[med-svn] r11705 - in trunk/packages/norsnet/trunk/debian: . example scr source

Christian Mertes mertes-guest at alioth.debian.org
Tue Jul 10 15:05:06 UTC 2012


Author: mertes-guest
Date: 2012-07-10 15:05:06 +0000 (Tue, 10 Jul 2012)
New Revision: 11705

Added:
   trunk/packages/norsnet/trunk/debian/AUTHORS
   trunk/packages/norsnet/trunk/debian/COPYING
   trunk/packages/norsnet/trunk/debian/ChangeLog
   trunk/packages/norsnet/trunk/debian/INSTALL
   trunk/packages/norsnet/trunk/debian/Makefile.am
   trunk/packages/norsnet/trunk/debian/Makefile.in
   trunk/packages/norsnet/trunk/debian/NEWS
   trunk/packages/norsnet/trunk/debian/README
   trunk/packages/norsnet/trunk/debian/aclocal.m4
   trunk/packages/norsnet/trunk/debian/configure
   trunk/packages/norsnet/trunk/debian/configure.ac
   trunk/packages/norsnet/trunk/debian/example/
   trunk/packages/norsnet/trunk/debian/example/Makefile.am
   trunk/packages/norsnet/trunk/debian/example/Makefile.in
   trunk/packages/norsnet/trunk/debian/example/cad23-fil.hssp
   trunk/packages/norsnet/trunk/debian/example/cad23-fil.rdbProf
   trunk/packages/norsnet/trunk/debian/example/cad23.f
   trunk/packages/norsnet/trunk/debian/example/cad23.norsnet
   trunk/packages/norsnet/trunk/debian/example/cad23.profbval
   trunk/packages/norsnet/trunk/debian/install-sh
   trunk/packages/norsnet/trunk/debian/missing
   trunk/packages/norsnet/trunk/debian/norsnet
   trunk/packages/norsnet/trunk/debian/norsnet.pod.in
   trunk/packages/norsnet/trunk/debian/scr/
   trunk/packages/norsnet/trunk/debian/scr/Makefile.am
   trunk/packages/norsnet/trunk/debian/scr/Makefile.in
   trunk/packages/norsnet/trunk/debian/scr/NORSnet.pl
   trunk/packages/norsnet/trunk/debian/scr/createDataFile.pl
   trunk/packages/norsnet/trunk/debian/scr/jct50-short
   trunk/packages/norsnet/trunk/debian/source/
   trunk/packages/norsnet/trunk/debian/source/format
Modified:
   trunk/packages/norsnet/trunk/debian/compat
   trunk/packages/norsnet/trunk/debian/watch
Log:
add new upstream

Added: trunk/packages/norsnet/trunk/debian/AUTHORS
===================================================================
--- trunk/packages/norsnet/trunk/debian/AUTHORS	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/AUTHORS	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1 @@
+Avner Schlessinger, Jinfeng Liu and Burkhard Rost

Added: trunk/packages/norsnet/trunk/debian/COPYING
===================================================================
--- trunk/packages/norsnet/trunk/debian/COPYING	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/COPYING	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,674 @@
+                    GNU GENERAL PUBLIC LICENSE
+                       Version 3, 29 June 2007
+
+ Copyright (C) 2007 Free Software Foundation, Inc. <http://fsf.org/>
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+
+                            Preamble
+
+  The GNU General Public License is a free, copyleft license for
+software and other kinds of works.
+
+  The licenses for most software and other practical works are designed
+to take away your freedom to share and change the works.  By contrast,
+the GNU General Public License is intended to guarantee your freedom to
+share and change all versions of a program--to make sure it remains free
+software for all its users.  We, the Free Software Foundation, use the
+GNU General Public License for most of our software; it applies also to
+any other work released this way by its authors.  You can apply it to
+your programs, too.
+
+  When we speak of free software, we are referring to freedom, not
+price.  Our General Public Licenses are designed to make sure that you
+have the freedom to distribute copies of free software (and charge for
+them if you wish), that you receive source code or can get it if you
+want it, that you can change the software or use pieces of it in new
+free programs, and that you know you can do these things.
+
+  To protect your rights, we need to prevent others from denying you
+these rights or asking you to surrender the rights.  Therefore, you have
+certain responsibilities if you distribute copies of the software, or if
+you modify it: responsibilities to respect the freedom of others.
+
+  For example, if you distribute copies of such a program, whether
+gratis or for a fee, you must pass on to the recipients the same
+freedoms that you received.  You must make sure that they, too, receive
+or can get the source code.  And you must show them these terms so they
+know their rights.
+
+  Developers that use the GNU GPL protect your rights with two steps:
+(1) assert copyright on the software, and (2) offer you this License
+giving you legal permission to copy, distribute and/or modify it.
+
+  For the developers' and authors' protection, the GPL clearly explains
+that there is no warranty for this free software.  For both users' and
+authors' sake, the GPL requires that modified versions be marked as
+changed, so that their problems will not be attributed erroneously to
+authors of previous versions.
+
+  Some devices are designed to deny users access to install or run
+modified versions of the software inside them, although the manufacturer
+can do so.  This is fundamentally incompatible with the aim of
+protecting users' freedom to change the software.  The systematic
+pattern of such abuse occurs in the area of products for individuals to
+use, which is precisely where it is most unacceptable.  Therefore, we
+have designed this version of the GPL to prohibit the practice for those
+products.  If such problems arise substantially in other domains, we
+stand ready to extend this provision to those domains in future versions
+of the GPL, as needed to protect the freedom of users.
+
+  Finally, every program is threatened constantly by software patents.
+States should not allow patents to restrict development and use of
+software on general-purpose computers, but in those that do, we wish to
+avoid the special danger that patents applied to a free program could
+make it effectively proprietary.  To prevent this, the GPL assures that
+patents cannot be used to render the program non-free.
+
+  The precise terms and conditions for copying, distribution and
+modification follow.
+
+                       TERMS AND CONDITIONS
+
+  0. Definitions.
+
+  "This License" refers to version 3 of the GNU General Public License.
+
+  "Copyright" also means copyright-like laws that apply to other kinds of
+works, such as semiconductor masks.
+
+  "The Program" refers to any copyrightable work licensed under this
+License.  Each licensee is addressed as "you".  "Licensees" and
+"recipients" may be individuals or organizations.
+
+  To "modify" a work means to copy from or adapt all or part of the work
+in a fashion requiring copyright permission, other than the making of an
+exact copy.  The resulting work is called a "modified version" of the
+earlier work or a work "based on" the earlier work.
+
+  A "covered work" means either the unmodified Program or a work based
+on the Program.
+
+  To "propagate" a work means to do anything with it that, without
+permission, would make you directly or secondarily liable for
+infringement under applicable copyright law, except executing it on a
+computer or modifying a private copy.  Propagation includes copying,
+distribution (with or without modification), making available to the
+public, and in some countries other activities as well.
+
+  To "convey" a work means any kind of propagation that enables other
+parties to make or receive copies.  Mere interaction with a user through
+a computer network, with no transfer of a copy, is not conveying.
+
+  An interactive user interface displays "Appropriate Legal Notices"
+to the extent that it includes a convenient and prominently visible
+feature that (1) displays an appropriate copyright notice, and (2)
+tells the user that there is no warranty for the work (except to the
+extent that warranties are provided), that licensees may convey the
+work under this License, and how to view a copy of this License.  If
+the interface presents a list of user commands or options, such as a
+menu, a prominent item in the list meets this criterion.
+
+  1. Source Code.
+
+  The "source code" for a work means the preferred form of the work
+for making modifications to it.  "Object code" means any non-source
+form of a work.
+
+  A "Standard Interface" means an interface that either is an official
+standard defined by a recognized standards body, or, in the case of
+interfaces specified for a particular programming language, one that
+is widely used among developers working in that language.
+
+  The "System Libraries" of an executable work include anything, other
+than the work as a whole, that (a) is included in the normal form of
+packaging a Major Component, but which is not part of that Major
+Component, and (b) serves only to enable use of the work with that
+Major Component, or to implement a Standard Interface for which an
+implementation is available to the public in source code form.  A
+"Major Component", in this context, means a major essential component
+(kernel, window system, and so on) of the specific operating system
+(if any) on which the executable work runs, or a compiler used to
+produce the work, or an object code interpreter used to run it.
+
+  The "Corresponding Source" for a work in object code form means all
+the source code needed to generate, install, and (for an executable
+work) run the object code and to modify the work, including scripts to
+control those activities.  However, it does not include the work's
+System Libraries, or general-purpose tools or generally available free
+programs which are used unmodified in performing those activities but
+which are not part of the work.  For example, Corresponding Source
+includes interface definition files associated with source files for
+the work, and the source code for shared libraries and dynamically
+linked subprograms that the work is specifically designed to require,
+such as by intimate data communication or control flow between those
+subprograms and other parts of the work.
+
+  The Corresponding Source need not include anything that users
+can regenerate automatically from other parts of the Corresponding
+Source.
+
+  The Corresponding Source for a work in source code form is that
+same work.
+
+  2. Basic Permissions.
+
+  All rights granted under this License are granted for the term of
+copyright on the Program, and are irrevocable provided the stated
+conditions are met.  This License explicitly affirms your unlimited
+permission to run the unmodified Program.  The output from running a
+covered work is covered by this License only if the output, given its
+content, constitutes a covered work.  This License acknowledges your
+rights of fair use or other equivalent, as provided by copyright law.
+
+  You may make, run and propagate covered works that you do not
+convey, without conditions so long as your license otherwise remains
+in force.  You may convey covered works to others for the sole purpose
+of having them make modifications exclusively for you, or provide you
+with facilities for running those works, provided that you comply with
+the terms of this License in conveying all material for which you do
+not control copyright.  Those thus making or running the covered works
+for you must do so exclusively on your behalf, under your direction
+and control, on terms that prohibit them from making any copies of
+your copyrighted material outside their relationship with you.
+
+  Conveying under any other circumstances is permitted solely under
+the conditions stated below.  Sublicensing is not allowed; section 10
+makes it unnecessary.
+
+  3. Protecting Users' Legal Rights From Anti-Circumvention Law.
+
+  No covered work shall be deemed part of an effective technological
+measure under any applicable law fulfilling obligations under article
+11 of the WIPO copyright treaty adopted on 20 December 1996, or
+similar laws prohibiting or restricting circumvention of such
+measures.
+
+  When you convey a covered work, you waive any legal power to forbid
+circumvention of technological measures to the extent such circumvention
+is effected by exercising rights under this License with respect to
+the covered work, and you disclaim any intention to limit operation or
+modification of the work as a means of enforcing, against the work's
+users, your or third parties' legal rights to forbid circumvention of
+technological measures.
+
+  4. Conveying Verbatim Copies.
+
+  You may convey verbatim copies of the Program's source code as you
+receive it, in any medium, provided that you conspicuously and
+appropriately publish on each copy an appropriate copyright notice;
+keep intact all notices stating that this License and any
+non-permissive terms added in accord with section 7 apply to the code;
+keep intact all notices of the absence of any warranty; and give all
+recipients a copy of this License along with the Program.
+
+  You may charge any price or no price for each copy that you convey,
+and you may offer support or warranty protection for a fee.
+
+  5. Conveying Modified Source Versions.
+
+  You may convey a work based on the Program, or the modifications to
+produce it from the Program, in the form of source code under the
+terms of section 4, provided that you also meet all of these conditions:
+
+    a) The work must carry prominent notices stating that you modified
+    it, and giving a relevant date.
+
+    b) The work must carry prominent notices stating that it is
+    released under this License and any conditions added under section
+    7.  This requirement modifies the requirement in section 4 to
+    "keep intact all notices".
+
+    c) You must license the entire work, as a whole, under this
+    License to anyone who comes into possession of a copy.  This
+    License will therefore apply, along with any applicable section 7
+    additional terms, to the whole of the work, and all its parts,
+    regardless of how they are packaged.  This License gives no
+    permission to license the work in any other way, but it does not
+    invalidate such permission if you have separately received it.
+
+    d) If the work has interactive user interfaces, each must display
+    Appropriate Legal Notices; however, if the Program has interactive
+    interfaces that do not display Appropriate Legal Notices, your
+    work need not make them do so.
+
+  A compilation of a covered work with other separate and independent
+works, which are not by their nature extensions of the covered work,
+and which are not combined with it such as to form a larger program,
+in or on a volume of a storage or distribution medium, is called an
+"aggregate" if the compilation and its resulting copyright are not
+used to limit the access or legal rights of the compilation's users
+beyond what the individual works permit.  Inclusion of a covered work
+in an aggregate does not cause this License to apply to the other
+parts of the aggregate.
+
+  6. Conveying Non-Source Forms.
+
+  You may convey a covered work in object code form under the terms
+of sections 4 and 5, provided that you also convey the
+machine-readable Corresponding Source under the terms of this License,
+in one of these ways:
+
+    a) Convey the object code in, or embodied in, a physical product
+    (including a physical distribution medium), accompanied by the
+    Corresponding Source fixed on a durable physical medium
+    customarily used for software interchange.
+
+    b) Convey the object code in, or embodied in, a physical product
+    (including a physical distribution medium), accompanied by a
+    written offer, valid for at least three years and valid for as
+    long as you offer spare parts or customer support for that product
+    model, to give anyone who possesses the object code either (1) a
+    copy of the Corresponding Source for all the software in the
+    product that is covered by this License, on a durable physical
+    medium customarily used for software interchange, for a price no
+    more than your reasonable cost of physically performing this
+    conveying of source, or (2) access to copy the
+    Corresponding Source from a network server at no charge.
+
+    c) Convey individual copies of the object code with a copy of the
+    written offer to provide the Corresponding Source.  This
+    alternative is allowed only occasionally and noncommercially, and
+    only if you received the object code with such an offer, in accord
+    with subsection 6b.
+
+    d) Convey the object code by offering access from a designated
+    place (gratis or for a charge), and offer equivalent access to the
+    Corresponding Source in the same way through the same place at no
+    further charge.  You need not require recipients to copy the
+    Corresponding Source along with the object code.  If the place to
+    copy the object code is a network server, the Corresponding Source
+    may be on a different server (operated by you or a third party)
+    that supports equivalent copying facilities, provided you maintain
+    clear directions next to the object code saying where to find the
+    Corresponding Source.  Regardless of what server hosts the
+    Corresponding Source, you remain obligated to ensure that it is
+    available for as long as needed to satisfy these requirements.
+
+    e) Convey the object code using peer-to-peer transmission, provided
+    you inform other peers where the object code and Corresponding
+    Source of the work are being offered to the general public at no
+    charge under subsection 6d.
+
+  A separable portion of the object code, whose source code is excluded
+from the Corresponding Source as a System Library, need not be
+included in conveying the object code work.
+
+  A "User Product" is either (1) a "consumer product", which means any
+tangible personal property which is normally used for personal, family,
+or household purposes, or (2) anything designed or sold for incorporation
+into a dwelling.  In determining whether a product is a consumer product,
+doubtful cases shall be resolved in favor of coverage.  For a particular
+product received by a particular user, "normally used" refers to a
+typical or common use of that class of product, regardless of the status
+of the particular user or of the way in which the particular user
+actually uses, or expects or is expected to use, the product.  A product
+is a consumer product regardless of whether the product has substantial
+commercial, industrial or non-consumer uses, unless such uses represent
+the only significant mode of use of the product.
+
+  "Installation Information" for a User Product means any methods,
+procedures, authorization keys, or other information required to install
+and execute modified versions of a covered work in that User Product from
+a modified version of its Corresponding Source.  The information must
+suffice to ensure that the continued functioning of the modified object
+code is in no case prevented or interfered with solely because
+modification has been made.
+
+  If you convey an object code work under this section in, or with, or
+specifically for use in, a User Product, and the conveying occurs as
+part of a transaction in which the right of possession and use of the
+User Product is transferred to the recipient in perpetuity or for a
+fixed term (regardless of how the transaction is characterized), the
+Corresponding Source conveyed under this section must be accompanied
+by the Installation Information.  But this requirement does not apply
+if neither you nor any third party retains the ability to install
+modified object code on the User Product (for example, the work has
+been installed in ROM).
+
+  The requirement to provide Installation Information does not include a
+requirement to continue to provide support service, warranty, or updates
+for a work that has been modified or installed by the recipient, or for
+the User Product in which it has been modified or installed.  Access to a
+network may be denied when the modification itself materially and
+adversely affects the operation of the network or violates the rules and
+protocols for communication across the network.
+
+  Corresponding Source conveyed, and Installation Information provided,
+in accord with this section must be in a format that is publicly
+documented (and with an implementation available to the public in
+source code form), and must require no special password or key for
+unpacking, reading or copying.
+
+  7. Additional Terms.
+
+  "Additional permissions" are terms that supplement the terms of this
+License by making exceptions from one or more of its conditions.
+Additional permissions that are applicable to the entire Program shall
+be treated as though they were included in this License, to the extent
+that they are valid under applicable law.  If additional permissions
+apply only to part of the Program, that part may be used separately
+under those permissions, but the entire Program remains governed by
+this License without regard to the additional permissions.
+
+  When you convey a copy of a covered work, you may at your option
+remove any additional permissions from that copy, or from any part of
+it.  (Additional permissions may be written to require their own
+removal in certain cases when you modify the work.)  You may place
+additional permissions on material, added by you to a covered work,
+for which you have or can give appropriate copyright permission.
+
+  Notwithstanding any other provision of this License, for material you
+add to a covered work, you may (if authorized by the copyright holders of
+that material) supplement the terms of this License with terms:
+
+    a) Disclaiming warranty or limiting liability differently from the
+    terms of sections 15 and 16 of this License; or
+
+    b) Requiring preservation of specified reasonable legal notices or
+    author attributions in that material or in the Appropriate Legal
+    Notices displayed by works containing it; or
+
+    c) Prohibiting misrepresentation of the origin of that material, or
+    requiring that modified versions of such material be marked in
+    reasonable ways as different from the original version; or
+
+    d) Limiting the use for publicity purposes of names of licensors or
+    authors of the material; or
+
+    e) Declining to grant rights under trademark law for use of some
+    trade names, trademarks, or service marks; or
+
+    f) Requiring indemnification of licensors and authors of that
+    material by anyone who conveys the material (or modified versions of
+    it) with contractual assumptions of liability to the recipient, for
+    any liability that these contractual assumptions directly impose on
+    those licensors and authors.
+
+  All other non-permissive additional terms are considered "further
+restrictions" within the meaning of section 10.  If the Program as you
+received it, or any part of it, contains a notice stating that it is
+governed by this License along with a term that is a further
+restriction, you may remove that term.  If a license document contains
+a further restriction but permits relicensing or conveying under this
+License, you may add to a covered work material governed by the terms
+of that license document, provided that the further restriction does
+not survive such relicensing or conveying.
+
+  If you add terms to a covered work in accord with this section, you
+must place, in the relevant source files, a statement of the
+additional terms that apply to those files, or a notice indicating
+where to find the applicable terms.
+
+  Additional terms, permissive or non-permissive, may be stated in the
+form of a separately written license, or stated as exceptions;
+the above requirements apply either way.
+
+  8. Termination.
+
+  You may not propagate or modify a covered work except as expressly
+provided under this License.  Any attempt otherwise to propagate or
+modify it is void, and will automatically terminate your rights under
+this License (including any patent licenses granted under the third
+paragraph of section 11).
+
+  However, if you cease all violation of this License, then your
+license from a particular copyright holder is reinstated (a)
+provisionally, unless and until the copyright holder explicitly and
+finally terminates your license, and (b) permanently, if the copyright
+holder fails to notify you of the violation by some reasonable means
+prior to 60 days after the cessation.
+
+  Moreover, your license from a particular copyright holder is
+reinstated permanently if the copyright holder notifies you of the
+violation by some reasonable means, this is the first time you have
+received notice of violation of this License (for any work) from that
+copyright holder, and you cure the violation prior to 30 days after
+your receipt of the notice.
+
+  Termination of your rights under this section does not terminate the
+licenses of parties who have received copies or rights from you under
+this License.  If your rights have been terminated and not permanently
+reinstated, you do not qualify to receive new licenses for the same
+material under section 10.
+
+  9. Acceptance Not Required for Having Copies.
+
+  You are not required to accept this License in order to receive or
+run a copy of the Program.  Ancillary propagation of a covered work
+occurring solely as a consequence of using peer-to-peer transmission
+to receive a copy likewise does not require acceptance.  However,
+nothing other than this License grants you permission to propagate or
+modify any covered work.  These actions infringe copyright if you do
+not accept this License.  Therefore, by modifying or propagating a
+covered work, you indicate your acceptance of this License to do so.
+
+  10. Automatic Licensing of Downstream Recipients.
+
+  Each time you convey a covered work, the recipient automatically
+receives a license from the original licensors, to run, modify and
+propagate that work, subject to this License.  You are not responsible
+for enforcing compliance by third parties with this License.
+
+  An "entity transaction" is a transaction transferring control of an
+organization, or substantially all assets of one, or subdividing an
+organization, or merging organizations.  If propagation of a covered
+work results from an entity transaction, each party to that
+transaction who receives a copy of the work also receives whatever
+licenses to the work the party's predecessor in interest had or could
+give under the previous paragraph, plus a right to possession of the
+Corresponding Source of the work from the predecessor in interest, if
+the predecessor has it or can get it with reasonable efforts.
+
+  You may not impose any further restrictions on the exercise of the
+rights granted or affirmed under this License.  For example, you may
+not impose a license fee, royalty, or other charge for exercise of
+rights granted under this License, and you may not initiate litigation
+(including a cross-claim or counterclaim in a lawsuit) alleging that
+any patent claim is infringed by making, using, selling, offering for
+sale, or importing the Program or any portion of it.
+
+  11. Patents.
+
+  A "contributor" is a copyright holder who authorizes use under this
+License of the Program or a work on which the Program is based.  The
+work thus licensed is called the contributor's "contributor version".
+
+  A contributor's "essential patent claims" are all patent claims
+owned or controlled by the contributor, whether already acquired or
+hereafter acquired, that would be infringed by some manner, permitted
+by this License, of making, using, or selling its contributor version,
+but do not include claims that would be infringed only as a
+consequence of further modification of the contributor version.  For
+purposes of this definition, "control" includes the right to grant
+patent sublicenses in a manner consistent with the requirements of
+this License.
+
+  Each contributor grants you a non-exclusive, worldwide, royalty-free
+patent license under the contributor's essential patent claims, to
+make, use, sell, offer for sale, import and otherwise run, modify and
+propagate the contents of its contributor version.
+
+  In the following three paragraphs, a "patent license" is any express
+agreement or commitment, however denominated, not to enforce a patent
+(such as an express permission to practice a patent or covenant not to
+sue for patent infringement).  To "grant" such a patent license to a
+party means to make such an agreement or commitment not to enforce a
+patent against the party.
+
+  If you convey a covered work, knowingly relying on a patent license,
+and the Corresponding Source of the work is not available for anyone
+to copy, free of charge and under the terms of this License, through a
+publicly available network server or other readily accessible means,
+then you must either (1) cause the Corresponding Source to be so
+available, or (2) arrange to deprive yourself of the benefit of the
+patent license for this particular work, or (3) arrange, in a manner
+consistent with the requirements of this License, to extend the patent
+license to downstream recipients.  "Knowingly relying" means you have
+actual knowledge that, but for the patent license, your conveying the
+covered work in a country, or your recipient's use of the covered work
+in a country, would infringe one or more identifiable patents in that
+country that you have reason to believe are valid.
+
+  If, pursuant to or in connection with a single transaction or
+arrangement, you convey, or propagate by procuring conveyance of, a
+covered work, and grant a patent license to some of the parties
+receiving the covered work authorizing them to use, propagate, modify
+or convey a specific copy of the covered work, then the patent license
+you grant is automatically extended to all recipients of the covered
+work and works based on it.
+
+  A patent license is "discriminatory" if it does not include within
+the scope of its coverage, prohibits the exercise of, or is
+conditioned on the non-exercise of one or more of the rights that are
+specifically granted under this License.  You may not convey a covered
+work if you are a party to an arrangement with a third party that is
+in the business of distributing software, under which you make payment
+to the third party based on the extent of your activity of conveying
+the work, and under which the third party grants, to any of the
+parties who would receive the covered work from you, a discriminatory
+patent license (a) in connection with copies of the covered work
+conveyed by you (or copies made from those copies), or (b) primarily
+for and in connection with specific products or compilations that
+contain the covered work, unless you entered into that arrangement,
+or that patent license was granted, prior to 28 March 2007.
+
+  Nothing in this License shall be construed as excluding or limiting
+any implied license or other defenses to infringement that may
+otherwise be available to you under applicable patent law.
+
+  12. No Surrender of Others' Freedom.
+
+  If conditions are imposed on you (whether by court order, agreement or
+otherwise) that contradict the conditions of this License, they do not
+excuse you from the conditions of this License.  If you cannot convey a
+covered work so as to satisfy simultaneously your obligations under this
+License and any other pertinent obligations, then as a consequence you may
+not convey it at all.  For example, if you agree to terms that obligate you
+to collect a royalty for further conveying from those to whom you convey
+the Program, the only way you could satisfy both those terms and this
+License would be to refrain entirely from conveying the Program.
+
+  13. Use with the GNU Affero General Public License.
+
+  Notwithstanding any other provision of this License, you have
+permission to link or combine any covered work with a work licensed
+under version 3 of the GNU Affero General Public License into a single
+combined work, and to convey the resulting work.  The terms of this
+License will continue to apply to the part which is the covered work,
+but the special requirements of the GNU Affero General Public License,
+section 13, concerning interaction through a network will apply to the
+combination as such.
+
+  14. Revised Versions of this License.
+
+  The Free Software Foundation may publish revised and/or new versions of
+the GNU General Public License from time to time.  Such new versions will
+be similar in spirit to the present version, but may differ in detail to
+address new problems or concerns.
+
+  Each version is given a distinguishing version number.  If the
+Program specifies that a certain numbered version of the GNU General
+Public License "or any later version" applies to it, you have the
+option of following the terms and conditions either of that numbered
+version or of any later version published by the Free Software
+Foundation.  If the Program does not specify a version number of the
+GNU General Public License, you may choose any version ever published
+by the Free Software Foundation.
+
+  If the Program specifies that a proxy can decide which future
+versions of the GNU General Public License can be used, that proxy's
+public statement of acceptance of a version permanently authorizes you
+to choose that version for the Program.
+
+  Later license versions may give you additional or different
+permissions.  However, no additional obligations are imposed on any
+author or copyright holder as a result of your choosing to follow a
+later version.
+
+  15. Disclaimer of Warranty.
+
+  THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY
+APPLICABLE LAW.  EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
+HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY
+OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO,
+THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
+PURPOSE.  THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM
+IS WITH YOU.  SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF
+ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
+
+  16. Limitation of Liability.
+
+  IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
+WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS
+THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY
+GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE
+USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF
+DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD
+PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS),
+EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF
+SUCH DAMAGES.
+
+  17. Interpretation of Sections 15 and 16.
+
+  If the disclaimer of warranty and limitation of liability provided
+above cannot be given local legal effect according to their terms,
+reviewing courts shall apply local law that most closely approximates
+an absolute waiver of all civil liability in connection with the
+Program, unless a warranty or assumption of liability accompanies a
+copy of the Program in return for a fee.
+
+                     END OF TERMS AND CONDITIONS
+
+            How to Apply These Terms to Your New Programs
+
+  If you develop a new program, and you want it to be of the greatest
+possible use to the public, the best way to achieve this is to make it
+free software which everyone can redistribute and change under these terms.
+
+  To do so, attach the following notices to the program.  It is safest
+to attach them to the start of each source file to most effectively
+state the exclusion of warranty; and each file should have at least
+the "copyright" line and a pointer to where the full notice is found.
+
+    <one line to give the program's name and a brief idea of what it does.>
+    Copyright (C) <year>  <name of author>
+
+    This program is free software: you can redistribute it and/or modify
+    it under the terms of the GNU General Public License as published by
+    the Free Software Foundation, either version 3 of the License, or
+    (at your option) any later version.
+
+    This program is distributed in the hope that it will be useful,
+    but WITHOUT ANY WARRANTY; without even the implied warranty of
+    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+    GNU General Public License for more details.
+
+    You should have received a copy of the GNU General Public License
+    along with this program.  If not, see <http://www.gnu.org/licenses/>.
+
+Also add information on how to contact you by electronic and paper mail.
+
+  If the program does terminal interaction, make it output a short
+notice like this when it starts in an interactive mode:
+
+    <program>  Copyright (C) <year>  <name of author>
+    This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'.
+    This is free software, and you are welcome to redistribute it
+    under certain conditions; type `show c' for details.
+
+The hypothetical commands `show w' and `show c' should show the appropriate
+parts of the General Public License.  Of course, your program's commands
+might be different; for a GUI interface, you would use an "about box".
+
+  You should also get your employer (if you work as a programmer) or school,
+if any, to sign a "copyright disclaimer" for the program, if necessary.
+For more information on this, and how to apply and follow the GNU GPL, see
+<http://www.gnu.org/licenses/>.
+
+  The GNU General Public License does not permit incorporating your program
+into proprietary programs.  If your program is a subroutine library, you
+may consider it more useful to permit linking proprietary applications with
+the library.  If this is what you want to do, use the GNU Lesser General
+Public License instead of this License.  But first, please read
+<http://www.gnu.org/philosophy/why-not-lgpl.html>.

Added: trunk/packages/norsnet/trunk/debian/ChangeLog
===================================================================
--- trunk/packages/norsnet/trunk/debian/ChangeLog	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/ChangeLog	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,88 @@
+norsnet (1.0.12) unstable; urgency=low
+
+  * Release under GPL-3+ license.
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Tue, 10 Jul 2012 13:09:57 +0200
+
+norsnet (1.0.11) unstable; urgency=low
+
+  * Debianization removed.
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Tue, 03 Jul 2012 19:46:27 +0200
+
+norsnet (1.0.10) stable; urgency=low
+
+  * warning when pp-popcon is not installed
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Mon, 28 Feb 2011 18:08:50 +0100
+
+norsnet (1.0.9) stable; urgency=low
+
+  * bugzilla link corrected
+  * pp-popularity-contest
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Fri, 18 Feb 2011 16:56:41 +0100
+
+norsnet (1.0.8) stable; urgency=low
+
+  * createDataFile.pl too restrictive regexp bug fixed
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Thu, 13 Jan 2011 15:10:44 +0100
+
+norsnet (1.0.7-1) stable; urgency=low
+
+  * New upstream release
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Wed, 30 Jun 2010 13:29:07 +0200
+
+norsnet (1.0.7)
+
+  * Silence in non-debug mode - correctly this time
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Wed, 30 Jun 2010 13:07:02 +0200
+
+norsnet (1.0.6)
+
+  * Silence in non-debug mode
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Thu, 17 Jun 2010 20:32:58 +0200
+
+norsnet (1.0.5)
+
+  * Example without gzip
+  * Output mode 1 documented
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Thu, 17 Jun 2010 12:38:03 +0200
+
+norsnet (1.0.4)
+
+  * Fixed __pkgdatadir__ paths
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Tue, 16 Mar 2010 17:55:41 +0100
+
+norsnet (1.0.3)
+
+  * Fixed version, this actually produces results
+  * Now calls profnet_norsnet and not profnet_bval
+  * Fixed mode 6 issue - there is only mode 1, 2 and 3
+  * Introduced automake + autoconf
+
+ -- Laszlo Kajan <lkajan at rostlab.org>  Tue, 16 Mar 2010 17:55:41 +0100
+
+norsnet (1.0.2)
+
+  * Minor revision.
+
+ -- Guy Yachdav <gyahcdav at rostlab.org>  Thu, 10 Dec 2009 22:57:15 +0100
+
+norsnet (1.0.1)
+
+  * Minor revision.
+
+ -- Guy Yachdav <gyahcdav at rostlab.org>  Thu, 10 Dec 2009 22:40:15 +0100
+
+norsnet (1.0.0)
+
+  * Initial version.
+
+ -- Guy Yachdav <gyahcdav at rostlab.org>  Thu, 10 Dec 2009 22:32:15 +0100

Added: trunk/packages/norsnet/trunk/debian/INSTALL
===================================================================
--- trunk/packages/norsnet/trunk/debian/INSTALL	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/INSTALL	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,370 @@
+Installation Instructions
+*************************
+
+Copyright (C) 1994-1996, 1999-2002, 2004-2011 Free Software Foundation,
+Inc.
+
+   Copying and distribution of this file, with or without modification,
+are permitted in any medium without royalty provided the copyright
+notice and this notice are preserved.  This file is offered as-is,
+without warranty of any kind.
+
+Basic Installation
+==================
+
+   Briefly, the shell commands `./configure; make; make install' should
+configure, build, and install this package.  The following
+more-detailed instructions are generic; see the `README' file for
+instructions specific to this package.  Some packages provide this
+`INSTALL' file but do not implement all of the features documented
+below.  The lack of an optional feature in a given package is not
+necessarily a bug.  More recommendations for GNU packages can be found
+in *note Makefile Conventions: (standards)Makefile Conventions.
+
+   The `configure' shell script attempts to guess correct values for
+various system-dependent variables used during compilation.  It uses
+those values to create a `Makefile' in each directory of the package.
+It may also create one or more `.h' files containing system-dependent
+definitions.  Finally, it creates a shell script `config.status' that
+you can run in the future to recreate the current configuration, and a
+file `config.log' containing compiler output (useful mainly for
+debugging `configure').
+
+   It can also use an optional file (typically called `config.cache'
+and enabled with `--cache-file=config.cache' or simply `-C') that saves
+the results of its tests to speed up reconfiguring.  Caching is
+disabled by default to prevent problems with accidental use of stale
+cache files.
+
+   If you need to do unusual things to compile the package, please try
+to figure out how `configure' could check whether to do them, and mail
+diffs or instructions to the address given in the `README' so they can
+be considered for the next release.  If you are using the cache, and at
+some point `config.cache' contains results you don't want to keep, you
+may remove or edit it.
+
+   The file `configure.ac' (or `configure.in') is used to create
+`configure' by a program called `autoconf'.  You need `configure.ac' if
+you want to change it or regenerate `configure' using a newer version
+of `autoconf'.
+
+   The simplest way to compile this package is:
+
+  1. `cd' to the directory containing the package's source code and type
+     `./configure' to configure the package for your system.
+
+     Running `configure' might take a while.  While running, it prints
+     some messages telling which features it is checking for.
+
+  2. Type `make' to compile the package.
+
+  3. Optionally, type `make check' to run any self-tests that come with
+     the package, generally using the just-built uninstalled binaries.
+
+  4. Type `make install' to install the programs and any data files and
+     documentation.  When installing into a prefix owned by root, it is
+     recommended that the package be configured and built as a regular
+     user, and only the `make install' phase executed with root
+     privileges.
+
+  5. Optionally, type `make installcheck' to repeat any self-tests, but
+     this time using the binaries in their final installed location.
+     This target does not install anything.  Running this target as a
+     regular user, particularly if the prior `make install' required
+     root privileges, verifies that the installation completed
+     correctly.
+
+  6. You can remove the program binaries and object files from the
+     source code directory by typing `make clean'.  To also remove the
+     files that `configure' created (so you can compile the package for
+     a different kind of computer), type `make distclean'.  There is
+     also a `make maintainer-clean' target, but that is intended mainly
+     for the package's developers.  If you use it, you may have to get
+     all sorts of other programs in order to regenerate files that came
+     with the distribution.
+
+  7. Often, you can also type `make uninstall' to remove the installed
+     files again.  In practice, not all packages have tested that
+     uninstallation works correctly, even though it is required by the
+     GNU Coding Standards.
+
+  8. Some packages, particularly those that use Automake, provide `make
+     distcheck', which can by used by developers to test that all other
+     targets like `make install' and `make uninstall' work correctly.
+     This target is generally not run by end users.
+
+Compilers and Options
+=====================
+
+   Some systems require unusual options for compilation or linking that
+the `configure' script does not know about.  Run `./configure --help'
+for details on some of the pertinent environment variables.
+
+   You can give `configure' initial values for configuration parameters
+by setting variables in the command line or in the environment.  Here
+is an example:
+
+     ./configure CC=c99 CFLAGS=-g LIBS=-lposix
+
+   *Note Defining Variables::, for more details.
+
+Compiling For Multiple Architectures
+====================================
+
+   You can compile the package for more than one kind of computer at the
+same time, by placing the object files for each architecture in their
+own directory.  To do this, you can use GNU `make'.  `cd' to the
+directory where you want the object files and executables to go and run
+the `configure' script.  `configure' automatically checks for the
+source code in the directory that `configure' is in and in `..'.  This
+is known as a "VPATH" build.
+
+   With a non-GNU `make', it is safer to compile the package for one
+architecture at a time in the source code directory.  After you have
+installed the package for one architecture, use `make distclean' before
+reconfiguring for another architecture.
+
+   On MacOS X 10.5 and later systems, you can create libraries and
+executables that work on multiple system types--known as "fat" or
+"universal" binaries--by specifying multiple `-arch' options to the
+compiler but only a single `-arch' option to the preprocessor.  Like
+this:
+
+     ./configure CC="gcc -arch i386 -arch x86_64 -arch ppc -arch ppc64" \
+                 CXX="g++ -arch i386 -arch x86_64 -arch ppc -arch ppc64" \
+                 CPP="gcc -E" CXXCPP="g++ -E"
+
+   This is not guaranteed to produce working output in all cases, you
+may have to build one architecture at a time and combine the results
+using the `lipo' tool if you have problems.
+
+Installation Names
+==================
+
+   By default, `make install' installs the package's commands under
+`/usr/local/bin', include files under `/usr/local/include', etc.  You
+can specify an installation prefix other than `/usr/local' by giving
+`configure' the option `--prefix=PREFIX', where PREFIX must be an
+absolute file name.
+
+   You can specify separate installation prefixes for
+architecture-specific files and architecture-independent files.  If you
+pass the option `--exec-prefix=PREFIX' to `configure', the package uses
+PREFIX as the prefix for installing programs and libraries.
+Documentation and other data files still use the regular prefix.
+
+   In addition, if you use an unusual directory layout you can give
+options like `--bindir=DIR' to specify different values for particular
+kinds of files.  Run `configure --help' for a list of the directories
+you can set and what kinds of files go in them.  In general, the
+default for these options is expressed in terms of `${prefix}', so that
+specifying just `--prefix' will affect all of the other directory
+specifications that were not explicitly provided.
+
+   The most portable way to affect installation locations is to pass the
+correct locations to `configure'; however, many packages provide one or
+both of the following shortcuts of passing variable assignments to the
+`make install' command line to change installation locations without
+having to reconfigure or recompile.
+
+   The first method involves providing an override variable for each
+affected directory.  For example, `make install
+prefix=/alternate/directory' will choose an alternate location for all
+directory configuration variables that were expressed in terms of
+`${prefix}'.  Any directories that were specified during `configure',
+but not in terms of `${prefix}', must each be overridden at install
+time for the entire installation to be relocated.  The approach of
+makefile variable overrides for each directory variable is required by
+the GNU Coding Standards, and ideally causes no recompilation.
+However, some platforms have known limitations with the semantics of
+shared libraries that end up requiring recompilation when using this
+method, particularly noticeable in packages that use GNU Libtool.
+
+   The second method involves providing the `DESTDIR' variable.  For
+example, `make install DESTDIR=/alternate/directory' will prepend
+`/alternate/directory' before all installation names.  The approach of
+`DESTDIR' overrides is not required by the GNU Coding Standards, and
+does not work on platforms that have drive letters.  On the other hand,
+it does better at avoiding recompilation issues, and works well even
+when some directory options were not specified in terms of `${prefix}'
+at `configure' time.
+
+Optional Features
+=================
+
+   If the package supports it, you can cause programs to be installed
+with an extra prefix or suffix on their names by giving `configure' the
+option `--program-prefix=PREFIX' or `--program-suffix=SUFFIX'.
+
+   Some packages pay attention to `--enable-FEATURE' options to
+`configure', where FEATURE indicates an optional part of the package.
+They may also pay attention to `--with-PACKAGE' options, where PACKAGE
+is something like `gnu-as' or `x' (for the X Window System).  The
+`README' should mention any `--enable-' and `--with-' options that the
+package recognizes.
+
+   For packages that use the X Window System, `configure' can usually
+find the X include and library files automatically, but if it doesn't,
+you can use the `configure' options `--x-includes=DIR' and
+`--x-libraries=DIR' to specify their locations.
+
+   Some packages offer the ability to configure how verbose the
+execution of `make' will be.  For these packages, running `./configure
+--enable-silent-rules' sets the default to minimal output, which can be
+overridden with `make V=1'; while running `./configure
+--disable-silent-rules' sets the default to verbose, which can be
+overridden with `make V=0'.
+
+Particular systems
+==================
+
+   On HP-UX, the default C compiler is not ANSI C compatible.  If GNU
+CC is not installed, it is recommended to use the following options in
+order to use an ANSI C compiler:
+
+     ./configure CC="cc -Ae -D_XOPEN_SOURCE=500"
+
+and if that doesn't work, install pre-built binaries of GCC for HP-UX.
+
+   HP-UX `make' updates targets which have the same time stamps as
+their prerequisites, which makes it generally unusable when shipped
+generated files such as `configure' are involved.  Use GNU `make'
+instead.
+
+   On OSF/1 a.k.a. Tru64, some versions of the default C compiler cannot
+parse its `<wchar.h>' header file.  The option `-nodtk' can be used as
+a workaround.  If GNU CC is not installed, it is therefore recommended
+to try
+
+     ./configure CC="cc"
+
+and if that doesn't work, try
+
+     ./configure CC="cc -nodtk"
+
+   On Solaris, don't put `/usr/ucb' early in your `PATH'.  This
+directory contains several dysfunctional programs; working variants of
+these programs are available in `/usr/bin'.  So, if you need `/usr/ucb'
+in your `PATH', put it _after_ `/usr/bin'.
+
+   On Haiku, software installed for all users goes in `/boot/common',
+not `/usr/local'.  It is recommended to use the following options:
+
+     ./configure --prefix=/boot/common
+
+Specifying the System Type
+==========================
+
+   There may be some features `configure' cannot figure out
+automatically, but needs to determine by the type of machine the package
+will run on.  Usually, assuming the package is built to be run on the
+_same_ architectures, `configure' can figure that out, but if it prints
+a message saying it cannot guess the machine type, give it the
+`--build=TYPE' option.  TYPE can either be a short name for the system
+type, such as `sun4', or a canonical name which has the form:
+
+     CPU-COMPANY-SYSTEM
+
+where SYSTEM can have one of these forms:
+
+     OS
+     KERNEL-OS
+
+   See the file `config.sub' for the possible values of each field.  If
+`config.sub' isn't included in this package, then this package doesn't
+need to know the machine type.
+
+   If you are _building_ compiler tools for cross-compiling, you should
+use the option `--target=TYPE' to select the type of system they will
+produce code for.
+
+   If you want to _use_ a cross compiler, that generates code for a
+platform different from the build platform, you should specify the
+"host" platform (i.e., that on which the generated programs will
+eventually be run) with `--host=TYPE'.
+
+Sharing Defaults
+================
+
+   If you want to set default values for `configure' scripts to share,
+you can create a site shell script called `config.site' that gives
+default values for variables like `CC', `cache_file', and `prefix'.
+`configure' looks for `PREFIX/share/config.site' if it exists, then
+`PREFIX/etc/config.site' if it exists.  Or, you can set the
+`CONFIG_SITE' environment variable to the location of the site script.
+A warning: not all `configure' scripts look for a site script.
+
+Defining Variables
+==================
+
+   Variables not defined in a site shell script can be set in the
+environment passed to `configure'.  However, some packages may run
+configure again during the build, and the customized values of these
+variables may be lost.  In order to avoid this problem, you should set
+them in the `configure' command line, using `VAR=value'.  For example:
+
+     ./configure CC=/usr/local2/bin/gcc
+
+causes the specified `gcc' to be used as the C compiler (unless it is
+overridden in the site shell script).
+
+Unfortunately, this technique does not work for `CONFIG_SHELL' due to
+an Autoconf bug.  Until the bug is fixed you can use this workaround:
+
+     CONFIG_SHELL=/bin/bash /bin/bash ./configure CONFIG_SHELL=/bin/bash
+
+`configure' Invocation
+======================
+
+   `configure' recognizes the following options to control how it
+operates.
+
+`--help'
+`-h'
+     Print a summary of all of the options to `configure', and exit.
+
+`--help=short'
+`--help=recursive'
+     Print a summary of the options unique to this package's
+     `configure', and exit.  The `short' variant lists options used
+     only in the top level, while the `recursive' variant lists options
+     also present in any nested packages.
+
+`--version'
+`-V'
+     Print the version of Autoconf used to generate the `configure'
+     script, and exit.
+
+`--cache-file=FILE'
+     Enable the cache: use and save the results of the tests in FILE,
+     traditionally `config.cache'.  FILE defaults to `/dev/null' to
+     disable caching.
+
+`--config-cache'
+`-C'
+     Alias for `--cache-file=config.cache'.
+
+`--quiet'
+`--silent'
+`-q'
+     Do not print messages saying which checks are being made.  To
+     suppress all normal output, redirect it to `/dev/null' (any error
+     messages will still be shown).
+
+`--srcdir=DIR'
+     Look for the package's source code in directory DIR.  Usually
+     `configure' can determine that directory automatically.
+
+`--prefix=DIR'
+     Use DIR as the installation prefix.  *note Installation Names::
+     for more details, including other options available for fine-tuning
+     the installation locations.
+
+`--no-create'
+`-n'
+     Run the configure checks, but stop before creating any output
+     files.
+
+`configure' also accepts some other, not widely useful, options.  Run
+`configure --help' for more details.
+

Added: trunk/packages/norsnet/trunk/debian/Makefile.am
===================================================================
--- trunk/packages/norsnet/trunk/debian/Makefile.am	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/Makefile.am	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,29 @@
+SUBDIRS = scr example
+
+man_MANS = norsnet.1
+
+dist_noinst_DATA = norsnet.pod.in
+dist_bin_SCRIPTS = norsnet
+
+norsnet.pod:	norsnet.pod.in
+	sed -e 's|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;' "$<" > "$@"
+
+norsnet.1:	norsnet.pod
+	pod2man -c 'User Commands' -r "$(VERSION)" $< $@
+
+distclean-local:
+	rm -f norsnet.pod norsnet.1 norsnet
+
+dist-hook:
+	rm -rf `find $(distdir) -name .svn`
+
+install-data-local:
+
+install-data-hook:
+
+install-exec-hook:
+	sed -i -e 's|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' "$(DESTDIR)$(bindir)/norsnet"
+
+uninstall-local:
+	rm -rf "$(DESTDIR)$(pkgdatadir)" "$(DESTDIR)$(docdir)"
+

Added: trunk/packages/norsnet/trunk/debian/Makefile.in
===================================================================
--- trunk/packages/norsnet/trunk/debian/Makefile.in	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/Makefile.in	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,797 @@
+# Makefile.in generated by automake 1.11.1 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004, 2005, 2006, 2007, 2008, 2009  Free Software Foundation,
+# Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+
+
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkglibexecdir = $(libexecdir)/@PACKAGE@
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+subdir = .
+DIST_COMMON = README $(am__configure_deps) $(dist_bin_SCRIPTS) \
+	$(dist_noinst_DATA) $(srcdir)/Makefile.am \
+	$(srcdir)/Makefile.in $(top_srcdir)/configure AUTHORS COPYING \
+	ChangeLog INSTALL NEWS install-sh missing
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/configure.ac
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \
+ configure.lineno config.status.lineno
+mkinstalldirs = $(install_sh) -d
+CONFIG_CLEAN_FILES =
+CONFIG_CLEAN_VPATH_FILES =
+am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`;
+am__vpath_adj = case $$p in \
+    $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \
+    *) f=$$p;; \
+  esac;
+am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`;
+am__install_max = 40
+am__nobase_strip_setup = \
+  srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'`
+am__nobase_strip = \
+  for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||"
+am__nobase_list = $(am__nobase_strip_setup); \
+  for p in $$list; do echo "$$p $$p"; done | \
+  sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \
+  $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \
+    if (++n[$$2] == $(am__install_max)) \
+      { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \
+    END { for (dir in files) print dir, files[dir] }'
+am__base_list = \
+  sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \
+  sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g'
+am__installdirs = "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)"
+SCRIPTS = $(dist_bin_SCRIPTS)
+SOURCES =
+DIST_SOURCES =
+RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \
+	html-recursive info-recursive install-data-recursive \
+	install-dvi-recursive install-exec-recursive \
+	install-html-recursive install-info-recursive \
+	install-pdf-recursive install-ps-recursive install-recursive \
+	installcheck-recursive installdirs-recursive pdf-recursive \
+	ps-recursive uninstall-recursive
+man1dir = $(mandir)/man1
+NROFF = nroff
+MANS = $(man_MANS)
+DATA = $(dist_noinst_DATA)
+RECURSIVE_CLEAN_TARGETS = mostlyclean-recursive clean-recursive	\
+  distclean-recursive maintainer-clean-recursive
+AM_RECURSIVE_TARGETS = $(RECURSIVE_TARGETS:-recursive=) \
+	$(RECURSIVE_CLEAN_TARGETS:-recursive=) tags TAGS ctags CTAGS \
+	distdir dist dist-all distcheck
+ETAGS = etags
+CTAGS = ctags
+DIST_SUBDIRS = $(SUBDIRS)
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+distdir = $(PACKAGE)-$(VERSION)
+top_distdir = $(distdir)
+am__remove_distdir = \
+  { test ! -d "$(distdir)" \
+    || { find "$(distdir)" -type d ! -perm -200 -exec chmod u+w {} ';' \
+         && rm -fr "$(distdir)"; }; }
+am__relativize = \
+  dir0=`pwd`; \
+  sed_first='s,^\([^/]*\)/.*$$,\1,'; \
+  sed_rest='s,^[^/]*/*,,'; \
+  sed_last='s,^.*/\([^/]*\)$$,\1,'; \
+  sed_butlast='s,/*[^/]*$$,,'; \
+  while test -n "$$dir1"; do \
+    first=`echo "$$dir1" | sed -e "$$sed_first"`; \
+    if test "$$first" != "."; then \
+      if test "$$first" = ".."; then \
+        dir2=`echo "$$dir0" | sed -e "$$sed_last"`/"$$dir2"; \
+        dir0=`echo "$$dir0" | sed -e "$$sed_butlast"`; \
+      else \
+        first2=`echo "$$dir2" | sed -e "$$sed_first"`; \
+        if test "$$first2" = "$$first"; then \
+          dir2=`echo "$$dir2" | sed -e "$$sed_rest"`; \
+        else \
+          dir2="../$$dir2"; \
+        fi; \
+        dir0="$$dir0"/"$$first"; \
+      fi; \
+    fi; \
+    dir1=`echo "$$dir1" | sed -e "$$sed_rest"`; \
+  done; \
+  reldir="$$dir2"
+DIST_ARCHIVES = $(distdir).tar.gz
+GZIP_ENV = --best
+distuninstallcheck_listfiles = find . -type f -print
+distcleancheck_listfiles = find . -type f -print
+ACLOCAL = @ACLOCAL@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+INSTALL = @INSTALL@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+MKDIR_P = @MKDIR_P@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_URL = @PACKAGE_URL@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+VERSION = @VERSION@
+abs_builddir = @abs_builddir@
+abs_srcdir = @abs_srcdir@
+abs_top_builddir = @abs_top_builddir@
+abs_top_srcdir = @abs_top_srcdir@
+am__leading_dot = @am__leading_dot@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build_alias = @build_alias@
+builddir = @builddir@
+datadir = @datadir@
+datarootdir = @datarootdir@
+docdir = @docdir@
+dvidir = @dvidir@
+exec_prefix = @exec_prefix@
+host_alias = @host_alias@
+htmldir = @htmldir@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localedir = @localedir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+pdfdir = @pdfdir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+psdir = @psdir@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+srcdir = @srcdir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+top_build_prefix = @top_build_prefix@
+top_builddir = @top_builddir@
+top_srcdir = @top_srcdir@
+SUBDIRS = scr example
+man_MANS = norsnet.1
+dist_noinst_DATA = norsnet.pod.in
+dist_bin_SCRIPTS = norsnet
+all: all-recursive
+
+.SUFFIXES:
+am--refresh:
+	@:
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      echo ' cd $(srcdir) && $(AUTOMAKE) --gnu'; \
+	      $(am__cd) $(srcdir) && $(AUTOMAKE) --gnu \
+		&& exit 0; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu Makefile'; \
+	$(am__cd) $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    echo ' $(SHELL) ./config.status'; \
+	    $(SHELL) ./config.status;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	$(SHELL) ./config.status --recheck
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	$(am__cd) $(srcdir) && $(AUTOCONF)
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	$(am__cd) $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS)
+$(am__aclocal_m4_deps):
+install-dist_binSCRIPTS: $(dist_bin_SCRIPTS)
+	@$(NORMAL_INSTALL)
+	test -z "$(bindir)" || $(MKDIR_P) "$(DESTDIR)$(bindir)"
+	@list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || list=; \
+	for p in $$list; do \
+	  if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \
+	  if test -f "$$d$$p"; then echo "$$d$$p"; echo "$$p"; else :; fi; \
+	done | \
+	sed -e 'p;s,.*/,,;n' \
+	    -e 'h;s|.*|.|' \
+	    -e 'p;x;s,.*/,,;$(transform)' | sed 'N;N;N;s,\n, ,g' | \
+	$(AWK) 'BEGIN { files["."] = ""; dirs["."] = 1; } \
+	  { d=$$3; if (dirs[d] != 1) { print "d", d; dirs[d] = 1 } \
+	    if ($$2 == $$4) { files[d] = files[d] " " $$1; \
+	      if (++n[d] == $(am__install_max)) { \
+		print "f", d, files[d]; n[d] = 0; files[d] = "" } } \
+	    else { print "f", d "/" $$4, $$1 } } \
+	  END { for (d in files) print "f", d, files[d] }' | \
+	while read type dir files; do \
+	     if test "$$dir" = .; then dir=; else dir=/$$dir; fi; \
+	     test -z "$$files" || { \
+	       echo " $(INSTALL_SCRIPT) $$files '$(DESTDIR)$(bindir)$$dir'"; \
+	       $(INSTALL_SCRIPT) $$files "$(DESTDIR)$(bindir)$$dir" || exit $$?; \
+	     } \
+	; done
+
+uninstall-dist_binSCRIPTS:
+	@$(NORMAL_UNINSTALL)
+	@list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || exit 0; \
+	files=`for p in $$list; do echo "$$p"; done | \
+	       sed -e 's,.*/,,;$(transform)'`; \
+	test -n "$$list" || exit 0; \
+	echo " ( cd '$(DESTDIR)$(bindir)' && rm -f" $$files ")"; \
+	cd "$(DESTDIR)$(bindir)" && rm -f $$files
+install-man1: $(man_MANS)
+	@$(NORMAL_INSTALL)
+	test -z "$(man1dir)" || $(MKDIR_P) "$(DESTDIR)$(man1dir)"
+	@list=''; test -n "$(man1dir)" || exit 0; \
+	{ for i in $$list; do echo "$$i"; done; \
+	l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \
+	  sed -n '/\.1[a-z]*$$/p'; \
+	} | while read p; do \
+	  if test -f $$p; then d=; else d="$(srcdir)/"; fi; \
+	  echo "$$d$$p"; echo "$$p"; \
+	done | \
+	sed -e 'n;s,.*/,,;p;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \
+	      -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,' | \
+	sed 'N;N;s,\n, ,g' | { \
+	list=; while read file base inst; do \
+	  if test "$$base" = "$$inst"; then list="$$list $$file"; else \
+	    echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man1dir)/$$inst'"; \
+	    $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man1dir)/$$inst" || exit $$?; \
+	  fi; \
+	done; \
+	for i in $$list; do echo "$$i"; done | $(am__base_list) | \
+	while read files; do \
+	  test -z "$$files" || { \
+	    echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(man1dir)'"; \
+	    $(INSTALL_DATA) $$files "$(DESTDIR)$(man1dir)" || exit $$?; }; \
+	done; }
+
+uninstall-man1:
+	@$(NORMAL_UNINSTALL)
+	@list=''; test -n "$(man1dir)" || exit 0; \
+	files=`{ for i in $$list; do echo "$$i"; done; \
+	l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \
+	  sed -n '/\.1[a-z]*$$/p'; \
+	} | sed -e 's,.*/,,;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \
+	      -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,'`; \
+	test -z "$$files" || { \
+	  echo " ( cd '$(DESTDIR)$(man1dir)' && rm -f" $$files ")"; \
+	  cd "$(DESTDIR)$(man1dir)" && rm -f $$files; }
+
+# This directory's subdirectories are mostly independent; you can cd
+# into them and run `make' without going through this Makefile.
+# To change the values of `make' variables: instead of editing Makefiles,
+# (1) if the variable is set in `config.status', edit `config.status'
+#     (which will cause the Makefiles to be regenerated when you run `make');
+# (2) otherwise, pass the desired values on the `make' command line.
+$(RECURSIVE_TARGETS):
+	@fail= failcom='exit 1'; \
+	for f in x $$MAKEFLAGS; do \
+	  case $$f in \
+	    *=* | --[!k]*);; \
+	    *k*) failcom='fail=yes';; \
+	  esac; \
+	done; \
+	dot_seen=no; \
+	target=`echo $@ | sed s/-recursive//`; \
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  echo "Making $$target in $$subdir"; \
+	  if test "$$subdir" = "."; then \
+	    dot_seen=yes; \
+	    local_target="$$target-am"; \
+	  else \
+	    local_target="$$target"; \
+	  fi; \
+	  ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \
+	  || eval $$failcom; \
+	done; \
+	if test "$$dot_seen" = "no"; then \
+	  $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \
+	fi; test -z "$$fail"
+
+$(RECURSIVE_CLEAN_TARGETS):
+	@fail= failcom='exit 1'; \
+	for f in x $$MAKEFLAGS; do \
+	  case $$f in \
+	    *=* | --[!k]*);; \
+	    *k*) failcom='fail=yes';; \
+	  esac; \
+	done; \
+	dot_seen=no; \
+	case "$@" in \
+	  distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \
+	  *) list='$(SUBDIRS)' ;; \
+	esac; \
+	rev=''; for subdir in $$list; do \
+	  if test "$$subdir" = "."; then :; else \
+	    rev="$$subdir $$rev"; \
+	  fi; \
+	done; \
+	rev="$$rev ."; \
+	target=`echo $@ | sed s/-recursive//`; \
+	for subdir in $$rev; do \
+	  echo "Making $$target in $$subdir"; \
+	  if test "$$subdir" = "."; then \
+	    local_target="$$target-am"; \
+	  else \
+	    local_target="$$target"; \
+	  fi; \
+	  ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \
+	  || eval $$failcom; \
+	done && test -z "$$fail"
+tags-recursive:
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \
+	done
+ctags-recursive:
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \
+	done
+
+ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES)
+	list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '{ files[$$0] = 1; nonempty = 1; } \
+	      END { if (nonempty) { for (i in files) print i; }; }'`; \
+	mkid -fID $$unique
+tags: TAGS
+
+TAGS: tags-recursive $(HEADERS) $(SOURCES)  $(TAGS_DEPENDENCIES) \
+		$(TAGS_FILES) $(LISP)
+	set x; \
+	here=`pwd`; \
+	if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \
+	  include_option=--etags-include; \
+	  empty_fix=.; \
+	else \
+	  include_option=--include; \
+	  empty_fix=; \
+	fi; \
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  if test "$$subdir" = .; then :; else \
+	    test ! -f $$subdir/TAGS || \
+	      set "$$@" "$$include_option=$$here/$$subdir/TAGS"; \
+	  fi; \
+	done; \
+	list='$(SOURCES) $(HEADERS)  $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '{ files[$$0] = 1; nonempty = 1; } \
+	      END { if (nonempty) { for (i in files) print i; }; }'`; \
+	shift; \
+	if test -z "$(ETAGS_ARGS)$$*$$unique"; then :; else \
+	  test -n "$$unique" || unique=$$empty_fix; \
+	  if test $$# -gt 0; then \
+	    $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \
+	      "$$@" $$unique; \
+	  else \
+	    $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \
+	      $$unique; \
+	  fi; \
+	fi
+ctags: CTAGS
+CTAGS: ctags-recursive $(HEADERS) $(SOURCES)  $(TAGS_DEPENDENCIES) \
+		$(TAGS_FILES) $(LISP)
+	list='$(SOURCES) $(HEADERS)  $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '{ files[$$0] = 1; nonempty = 1; } \
+	      END { if (nonempty) { for (i in files) print i; }; }'`; \
+	test -z "$(CTAGS_ARGS)$$unique" \
+	  || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \
+	     $$unique
+
+GTAGS:
+	here=`$(am__cd) $(top_builddir) && pwd` \
+	  && $(am__cd) $(top_srcdir) \
+	  && gtags -i $(GTAGS_ARGS) "$$here"
+
+distclean-tags:
+	-rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags
+
+distdir: $(DISTFILES)
+	@list='$(MANS)'; if test -n "$$list"; then \
+	  list=`for p in $$list; do \
+	    if test -f $$p; then d=; else d="$(srcdir)/"; fi; \
+	    if test -f "$$d$$p"; then echo "$$d$$p"; else :; fi; done`; \
+	  if test -n "$$list" && \
+	    grep 'ab help2man is required to generate this page' $$list >/dev/null; then \
+	    echo "error: found man pages containing the \`missing help2man' replacement text:" >&2; \
+	    grep -l 'ab help2man is required to generate this page' $$list | sed 's/^/         /' >&2; \
+	    echo "       to fix them, install help2man, remove and regenerate the man pages;" >&2; \
+	    echo "       typically \`make maintainer-clean' will remove them" >&2; \
+	    exit 1; \
+	  else :; fi; \
+	else :; fi
+	$(am__remove_distdir)
+	test -d "$(distdir)" || mkdir "$(distdir)"
+	@srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+	list='$(DISTFILES)'; \
+	  dist_files=`for file in $$list; do echo $$file; done | \
+	  sed -e "s|^$$srcdirstrip/||;t" \
+	      -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \
+	case $$dist_files in \
+	  */*) $(MKDIR_P) `echo "$$dist_files" | \
+			   sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \
+			   sort -u` ;; \
+	esac; \
+	for file in $$dist_files; do \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  if test -d $$d/$$file; then \
+	    dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \
+	    if test -d "$(distdir)/$$file"; then \
+	      find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+	    fi; \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \
+	      find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+	    fi; \
+	    cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \
+	  else \
+	    test -f "$(distdir)/$$file" \
+	    || cp -p $$d/$$file "$(distdir)/$$file" \
+	    || exit 1; \
+	  fi; \
+	done
+	@list='$(DIST_SUBDIRS)'; for subdir in $$list; do \
+	  if test "$$subdir" = .; then :; else \
+	    test -d "$(distdir)/$$subdir" \
+	    || $(MKDIR_P) "$(distdir)/$$subdir" \
+	    || exit 1; \
+	  fi; \
+	done
+	@list='$(DIST_SUBDIRS)'; for subdir in $$list; do \
+	  if test "$$subdir" = .; then :; else \
+	    dir1=$$subdir; dir2="$(distdir)/$$subdir"; \
+	    $(am__relativize); \
+	    new_distdir=$$reldir; \
+	    dir1=$$subdir; dir2="$(top_distdir)"; \
+	    $(am__relativize); \
+	    new_top_distdir=$$reldir; \
+	    echo " (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) top_distdir="$$new_top_distdir" distdir="$$new_distdir" \\"; \
+	    echo "     am__remove_distdir=: am__skip_length_check=: am__skip_mode_fix=: distdir)"; \
+	    ($(am__cd) $$subdir && \
+	      $(MAKE) $(AM_MAKEFLAGS) \
+	        top_distdir="$$new_top_distdir" \
+	        distdir="$$new_distdir" \
+		am__remove_distdir=: \
+		am__skip_length_check=: \
+		am__skip_mode_fix=: \
+	        distdir) \
+	      || exit 1; \
+	  fi; \
+	done
+	$(MAKE) $(AM_MAKEFLAGS) \
+	  top_distdir="$(top_distdir)" distdir="$(distdir)" \
+	  dist-hook
+	-test -n "$(am__skip_mode_fix)" \
+	|| find "$(distdir)" -type d ! -perm -755 \
+		-exec chmod u+rwx,go+rx {} \; -o \
+	  ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \
+	  ! -type d ! -perm -400 -exec chmod a+r {} \; -o \
+	  ! -type d ! -perm -444 -exec $(install_sh) -c -m a+r {} {} \; \
+	|| chmod -R a+r "$(distdir)"
+dist-gzip: distdir
+	tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz
+	$(am__remove_distdir)
+
+dist-bzip2: distdir
+	tardir=$(distdir) && $(am__tar) | bzip2 -9 -c >$(distdir).tar.bz2
+	$(am__remove_distdir)
+
+dist-lzma: distdir
+	tardir=$(distdir) && $(am__tar) | lzma -9 -c >$(distdir).tar.lzma
+	$(am__remove_distdir)
+
+dist-xz: distdir
+	tardir=$(distdir) && $(am__tar) | xz -c >$(distdir).tar.xz
+	$(am__remove_distdir)
+
+dist-tarZ: distdir
+	tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z
+	$(am__remove_distdir)
+
+dist-shar: distdir
+	shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz
+	$(am__remove_distdir)
+
+dist-zip: distdir
+	-rm -f $(distdir).zip
+	zip -rq $(distdir).zip $(distdir)
+	$(am__remove_distdir)
+
+dist dist-all: distdir
+	tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz
+	$(am__remove_distdir)
+
+# This target untars the dist file and tries a VPATH configuration.  Then
+# it guarantees that the distribution is self-contained by making another
+# tarfile.
+distcheck: dist
+	case '$(DIST_ARCHIVES)' in \
+	*.tar.gz*) \
+	  GZIP=$(GZIP_ENV) gzip -dc $(distdir).tar.gz | $(am__untar) ;;\
+	*.tar.bz2*) \
+	  bzip2 -dc $(distdir).tar.bz2 | $(am__untar) ;;\
+	*.tar.lzma*) \
+	  lzma -dc $(distdir).tar.lzma | $(am__untar) ;;\
+	*.tar.xz*) \
+	  xz -dc $(distdir).tar.xz | $(am__untar) ;;\
+	*.tar.Z*) \
+	  uncompress -c $(distdir).tar.Z | $(am__untar) ;;\
+	*.shar.gz*) \
+	  GZIP=$(GZIP_ENV) gzip -dc $(distdir).shar.gz | unshar ;;\
+	*.zip*) \
+	  unzip $(distdir).zip ;;\
+	esac
+	chmod -R a-w $(distdir); chmod a+w $(distdir)
+	mkdir $(distdir)/_build
+	mkdir $(distdir)/_inst
+	chmod a-w $(distdir)
+	test -d $(distdir)/_build || exit 0; \
+	dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \
+	  && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \
+	  && am__cwd=`pwd` \
+	  && $(am__cd) $(distdir)/_build \
+	  && ../configure --srcdir=.. --prefix="$$dc_install_base" \
+	    $(DISTCHECK_CONFIGURE_FLAGS) \
+	  && $(MAKE) $(AM_MAKEFLAGS) \
+	  && $(MAKE) $(AM_MAKEFLAGS) dvi \
+	  && $(MAKE) $(AM_MAKEFLAGS) check \
+	  && $(MAKE) $(AM_MAKEFLAGS) install \
+	  && $(MAKE) $(AM_MAKEFLAGS) installcheck \
+	  && $(MAKE) $(AM_MAKEFLAGS) uninstall \
+	  && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \
+	        distuninstallcheck \
+	  && chmod -R a-w "$$dc_install_base" \
+	  && ({ \
+	       (cd ../.. && umask 077 && mkdir "$$dc_destdir") \
+	       && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \
+	       && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \
+	       && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \
+	            distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \
+	      } || { rm -rf "$$dc_destdir"; exit 1; }) \
+	  && rm -rf "$$dc_destdir" \
+	  && $(MAKE) $(AM_MAKEFLAGS) dist \
+	  && rm -rf $(DIST_ARCHIVES) \
+	  && $(MAKE) $(AM_MAKEFLAGS) distcleancheck \
+	  && cd "$$am__cwd" \
+	  || exit 1
+	$(am__remove_distdir)
+	@(echo "$(distdir) archives ready for distribution: "; \
+	  list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \
+	  sed -e 1h -e 1s/./=/g -e 1p -e 1x -e '$$p' -e '$$x'
+distuninstallcheck:
+	@$(am__cd) '$(distuninstallcheck_dir)' \
+	&& test `$(distuninstallcheck_listfiles) | wc -l` -le 1 \
+	   || { echo "ERROR: files left after uninstall:" ; \
+	        if test -n "$(DESTDIR)"; then \
+	          echo "  (check DESTDIR support)"; \
+	        fi ; \
+	        $(distuninstallcheck_listfiles) ; \
+	        exit 1; } >&2
+distcleancheck: distclean
+	@if test '$(srcdir)' = . ; then \
+	  echo "ERROR: distcleancheck can only run from a VPATH build" ; \
+	  exit 1 ; \
+	fi
+	@test `$(distcleancheck_listfiles) | wc -l` -eq 0 \
+	  || { echo "ERROR: files left in build directory after distclean:" ; \
+	       $(distcleancheck_listfiles) ; \
+	       exit 1; } >&2
+check-am: all-am
+check: check-recursive
+all-am: Makefile $(SCRIPTS) $(MANS) $(DATA)
+installdirs: installdirs-recursive
+installdirs-am:
+	for dir in "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)"; do \
+	  test -z "$$dir" || $(MKDIR_P) "$$dir"; \
+	done
+install: install-recursive
+install-exec: install-exec-recursive
+install-data: install-data-recursive
+uninstall: uninstall-recursive
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-recursive
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+	-test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-recursive
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-recursive
+	-rm -f $(am__CONFIG_DISTCLEAN_FILES)
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic distclean-local \
+	distclean-tags
+
+dvi: dvi-recursive
+
+dvi-am:
+
+html: html-recursive
+
+html-am:
+
+info: info-recursive
+
+info-am:
+
+install-data-am: install-data-local install-man
+	@$(NORMAL_INSTALL)
+	$(MAKE) $(AM_MAKEFLAGS) install-data-hook
+install-dvi: install-dvi-recursive
+
+install-dvi-am:
+
+install-exec-am: install-dist_binSCRIPTS
+	@$(NORMAL_INSTALL)
+	$(MAKE) $(AM_MAKEFLAGS) install-exec-hook
+install-html: install-html-recursive
+
+install-html-am:
+
+install-info: install-info-recursive
+
+install-info-am:
+
+install-man: install-man1
+
+install-pdf: install-pdf-recursive
+
+install-pdf-am:
+
+install-ps: install-ps-recursive
+
+install-ps-am:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-recursive
+	-rm -f $(am__CONFIG_DISTCLEAN_FILES)
+	-rm -rf $(top_srcdir)/autom4te.cache
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-recursive
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-recursive
+
+pdf-am:
+
+ps: ps-recursive
+
+ps-am:
+
+uninstall-am: uninstall-dist_binSCRIPTS uninstall-local uninstall-man
+
+uninstall-man: uninstall-man1
+
+.MAKE: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) ctags-recursive \
+	install-am install-data-am install-exec-am install-strip \
+	tags-recursive
+
+.PHONY: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) CTAGS GTAGS \
+	all all-am am--refresh check check-am clean clean-generic \
+	ctags ctags-recursive dist dist-all dist-bzip2 dist-gzip \
+	dist-hook dist-lzma dist-shar dist-tarZ dist-xz dist-zip \
+	distcheck distclean distclean-generic distclean-local \
+	distclean-tags distcleancheck distdir distuninstallcheck dvi \
+	dvi-am html html-am info info-am install install-am \
+	install-data install-data-am install-data-hook \
+	install-data-local install-dist_binSCRIPTS install-dvi \
+	install-dvi-am install-exec install-exec-am install-exec-hook \
+	install-html install-html-am install-info install-info-am \
+	install-man install-man1 install-pdf install-pdf-am install-ps \
+	install-ps-am install-strip installcheck installcheck-am \
+	installdirs installdirs-am maintainer-clean \
+	maintainer-clean-generic mostlyclean mostlyclean-generic pdf \
+	pdf-am ps ps-am tags tags-recursive uninstall uninstall-am \
+	uninstall-dist_binSCRIPTS uninstall-local uninstall-man \
+	uninstall-man1
+
+
+norsnet.pod:	norsnet.pod.in
+	sed -e 's|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;' "$<" > "$@"
+
+norsnet.1:	norsnet.pod
+	pod2man -c 'User Commands' -r "$(VERSION)" $< $@
+
+distclean-local:
+	rm -f norsnet.pod norsnet.1 norsnet
+
+dist-hook:
+	rm -rf `find $(distdir) -name .svn`
+
+install-data-local:
+
+install-data-hook:
+
+install-exec-hook:
+	sed -i -e 's|__datadir__|$(datadir)|g;s|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;' "$(DESTDIR)$(bindir)/norsnet"
+
+uninstall-local:
+	rm -rf "$(DESTDIR)$(pkgdatadir)" "$(DESTDIR)$(docdir)"
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:

Added: trunk/packages/norsnet/trunk/debian/NEWS
===================================================================
Added: trunk/packages/norsnet/trunk/debian/README
===================================================================
Added: trunk/packages/norsnet/trunk/debian/aclocal.m4
===================================================================
--- trunk/packages/norsnet/trunk/debian/aclocal.m4	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/aclocal.m4	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,601 @@
+# generated automatically by aclocal 1.11.1 -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004,
+# 2005, 2006, 2007, 2008, 2009  Free Software Foundation, Inc.
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+m4_ifndef([AC_AUTOCONF_VERSION],
+  [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl
+m4_if(m4_defn([AC_AUTOCONF_VERSION]), [2.67],,
+[m4_warning([this file was generated for autoconf 2.67.
+You have another version of autoconf.  It may work, but is not guaranteed to.
+If you have problems, you may need to regenerate the build system entirely.
+To do so, use the procedure documented by the package, typically `autoreconf'.])])
+
+# Copyright (C) 2002, 2003, 2005, 2006, 2007, 2008  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# AM_AUTOMAKE_VERSION(VERSION)
+# ----------------------------
+# Automake X.Y traces this macro to ensure aclocal.m4 has been
+# generated from the m4 files accompanying Automake X.Y.
+# (This private macro should not be called outside this file.)
+AC_DEFUN([AM_AUTOMAKE_VERSION],
+[am__api_version='1.11'
+dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to
+dnl require some minimum version.  Point them to the right macro.
+m4_if([$1], [1.11.1], [],
+      [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl
+])
+
+# _AM_AUTOCONF_VERSION(VERSION)
+# -----------------------------
+# aclocal traces this macro to find the Autoconf version.
+# This is a private macro too.  Using m4_define simplifies
+# the logic in aclocal, which can simply ignore this definition.
+m4_define([_AM_AUTOCONF_VERSION], [])
+
+# AM_SET_CURRENT_AUTOMAKE_VERSION
+# -------------------------------
+# Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced.
+# This function is AC_REQUIREd by AM_INIT_AUTOMAKE.
+AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION],
+[AM_AUTOMAKE_VERSION([1.11.1])dnl
+m4_ifndef([AC_AUTOCONF_VERSION],
+  [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl
+_AM_AUTOCONF_VERSION(m4_defn([AC_AUTOCONF_VERSION]))])
+
+# AM_AUX_DIR_EXPAND                                         -*- Autoconf -*-
+
+# Copyright (C) 2001, 2003, 2005  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets
+# $ac_aux_dir to `$srcdir/foo'.  In other projects, it is set to
+# `$srcdir', `$srcdir/..', or `$srcdir/../..'.
+#
+# Of course, Automake must honor this variable whenever it calls a
+# tool from the auxiliary directory.  The problem is that $srcdir (and
+# therefore $ac_aux_dir as well) can be either absolute or relative,
+# depending on how configure is run.  This is pretty annoying, since
+# it makes $ac_aux_dir quite unusable in subdirectories: in the top
+# source directory, any form will work fine, but in subdirectories a
+# relative path needs to be adjusted first.
+#
+# $ac_aux_dir/missing
+#    fails when called from a subdirectory if $ac_aux_dir is relative
+# $top_srcdir/$ac_aux_dir/missing
+#    fails if $ac_aux_dir is absolute,
+#    fails when called from a subdirectory in a VPATH build with
+#          a relative $ac_aux_dir
+#
+# The reason of the latter failure is that $top_srcdir and $ac_aux_dir
+# are both prefixed by $srcdir.  In an in-source build this is usually
+# harmless because $srcdir is `.', but things will broke when you
+# start a VPATH build or use an absolute $srcdir.
+#
+# So we could use something similar to $top_srcdir/$ac_aux_dir/missing,
+# iff we strip the leading $srcdir from $ac_aux_dir.  That would be:
+#   am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"`
+# and then we would define $MISSING as
+#   MISSING="\${SHELL} $am_aux_dir/missing"
+# This will work as long as MISSING is not called from configure, because
+# unfortunately $(top_srcdir) has no meaning in configure.
+# However there are other variables, like CC, which are often used in
+# configure, and could therefore not use this "fixed" $ac_aux_dir.
+#
+# Another solution, used here, is to always expand $ac_aux_dir to an
+# absolute PATH.  The drawback is that using absolute paths prevent a
+# configured tree to be moved without reconfiguration.
+
+AC_DEFUN([AM_AUX_DIR_EXPAND],
+[dnl Rely on autoconf to set up CDPATH properly.
+AC_PREREQ([2.50])dnl
+# expand $ac_aux_dir to an absolute path
+am_aux_dir=`cd $ac_aux_dir && pwd`
+])
+
+# Do all the work for Automake.                             -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004,
+# 2005, 2006, 2008, 2009 Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 16
+
+# This macro actually does too much.  Some checks are only needed if
+# your package does certain things.  But this isn't really a big deal.
+
+# AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE])
+# AM_INIT_AUTOMAKE([OPTIONS])
+# -----------------------------------------------
+# The call with PACKAGE and VERSION arguments is the old style
+# call (pre autoconf-2.50), which is being phased out.  PACKAGE
+# and VERSION should now be passed to AC_INIT and removed from
+# the call to AM_INIT_AUTOMAKE.
+# We support both call styles for the transition.  After
+# the next Automake release, Autoconf can make the AC_INIT
+# arguments mandatory, and then we can depend on a new Autoconf
+# release and drop the old call support.
+AC_DEFUN([AM_INIT_AUTOMAKE],
+[AC_PREREQ([2.62])dnl
+dnl Autoconf wants to disallow AM_ names.  We explicitly allow
+dnl the ones we care about.
+m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl
+AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl
+AC_REQUIRE([AC_PROG_INSTALL])dnl
+if test "`cd $srcdir && pwd`" != "`pwd`"; then
+  # Use -I$(srcdir) only when $(srcdir) != ., so that make's output
+  # is not polluted with repeated "-I."
+  AC_SUBST([am__isrc], [' -I$(srcdir)'])_AM_SUBST_NOTMAKE([am__isrc])dnl
+  # test to see if srcdir already configured
+  if test -f $srcdir/config.status; then
+    AC_MSG_ERROR([source directory already configured; run "make distclean" there first])
+  fi
+fi
+
+# test whether we have cygpath
+if test -z "$CYGPATH_W"; then
+  if (cygpath --version) >/dev/null 2>/dev/null; then
+    CYGPATH_W='cygpath -w'
+  else
+    CYGPATH_W=echo
+  fi
+fi
+AC_SUBST([CYGPATH_W])
+
+# Define the identity of the package.
+dnl Distinguish between old-style and new-style calls.
+m4_ifval([$2],
+[m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl
+ AC_SUBST([PACKAGE], [$1])dnl
+ AC_SUBST([VERSION], [$2])],
+[_AM_SET_OPTIONS([$1])dnl
+dnl Diagnose old-style AC_INIT with new-style AM_AUTOMAKE_INIT.
+m4_if(m4_ifdef([AC_PACKAGE_NAME], 1)m4_ifdef([AC_PACKAGE_VERSION], 1), 11,,
+  [m4_fatal([AC_INIT should be called with package and version arguments])])dnl
+ AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl
+ AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl
+
+_AM_IF_OPTION([no-define],,
+[AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package])
+ AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl
+
+# Some tools Automake needs.
+AC_REQUIRE([AM_SANITY_CHECK])dnl
+AC_REQUIRE([AC_ARG_PROGRAM])dnl
+AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version})
+AM_MISSING_PROG(AUTOCONF, autoconf)
+AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version})
+AM_MISSING_PROG(AUTOHEADER, autoheader)
+AM_MISSING_PROG(MAKEINFO, makeinfo)
+AC_REQUIRE([AM_PROG_INSTALL_SH])dnl
+AC_REQUIRE([AM_PROG_INSTALL_STRIP])dnl
+AC_REQUIRE([AM_PROG_MKDIR_P])dnl
+# We need awk for the "check" target.  The system "awk" is bad on
+# some platforms.
+AC_REQUIRE([AC_PROG_AWK])dnl
+AC_REQUIRE([AC_PROG_MAKE_SET])dnl
+AC_REQUIRE([AM_SET_LEADING_DOT])dnl
+_AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])],
+	      [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])],
+			     [_AM_PROG_TAR([v7])])])
+_AM_IF_OPTION([no-dependencies],,
+[AC_PROVIDE_IFELSE([AC_PROG_CC],
+		  [_AM_DEPENDENCIES(CC)],
+		  [define([AC_PROG_CC],
+			  defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl
+AC_PROVIDE_IFELSE([AC_PROG_CXX],
+		  [_AM_DEPENDENCIES(CXX)],
+		  [define([AC_PROG_CXX],
+			  defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl
+AC_PROVIDE_IFELSE([AC_PROG_OBJC],
+		  [_AM_DEPENDENCIES(OBJC)],
+		  [define([AC_PROG_OBJC],
+			  defn([AC_PROG_OBJC])[_AM_DEPENDENCIES(OBJC)])])dnl
+])
+_AM_IF_OPTION([silent-rules], [AC_REQUIRE([AM_SILENT_RULES])])dnl
+dnl The `parallel-tests' driver may need to know about EXEEXT, so add the
+dnl `am__EXEEXT' conditional if _AM_COMPILER_EXEEXT was seen.  This macro
+dnl is hooked onto _AC_COMPILER_EXEEXT early, see below.
+AC_CONFIG_COMMANDS_PRE(dnl
+[m4_provide_if([_AM_COMPILER_EXEEXT],
+  [AM_CONDITIONAL([am__EXEEXT], [test -n "$EXEEXT"])])])dnl
+])
+
+dnl Hook into `_AC_COMPILER_EXEEXT' early to learn its expansion.  Do not
+dnl add the conditional right here, as _AC_COMPILER_EXEEXT may be further
+dnl mangled by Autoconf and run in a shell conditional statement.
+m4_define([_AC_COMPILER_EXEEXT],
+m4_defn([_AC_COMPILER_EXEEXT])[m4_provide([_AM_COMPILER_EXEEXT])])
+
+
+# When config.status generates a header, we must update the stamp-h file.
+# This file resides in the same directory as the config header
+# that is generated.  The stamp files are numbered to have different names.
+
+# Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the
+# loop where config.status creates the headers, so we can generate
+# our stamp files there.
+AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK],
+[# Compute $1's index in $config_headers.
+_am_arg=$1
+_am_stamp_count=1
+for _am_header in $config_headers :; do
+  case $_am_header in
+    $_am_arg | $_am_arg:* )
+      break ;;
+    * )
+      _am_stamp_count=`expr $_am_stamp_count + 1` ;;
+  esac
+done
+echo "timestamp for $_am_arg" >`AS_DIRNAME(["$_am_arg"])`/stamp-h[]$_am_stamp_count])
+
+# Copyright (C) 2001, 2003, 2005, 2008  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# AM_PROG_INSTALL_SH
+# ------------------
+# Define $install_sh.
+AC_DEFUN([AM_PROG_INSTALL_SH],
+[AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl
+if test x"${install_sh}" != xset; then
+  case $am_aux_dir in
+  *\ * | *\	*)
+    install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;;
+  *)
+    install_sh="\${SHELL} $am_aux_dir/install-sh"
+  esac
+fi
+AC_SUBST(install_sh)])
+
+# Copyright (C) 2003, 2005  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 2
+
+# Check whether the underlying file-system supports filenames
+# with a leading dot.  For instance MS-DOS doesn't.
+AC_DEFUN([AM_SET_LEADING_DOT],
+[rm -rf .tst 2>/dev/null
+mkdir .tst 2>/dev/null
+if test -d .tst; then
+  am__leading_dot=.
+else
+  am__leading_dot=_
+fi
+rmdir .tst 2>/dev/null
+AC_SUBST([am__leading_dot])])
+
+# Fake the existence of programs that GNU maintainers use.  -*- Autoconf -*-
+
+# Copyright (C) 1997, 1999, 2000, 2001, 2003, 2004, 2005, 2008
+# Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 6
+
+# AM_MISSING_PROG(NAME, PROGRAM)
+# ------------------------------
+AC_DEFUN([AM_MISSING_PROG],
+[AC_REQUIRE([AM_MISSING_HAS_RUN])
+$1=${$1-"${am_missing_run}$2"}
+AC_SUBST($1)])
+
+
+# AM_MISSING_HAS_RUN
+# ------------------
+# Define MISSING if not defined so far and test if it supports --run.
+# If it does, set am_missing_run to use it, otherwise, to nothing.
+AC_DEFUN([AM_MISSING_HAS_RUN],
+[AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl
+AC_REQUIRE_AUX_FILE([missing])dnl
+if test x"${MISSING+set}" != xset; then
+  case $am_aux_dir in
+  *\ * | *\	*)
+    MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;;
+  *)
+    MISSING="\${SHELL} $am_aux_dir/missing" ;;
+  esac
+fi
+# Use eval to expand $SHELL
+if eval "$MISSING --run true"; then
+  am_missing_run="$MISSING --run "
+else
+  am_missing_run=
+  AC_MSG_WARN([`missing' script is too old or missing])
+fi
+])
+
+# Copyright (C) 2003, 2004, 2005, 2006  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# AM_PROG_MKDIR_P
+# ---------------
+# Check for `mkdir -p'.
+AC_DEFUN([AM_PROG_MKDIR_P],
+[AC_PREREQ([2.60])dnl
+AC_REQUIRE([AC_PROG_MKDIR_P])dnl
+dnl Automake 1.8 to 1.9.6 used to define mkdir_p.  We now use MKDIR_P,
+dnl while keeping a definition of mkdir_p for backward compatibility.
+dnl @MKDIR_P@ is magic: AC_OUTPUT adjusts its value for each Makefile.
+dnl However we cannot define mkdir_p as $(MKDIR_P) for the sake of
+dnl Makefile.ins that do not define MKDIR_P, so we do our own
+dnl adjustment using top_builddir (which is defined more often than
+dnl MKDIR_P).
+AC_SUBST([mkdir_p], ["$MKDIR_P"])dnl
+case $mkdir_p in
+  [[\\/$]]* | ?:[[\\/]]*) ;;
+  */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;;
+esac
+])
+
+# Helper functions for option handling.                     -*- Autoconf -*-
+
+# Copyright (C) 2001, 2002, 2003, 2005, 2008  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 4
+
+# _AM_MANGLE_OPTION(NAME)
+# -----------------------
+AC_DEFUN([_AM_MANGLE_OPTION],
+[[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])])
+
+# _AM_SET_OPTION(NAME)
+# ------------------------------
+# Set option NAME.  Presently that only means defining a flag for this option.
+AC_DEFUN([_AM_SET_OPTION],
+[m4_define(_AM_MANGLE_OPTION([$1]), 1)])
+
+# _AM_SET_OPTIONS(OPTIONS)
+# ----------------------------------
+# OPTIONS is a space-separated list of Automake options.
+AC_DEFUN([_AM_SET_OPTIONS],
+[m4_foreach_w([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])])
+
+# _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET])
+# -------------------------------------------
+# Execute IF-SET if OPTION is set, IF-NOT-SET otherwise.
+AC_DEFUN([_AM_IF_OPTION],
+[m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])])
+
+# Check to make sure that the build environment is sane.    -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 2000, 2001, 2003, 2005, 2008
+# Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 5
+
+# AM_SANITY_CHECK
+# ---------------
+AC_DEFUN([AM_SANITY_CHECK],
+[AC_MSG_CHECKING([whether build environment is sane])
+# Just in case
+sleep 1
+echo timestamp > conftest.file
+# Reject unsafe characters in $srcdir or the absolute working directory
+# name.  Accept space and tab only in the latter.
+am_lf='
+'
+case `pwd` in
+  *[[\\\"\#\$\&\'\`$am_lf]]*)
+    AC_MSG_ERROR([unsafe absolute working directory name]);;
+esac
+case $srcdir in
+  *[[\\\"\#\$\&\'\`$am_lf\ \	]]*)
+    AC_MSG_ERROR([unsafe srcdir value: `$srcdir']);;
+esac
+
+# Do `set' in a subshell so we don't clobber the current shell's
+# arguments.  Must try -L first in case configure is actually a
+# symlink; some systems play weird games with the mod time of symlinks
+# (eg FreeBSD returns the mod time of the symlink's containing
+# directory).
+if (
+   set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null`
+   if test "$[*]" = "X"; then
+      # -L didn't work.
+      set X `ls -t "$srcdir/configure" conftest.file`
+   fi
+   rm -f conftest.file
+   if test "$[*]" != "X $srcdir/configure conftest.file" \
+      && test "$[*]" != "X conftest.file $srcdir/configure"; then
+
+      # If neither matched, then we have a broken ls.  This can happen
+      # if, for instance, CONFIG_SHELL is bash and it inherits a
+      # broken ls alias from the environment.  This has actually
+      # happened.  Such a system could not be considered "sane".
+      AC_MSG_ERROR([ls -t appears to fail.  Make sure there is not a broken
+alias in your environment])
+   fi
+
+   test "$[2]" = conftest.file
+   )
+then
+   # Ok.
+   :
+else
+   AC_MSG_ERROR([newly created file is older than distributed files!
+Check your system clock])
+fi
+AC_MSG_RESULT(yes)])
+
+# Copyright (C) 2001, 2003, 2005  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# AM_PROG_INSTALL_STRIP
+# ---------------------
+# One issue with vendor `install' (even GNU) is that you can't
+# specify the program used to strip binaries.  This is especially
+# annoying in cross-compiling environments, where the build's strip
+# is unlikely to handle the host's binaries.
+# Fortunately install-sh will honor a STRIPPROG variable, so we
+# always use install-sh in `make install-strip', and initialize
+# STRIPPROG with the value of the STRIP variable (set by the user).
+AC_DEFUN([AM_PROG_INSTALL_STRIP],
+[AC_REQUIRE([AM_PROG_INSTALL_SH])dnl
+# Installed binaries are usually stripped using `strip' when the user
+# run `make install-strip'.  However `strip' might not be the right
+# tool to use in cross-compilation environments, therefore Automake
+# will honor the `STRIP' environment variable to overrule this program.
+dnl Don't test for $cross_compiling = yes, because it might be `maybe'.
+if test "$cross_compiling" != no; then
+  AC_CHECK_TOOL([STRIP], [strip], :)
+fi
+INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s"
+AC_SUBST([INSTALL_STRIP_PROGRAM])])
+
+# Copyright (C) 2006, 2008  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 2
+
+# _AM_SUBST_NOTMAKE(VARIABLE)
+# ---------------------------
+# Prevent Automake from outputting VARIABLE = @VARIABLE@ in Makefile.in.
+# This macro is traced by Automake.
+AC_DEFUN([_AM_SUBST_NOTMAKE])
+
+# AM_SUBST_NOTMAKE(VARIABLE)
+# ---------------------------
+# Public sister of _AM_SUBST_NOTMAKE.
+AC_DEFUN([AM_SUBST_NOTMAKE], [_AM_SUBST_NOTMAKE($@)])
+
+# Check how to create a tarball.                            -*- Autoconf -*-
+
+# Copyright (C) 2004, 2005  Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 2
+
+# _AM_PROG_TAR(FORMAT)
+# --------------------
+# Check how to create a tarball in format FORMAT.
+# FORMAT should be one of `v7', `ustar', or `pax'.
+#
+# Substitute a variable $(am__tar) that is a command
+# writing to stdout a FORMAT-tarball containing the directory
+# $tardir.
+#     tardir=directory && $(am__tar) > result.tar
+#
+# Substitute a variable $(am__untar) that extract such
+# a tarball read from stdin.
+#     $(am__untar) < result.tar
+AC_DEFUN([_AM_PROG_TAR],
+[# Always define AMTAR for backward compatibility.
+AM_MISSING_PROG([AMTAR], [tar])
+m4_if([$1], [v7],
+     [am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'],
+     [m4_case([$1], [ustar],, [pax],,
+              [m4_fatal([Unknown tar format])])
+AC_MSG_CHECKING([how to create a $1 tar archive])
+# Loop over all known methods to create a tar archive until one works.
+_am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none'
+_am_tools=${am_cv_prog_tar_$1-$_am_tools}
+# Do not fold the above two line into one, because Tru64 sh and
+# Solaris sh will not grok spaces in the rhs of `-'.
+for _am_tool in $_am_tools
+do
+  case $_am_tool in
+  gnutar)
+    for _am_tar in tar gnutar gtar;
+    do
+      AM_RUN_LOG([$_am_tar --version]) && break
+    done
+    am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"'
+    am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"'
+    am__untar="$_am_tar -xf -"
+    ;;
+  plaintar)
+    # Must skip GNU tar: if it does not support --format= it doesn't create
+    # ustar tarball either.
+    (tar --version) >/dev/null 2>&1 && continue
+    am__tar='tar chf - "$$tardir"'
+    am__tar_='tar chf - "$tardir"'
+    am__untar='tar xf -'
+    ;;
+  pax)
+    am__tar='pax -L -x $1 -w "$$tardir"'
+    am__tar_='pax -L -x $1 -w "$tardir"'
+    am__untar='pax -r'
+    ;;
+  cpio)
+    am__tar='find "$$tardir" -print | cpio -o -H $1 -L'
+    am__tar_='find "$tardir" -print | cpio -o -H $1 -L'
+    am__untar='cpio -i -H $1 -d'
+    ;;
+  none)
+    am__tar=false
+    am__tar_=false
+    am__untar=false
+    ;;
+  esac
+
+  # If the value was cached, stop now.  We just wanted to have am__tar
+  # and am__untar set.
+  test -n "${am_cv_prog_tar_$1}" && break
+
+  # tar/untar a dummy directory, and stop if the command works
+  rm -rf conftest.dir
+  mkdir conftest.dir
+  echo GrepMe > conftest.dir/file
+  AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar])
+  rm -rf conftest.dir
+  if test -s conftest.tar; then
+    AM_RUN_LOG([$am__untar <conftest.tar])
+    grep GrepMe conftest.dir/file >/dev/null 2>&1 && break
+  fi
+done
+rm -rf conftest.dir
+
+AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool])
+AC_MSG_RESULT([$am_cv_prog_tar_$1])])
+AC_SUBST([am__tar])
+AC_SUBST([am__untar])
+]) # _AM_PROG_TAR
+

Modified: trunk/packages/norsnet/trunk/debian/compat
===================================================================
--- trunk/packages/norsnet/trunk/debian/compat	2012-07-10 14:45:53 UTC (rev 11704)
+++ trunk/packages/norsnet/trunk/debian/compat	2012-07-10 15:05:06 UTC (rev 11705)
@@ -1 +1 @@
-7
+8

Added: trunk/packages/norsnet/trunk/debian/configure
===================================================================
--- trunk/packages/norsnet/trunk/debian/configure	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/configure	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,3350 @@
+#! /bin/sh
+# Guess values for system-dependent variables and create Makefiles.
+# Generated by GNU Autoconf 2.67 for norsnet 1.0.12.
+#
+# Report bugs to <https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsnet>.
+#
+#
+# Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001,
+# 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010 Free Software
+# Foundation, Inc.
+#
+#
+# This configure script is free software; the Free Software Foundation
+# gives unlimited permission to copy, distribute and modify it.
+## -------------------- ##
+## M4sh Initialization. ##
+## -------------------- ##
+
+# Be more Bourne compatible
+DUALCASE=1; export DUALCASE # for MKS sh
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then :
+  emulate sh
+  NULLCMD=:
+  # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which
+  # is contrary to our usage.  Disable this feature.
+  alias -g '${1+"$@"}'='"$@"'
+  setopt NO_GLOB_SUBST
+else
+  case `(set -o) 2>/dev/null` in #(
+  *posix*) :
+    set -o posix ;; #(
+  *) :
+     ;;
+esac
+fi
+
+
+as_nl='
+'
+export as_nl
+# Printing a long string crashes Solaris 7 /usr/bin/printf.
+as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\'
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo
+# Prefer a ksh shell builtin over an external printf program on Solaris,
+# but without wasting forks for bash or zsh.
+if test -z "$BASH_VERSION$ZSH_VERSION" \
+    && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then
+  as_echo='print -r --'
+  as_echo_n='print -rn --'
+elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then
+  as_echo='printf %s\n'
+  as_echo_n='printf %s'
+else
+  if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then
+    as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"'
+    as_echo_n='/usr/ucb/echo -n'
+  else
+    as_echo_body='eval expr "X$1" : "X\\(.*\\)"'
+    as_echo_n_body='eval
+      arg=$1;
+      case $arg in #(
+      *"$as_nl"*)
+	expr "X$arg" : "X\\(.*\\)$as_nl";
+	arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;;
+      esac;
+      expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl"
+    '
+    export as_echo_n_body
+    as_echo_n='sh -c $as_echo_n_body as_echo'
+  fi
+  export as_echo_body
+  as_echo='sh -c $as_echo_body as_echo'
+fi
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+  PATH_SEPARATOR=:
+  (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && {
+    (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 ||
+      PATH_SEPARATOR=';'
+  }
+fi
+
+
+# IFS
+# We need space, tab and new line, in precisely that order.  Quoting is
+# there to prevent editors from complaining about space-tab.
+# (If _AS_PATH_WALK were called with IFS unset, it would disable word
+# splitting by setting IFS to empty value.)
+IFS=" ""	$as_nl"
+
+# Find who we are.  Look in the path if we contain no directory separator.
+case $0 in #((
+  *[\\/]* ) as_myself=$0 ;;
+  *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+  done
+IFS=$as_save_IFS
+
+     ;;
+esac
+# We did not find ourselves, most probably we were run as `sh COMMAND'
+# in which case we are not to be found in the path.
+if test "x$as_myself" = x; then
+  as_myself=$0
+fi
+if test ! -f "$as_myself"; then
+  $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+  exit 1
+fi
+
+# Unset variables that we do not need and which cause bugs (e.g. in
+# pre-3.0 UWIN ksh).  But do not cause bugs in bash 2.01; the "|| exit 1"
+# suppresses any "Segmentation fault" message there.  '((' could
+# trigger a bug in pdksh 5.2.14.
+for as_var in BASH_ENV ENV MAIL MAILPATH
+do eval test x\${$as_var+set} = xset \
+  && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
+done
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+LC_ALL=C
+export LC_ALL
+LANGUAGE=C
+export LANGUAGE
+
+# CDPATH.
+(unset CDPATH) >/dev/null 2>&1 && unset CDPATH
+
+if test "x$CONFIG_SHELL" = x; then
+  as_bourne_compatible="if test -n \"\${ZSH_VERSION+set}\" && (emulate sh) >/dev/null 2>&1; then :
+  emulate sh
+  NULLCMD=:
+  # Pre-4.2 versions of Zsh do word splitting on \${1+\"\$@\"}, which
+  # is contrary to our usage.  Disable this feature.
+  alias -g '\${1+\"\$@\"}'='\"\$@\"'
+  setopt NO_GLOB_SUBST
+else
+  case \`(set -o) 2>/dev/null\` in #(
+  *posix*) :
+    set -o posix ;; #(
+  *) :
+     ;;
+esac
+fi
+"
+  as_required="as_fn_return () { (exit \$1); }
+as_fn_success () { as_fn_return 0; }
+as_fn_failure () { as_fn_return 1; }
+as_fn_ret_success () { return 0; }
+as_fn_ret_failure () { return 1; }
+
+exitcode=0
+as_fn_success || { exitcode=1; echo as_fn_success failed.; }
+as_fn_failure && { exitcode=1; echo as_fn_failure succeeded.; }
+as_fn_ret_success || { exitcode=1; echo as_fn_ret_success failed.; }
+as_fn_ret_failure && { exitcode=1; echo as_fn_ret_failure succeeded.; }
+if ( set x; as_fn_ret_success y && test x = \"\$1\" ); then :
+
+else
+  exitcode=1; echo positional parameters were not saved.
+fi
+test x\$exitcode = x0 || exit 1"
+  as_suggested="  as_lineno_1=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_1a=\$LINENO
+  as_lineno_2=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_2a=\$LINENO
+  eval 'test \"x\$as_lineno_1'\$as_run'\" != \"x\$as_lineno_2'\$as_run'\" &&
+  test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1"
+  if (eval "$as_required") 2>/dev/null; then :
+  as_have_required=yes
+else
+  as_have_required=no
+fi
+  if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null; then :
+
+else
+  as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+as_found=false
+for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  as_found=:
+  case $as_dir in #(
+	 /*)
+	   for as_base in sh bash ksh sh5; do
+	     # Try only shells that exist, to save several forks.
+	     as_shell=$as_dir/$as_base
+	     if { test -f "$as_shell" || test -f "$as_shell.exe"; } &&
+		    { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$as_shell"; } 2>/dev/null; then :
+  CONFIG_SHELL=$as_shell as_have_required=yes
+		   if { $as_echo "$as_bourne_compatible""$as_suggested" | as_run=a "$as_shell"; } 2>/dev/null; then :
+  break 2
+fi
+fi
+	   done;;
+       esac
+  as_found=false
+done
+$as_found || { if { test -f "$SHELL" || test -f "$SHELL.exe"; } &&
+	      { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$SHELL"; } 2>/dev/null; then :
+  CONFIG_SHELL=$SHELL as_have_required=yes
+fi; }
+IFS=$as_save_IFS
+
+
+      if test "x$CONFIG_SHELL" != x; then :
+  # We cannot yet assume a decent shell, so we have to provide a
+	# neutralization value for shells without unset; and this also
+	# works around shells that cannot unset nonexistent variables.
+	BASH_ENV=/dev/null
+	ENV=/dev/null
+	(unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV
+	export CONFIG_SHELL
+	exec "$CONFIG_SHELL" "$as_myself" ${1+"$@"}
+fi
+
+    if test x$as_have_required = xno; then :
+  $as_echo "$0: This script requires a shell more modern than all"
+  $as_echo "$0: the shells that I found on your system."
+  if test x${ZSH_VERSION+set} = xset ; then
+    $as_echo "$0: In particular, zsh $ZSH_VERSION has bugs and should"
+    $as_echo "$0: be upgraded to zsh 4.3.4 or later."
+  else
+    $as_echo "$0: Please tell bug-autoconf at gnu.org and
+$0: https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsnet
+$0: about your system, including any error possibly output
+$0: before this message. Then install a modern shell, or
+$0: manually run the script under such a shell if you do
+$0: have one."
+  fi
+  exit 1
+fi
+fi
+fi
+SHELL=${CONFIG_SHELL-/bin/sh}
+export SHELL
+# Unset more variables known to interfere with behavior of common tools.
+CLICOLOR_FORCE= GREP_OPTIONS=
+unset CLICOLOR_FORCE GREP_OPTIONS
+
+## --------------------- ##
+## M4sh Shell Functions. ##
+## --------------------- ##
+# as_fn_unset VAR
+# ---------------
+# Portably unset VAR.
+as_fn_unset ()
+{
+  { eval $1=; unset $1;}
+}
+as_unset=as_fn_unset
+
+# as_fn_set_status STATUS
+# -----------------------
+# Set $? to STATUS, without forking.
+as_fn_set_status ()
+{
+  return $1
+} # as_fn_set_status
+
+# as_fn_exit STATUS
+# -----------------
+# Exit the shell with STATUS, even in a "trap 0" or "set -e" context.
+as_fn_exit ()
+{
+  set +e
+  as_fn_set_status $1
+  exit $1
+} # as_fn_exit
+
+# as_fn_mkdir_p
+# -------------
+# Create "$as_dir" as a directory, including parents if necessary.
+as_fn_mkdir_p ()
+{
+
+  case $as_dir in #(
+  -*) as_dir=./$as_dir;;
+  esac
+  test -d "$as_dir" || eval $as_mkdir_p || {
+    as_dirs=
+    while :; do
+      case $as_dir in #(
+      *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
+      *) as_qdir=$as_dir;;
+      esac
+      as_dirs="'$as_qdir' $as_dirs"
+      as_dir=`$as_dirname -- "$as_dir" ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$as_dir" : 'X\(//\)[^/]' \| \
+	 X"$as_dir" : 'X\(//\)$' \| \
+	 X"$as_dir" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$as_dir" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)[^/].*/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\).*/{
+	    s//\1/
+	    q
+	  }
+	  s/.*/./; q'`
+      test -d "$as_dir" && break
+    done
+    test -z "$as_dirs" || eval "mkdir $as_dirs"
+  } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir"
+
+
+} # as_fn_mkdir_p
+# as_fn_append VAR VALUE
+# ----------------------
+# Append the text in VALUE to the end of the definition contained in VAR. Take
+# advantage of any shell optimizations that allow amortized linear growth over
+# repeated appends, instead of the typical quadratic growth present in naive
+# implementations.
+if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then :
+  eval 'as_fn_append ()
+  {
+    eval $1+=\$2
+  }'
+else
+  as_fn_append ()
+  {
+    eval $1=\$$1\$2
+  }
+fi # as_fn_append
+
+# as_fn_arith ARG...
+# ------------------
+# Perform arithmetic evaluation on the ARGs, and store the result in the
+# global $as_val. Take advantage of shells that can avoid forks. The arguments
+# must be portable across $(()) and expr.
+if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then :
+  eval 'as_fn_arith ()
+  {
+    as_val=$(( $* ))
+  }'
+else
+  as_fn_arith ()
+  {
+    as_val=`expr "$@" || test $? -eq 1`
+  }
+fi # as_fn_arith
+
+
+# as_fn_error STATUS ERROR [LINENO LOG_FD]
+# ----------------------------------------
+# Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are
+# provided, also output the error to LOG_FD, referencing LINENO. Then exit the
+# script with STATUS, using 1 if that was 0.
+as_fn_error ()
+{
+  as_status=$1; test $as_status -eq 0 && as_status=1
+  if test "$4"; then
+    as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
+    $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
+  fi
+  $as_echo "$as_me: error: $2" >&2
+  as_fn_exit $as_status
+} # as_fn_error
+
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+   test "X`expr 00001 : '.*\(...\)'`" = X001; then
+  as_expr=expr
+else
+  as_expr=false
+fi
+
+if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then
+  as_basename=basename
+else
+  as_basename=false
+fi
+
+if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then
+  as_dirname=dirname
+else
+  as_dirname=false
+fi
+
+as_me=`$as_basename -- "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+	 X"$0" : 'X\(//\)$' \| \
+	 X"$0" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X/"$0" |
+    sed '/^.*\/\([^/][^/]*\)\/*$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\/\(\/\/\)$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\/\(\/\).*/{
+	    s//\1/
+	    q
+	  }
+	  s/.*/./; q'`
+
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+
+  as_lineno_1=$LINENO as_lineno_1a=$LINENO
+  as_lineno_2=$LINENO as_lineno_2a=$LINENO
+  eval 'test "x$as_lineno_1'$as_run'" != "x$as_lineno_2'$as_run'" &&
+  test "x`expr $as_lineno_1'$as_run' + 1`" = "x$as_lineno_2'$as_run'"' || {
+  # Blame Lee E. McMahon (1931-1989) for sed's syntax.  :-)
+  sed -n '
+    p
+    /[$]LINENO/=
+  ' <$as_myself |
+    sed '
+      s/[$]LINENO.*/&-/
+      t lineno
+      b
+      :lineno
+      N
+      :loop
+      s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/
+      t loop
+      s/-\n.*//
+    ' >$as_me.lineno &&
+  chmod +x "$as_me.lineno" ||
+    { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; }
+
+  # Don't try to exec as it changes $[0], causing all sort of problems
+  # (the dirname of $[0] is not the place where we might find the
+  # original and so on.  Autoconf is especially sensitive to this).
+  . "./$as_me.lineno"
+  # Exit status is that of the last command.
+  exit
+}
+
+ECHO_C= ECHO_N= ECHO_T=
+case `echo -n x` in #(((((
+-n*)
+  case `echo 'xy\c'` in
+  *c*) ECHO_T='	';;	# ECHO_T is single tab character.
+  xy)  ECHO_C='\c';;
+  *)   echo `echo ksh88 bug on AIX 6.1` > /dev/null
+       ECHO_T='	';;
+  esac;;
+*)
+  ECHO_N='-n';;
+esac
+
+rm -f conf$$ conf$$.exe conf$$.file
+if test -d conf$$.dir; then
+  rm -f conf$$.dir/conf$$.file
+else
+  rm -f conf$$.dir
+  mkdir conf$$.dir 2>/dev/null
+fi
+if (echo >conf$$.file) 2>/dev/null; then
+  if ln -s conf$$.file conf$$ 2>/dev/null; then
+    as_ln_s='ln -s'
+    # ... but there are two gotchas:
+    # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail.
+    # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable.
+    # In both cases, we have to default to `cp -p'.
+    ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe ||
+      as_ln_s='cp -p'
+  elif ln conf$$.file conf$$ 2>/dev/null; then
+    as_ln_s=ln
+  else
+    as_ln_s='cp -p'
+  fi
+else
+  as_ln_s='cp -p'
+fi
+rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file
+rmdir conf$$.dir 2>/dev/null
+
+if mkdir -p . 2>/dev/null; then
+  as_mkdir_p='mkdir -p "$as_dir"'
+else
+  test -d ./-p && rmdir ./-p
+  as_mkdir_p=false
+fi
+
+if test -x / >/dev/null 2>&1; then
+  as_test_x='test -x'
+else
+  if ls -dL / >/dev/null 2>&1; then
+    as_ls_L_option=L
+  else
+    as_ls_L_option=
+  fi
+  as_test_x='
+    eval sh -c '\''
+      if test -d "$1"; then
+	test -d "$1/.";
+      else
+	case $1 in #(
+	-*)set "./$1";;
+	esac;
+	case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in #((
+	???[sx]*):;;*)false;;esac;fi
+    '\'' sh
+  '
+fi
+as_executable_p=$as_test_x
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+test -n "$DJDIR" || exec 7<&0 </dev/null
+exec 6>&1
+
+# Name of the host.
+# hostname on some systems (SVR3.2, old GNU/Linux) returns a bogus exit status,
+# so uname gets run too.
+ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q`
+
+#
+# Initializations.
+#
+ac_default_prefix=/usr/local
+ac_clean_files=
+ac_config_libobj_dir=.
+LIBOBJS=
+cross_compiling=no
+subdirs=
+MFLAGS=
+MAKEFLAGS=
+
+# Identity of this package.
+PACKAGE_NAME='norsnet'
+PACKAGE_TARNAME='norsnet'
+PACKAGE_VERSION='1.0.12'
+PACKAGE_STRING='norsnet 1.0.12'
+PACKAGE_BUGREPORT='https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsnet'
+PACKAGE_URL=''
+
+ac_unique_file="scr/createDataFile.pl"
+ac_subst_vars='LTLIBOBJS
+LIBOBJS
+am__untar
+am__tar
+AMTAR
+am__leading_dot
+SET_MAKE
+AWK
+mkdir_p
+MKDIR_P
+INSTALL_STRIP_PROGRAM
+STRIP
+install_sh
+MAKEINFO
+AUTOHEADER
+AUTOMAKE
+AUTOCONF
+ACLOCAL
+VERSION
+PACKAGE
+CYGPATH_W
+am__isrc
+INSTALL_DATA
+INSTALL_SCRIPT
+INSTALL_PROGRAM
+target_alias
+host_alias
+build_alias
+LIBS
+ECHO_T
+ECHO_N
+ECHO_C
+DEFS
+mandir
+localedir
+libdir
+psdir
+pdfdir
+dvidir
+htmldir
+infodir
+docdir
+oldincludedir
+includedir
+localstatedir
+sharedstatedir
+sysconfdir
+datadir
+datarootdir
+libexecdir
+sbindir
+bindir
+program_transform_name
+prefix
+exec_prefix
+PACKAGE_URL
+PACKAGE_BUGREPORT
+PACKAGE_STRING
+PACKAGE_VERSION
+PACKAGE_TARNAME
+PACKAGE_NAME
+PATH_SEPARATOR
+SHELL'
+ac_subst_files=''
+ac_user_opts='
+enable_option_checking
+'
+      ac_precious_vars='build_alias
+host_alias
+target_alias'
+
+
+# Initialize some variables set by options.
+ac_init_help=
+ac_init_version=false
+ac_unrecognized_opts=
+ac_unrecognized_sep=
+# The variables have the same names as the options, with
+# dashes changed to underlines.
+cache_file=/dev/null
+exec_prefix=NONE
+no_create=
+no_recursion=
+prefix=NONE
+program_prefix=NONE
+program_suffix=NONE
+program_transform_name=s,x,x,
+silent=
+site=
+srcdir=
+verbose=
+x_includes=NONE
+x_libraries=NONE
+
+# Installation directory options.
+# These are left unexpanded so users can "make install exec_prefix=/foo"
+# and all the variables that are supposed to be based on exec_prefix
+# by default will actually change.
+# Use braces instead of parens because sh, perl, etc. also accept them.
+# (The list follows the same order as the GNU Coding Standards.)
+bindir='${exec_prefix}/bin'
+sbindir='${exec_prefix}/sbin'
+libexecdir='${exec_prefix}/libexec'
+datarootdir='${prefix}/share'
+datadir='${datarootdir}'
+sysconfdir='${prefix}/etc'
+sharedstatedir='${prefix}/com'
+localstatedir='${prefix}/var'
+includedir='${prefix}/include'
+oldincludedir='/usr/include'
+docdir='${datarootdir}/doc/${PACKAGE_TARNAME}'
+infodir='${datarootdir}/info'
+htmldir='${docdir}'
+dvidir='${docdir}'
+pdfdir='${docdir}'
+psdir='${docdir}'
+libdir='${exec_prefix}/lib'
+localedir='${datarootdir}/locale'
+mandir='${datarootdir}/man'
+
+ac_prev=
+ac_dashdash=
+for ac_option
+do
+  # If the previous option needs an argument, assign it.
+  if test -n "$ac_prev"; then
+    eval $ac_prev=\$ac_option
+    ac_prev=
+    continue
+  fi
+
+  case $ac_option in
+  *=?*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;;
+  *=)   ac_optarg= ;;
+  *)    ac_optarg=yes ;;
+  esac
+
+  # Accept the important Cygnus configure options, so we can diagnose typos.
+
+  case $ac_dashdash$ac_option in
+  --)
+    ac_dashdash=yes ;;
+
+  -bindir | --bindir | --bindi | --bind | --bin | --bi)
+    ac_prev=bindir ;;
+  -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*)
+    bindir=$ac_optarg ;;
+
+  -build | --build | --buil | --bui | --bu)
+    ac_prev=build_alias ;;
+  -build=* | --build=* | --buil=* | --bui=* | --bu=*)
+    build_alias=$ac_optarg ;;
+
+  -cache-file | --cache-file | --cache-fil | --cache-fi \
+  | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c)
+    ac_prev=cache_file ;;
+  -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \
+  | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*)
+    cache_file=$ac_optarg ;;
+
+  --config-cache | -C)
+    cache_file=config.cache ;;
+
+  -datadir | --datadir | --datadi | --datad)
+    ac_prev=datadir ;;
+  -datadir=* | --datadir=* | --datadi=* | --datad=*)
+    datadir=$ac_optarg ;;
+
+  -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \
+  | --dataroo | --dataro | --datar)
+    ac_prev=datarootdir ;;
+  -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \
+  | --dataroot=* | --dataroo=* | --dataro=* | --datar=*)
+    datarootdir=$ac_optarg ;;
+
+  -disable-* | --disable-*)
+    ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+      as_fn_error $? "invalid feature name: $ac_useropt"
+    ac_useropt_orig=$ac_useropt
+    ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+    case $ac_user_opts in
+      *"
+"enable_$ac_useropt"
+"*) ;;
+      *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--disable-$ac_useropt_orig"
+	 ac_unrecognized_sep=', ';;
+    esac
+    eval enable_$ac_useropt=no ;;
+
+  -docdir | --docdir | --docdi | --doc | --do)
+    ac_prev=docdir ;;
+  -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*)
+    docdir=$ac_optarg ;;
+
+  -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv)
+    ac_prev=dvidir ;;
+  -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*)
+    dvidir=$ac_optarg ;;
+
+  -enable-* | --enable-*)
+    ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+      as_fn_error $? "invalid feature name: $ac_useropt"
+    ac_useropt_orig=$ac_useropt
+    ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+    case $ac_user_opts in
+      *"
+"enable_$ac_useropt"
+"*) ;;
+      *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--enable-$ac_useropt_orig"
+	 ac_unrecognized_sep=', ';;
+    esac
+    eval enable_$ac_useropt=\$ac_optarg ;;
+
+  -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \
+  | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \
+  | --exec | --exe | --ex)
+    ac_prev=exec_prefix ;;
+  -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \
+  | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \
+  | --exec=* | --exe=* | --ex=*)
+    exec_prefix=$ac_optarg ;;
+
+  -gas | --gas | --ga | --g)
+    # Obsolete; use --with-gas.
+    with_gas=yes ;;
+
+  -help | --help | --hel | --he | -h)
+    ac_init_help=long ;;
+  -help=r* | --help=r* | --hel=r* | --he=r* | -hr*)
+    ac_init_help=recursive ;;
+  -help=s* | --help=s* | --hel=s* | --he=s* | -hs*)
+    ac_init_help=short ;;
+
+  -host | --host | --hos | --ho)
+    ac_prev=host_alias ;;
+  -host=* | --host=* | --hos=* | --ho=*)
+    host_alias=$ac_optarg ;;
+
+  -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht)
+    ac_prev=htmldir ;;
+  -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \
+  | --ht=*)
+    htmldir=$ac_optarg ;;
+
+  -includedir | --includedir | --includedi | --included | --include \
+  | --includ | --inclu | --incl | --inc)
+    ac_prev=includedir ;;
+  -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \
+  | --includ=* | --inclu=* | --incl=* | --inc=*)
+    includedir=$ac_optarg ;;
+
+  -infodir | --infodir | --infodi | --infod | --info | --inf)
+    ac_prev=infodir ;;
+  -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*)
+    infodir=$ac_optarg ;;
+
+  -libdir | --libdir | --libdi | --libd)
+    ac_prev=libdir ;;
+  -libdir=* | --libdir=* | --libdi=* | --libd=*)
+    libdir=$ac_optarg ;;
+
+  -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \
+  | --libexe | --libex | --libe)
+    ac_prev=libexecdir ;;
+  -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \
+  | --libexe=* | --libex=* | --libe=*)
+    libexecdir=$ac_optarg ;;
+
+  -localedir | --localedir | --localedi | --localed | --locale)
+    ac_prev=localedir ;;
+  -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*)
+    localedir=$ac_optarg ;;
+
+  -localstatedir | --localstatedir | --localstatedi | --localstated \
+  | --localstate | --localstat | --localsta | --localst | --locals)
+    ac_prev=localstatedir ;;
+  -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \
+  | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*)
+    localstatedir=$ac_optarg ;;
+
+  -mandir | --mandir | --mandi | --mand | --man | --ma | --m)
+    ac_prev=mandir ;;
+  -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*)
+    mandir=$ac_optarg ;;
+
+  -nfp | --nfp | --nf)
+    # Obsolete; use --without-fp.
+    with_fp=no ;;
+
+  -no-create | --no-create | --no-creat | --no-crea | --no-cre \
+  | --no-cr | --no-c | -n)
+    no_create=yes ;;
+
+  -no-recursion | --no-recursion | --no-recursio | --no-recursi \
+  | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r)
+    no_recursion=yes ;;
+
+  -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \
+  | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \
+  | --oldin | --oldi | --old | --ol | --o)
+    ac_prev=oldincludedir ;;
+  -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \
+  | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \
+  | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*)
+    oldincludedir=$ac_optarg ;;
+
+  -prefix | --prefix | --prefi | --pref | --pre | --pr | --p)
+    ac_prev=prefix ;;
+  -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*)
+    prefix=$ac_optarg ;;
+
+  -program-prefix | --program-prefix | --program-prefi | --program-pref \
+  | --program-pre | --program-pr | --program-p)
+    ac_prev=program_prefix ;;
+  -program-prefix=* | --program-prefix=* | --program-prefi=* \
+  | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*)
+    program_prefix=$ac_optarg ;;
+
+  -program-suffix | --program-suffix | --program-suffi | --program-suff \
+  | --program-suf | --program-su | --program-s)
+    ac_prev=program_suffix ;;
+  -program-suffix=* | --program-suffix=* | --program-suffi=* \
+  | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*)
+    program_suffix=$ac_optarg ;;
+
+  -program-transform-name | --program-transform-name \
+  | --program-transform-nam | --program-transform-na \
+  | --program-transform-n | --program-transform- \
+  | --program-transform | --program-transfor \
+  | --program-transfo | --program-transf \
+  | --program-trans | --program-tran \
+  | --progr-tra | --program-tr | --program-t)
+    ac_prev=program_transform_name ;;
+  -program-transform-name=* | --program-transform-name=* \
+  | --program-transform-nam=* | --program-transform-na=* \
+  | --program-transform-n=* | --program-transform-=* \
+  | --program-transform=* | --program-transfor=* \
+  | --program-transfo=* | --program-transf=* \
+  | --program-trans=* | --program-tran=* \
+  | --progr-tra=* | --program-tr=* | --program-t=*)
+    program_transform_name=$ac_optarg ;;
+
+  -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd)
+    ac_prev=pdfdir ;;
+  -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*)
+    pdfdir=$ac_optarg ;;
+
+  -psdir | --psdir | --psdi | --psd | --ps)
+    ac_prev=psdir ;;
+  -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*)
+    psdir=$ac_optarg ;;
+
+  -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+  | -silent | --silent | --silen | --sile | --sil)
+    silent=yes ;;
+
+  -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb)
+    ac_prev=sbindir ;;
+  -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \
+  | --sbi=* | --sb=*)
+    sbindir=$ac_optarg ;;
+
+  -sharedstatedir | --sharedstatedir | --sharedstatedi \
+  | --sharedstated | --sharedstate | --sharedstat | --sharedsta \
+  | --sharedst | --shareds | --shared | --share | --shar \
+  | --sha | --sh)
+    ac_prev=sharedstatedir ;;
+  -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \
+  | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \
+  | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \
+  | --sha=* | --sh=*)
+    sharedstatedir=$ac_optarg ;;
+
+  -site | --site | --sit)
+    ac_prev=site ;;
+  -site=* | --site=* | --sit=*)
+    site=$ac_optarg ;;
+
+  -srcdir | --srcdir | --srcdi | --srcd | --src | --sr)
+    ac_prev=srcdir ;;
+  -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*)
+    srcdir=$ac_optarg ;;
+
+  -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \
+  | --syscon | --sysco | --sysc | --sys | --sy)
+    ac_prev=sysconfdir ;;
+  -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \
+  | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*)
+    sysconfdir=$ac_optarg ;;
+
+  -target | --target | --targe | --targ | --tar | --ta | --t)
+    ac_prev=target_alias ;;
+  -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*)
+    target_alias=$ac_optarg ;;
+
+  -v | -verbose | --verbose | --verbos | --verbo | --verb)
+    verbose=yes ;;
+
+  -version | --version | --versio | --versi | --vers | -V)
+    ac_init_version=: ;;
+
+  -with-* | --with-*)
+    ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+      as_fn_error $? "invalid package name: $ac_useropt"
+    ac_useropt_orig=$ac_useropt
+    ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+    case $ac_user_opts in
+      *"
+"with_$ac_useropt"
+"*) ;;
+      *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--with-$ac_useropt_orig"
+	 ac_unrecognized_sep=', ';;
+    esac
+    eval with_$ac_useropt=\$ac_optarg ;;
+
+  -without-* | --without-*)
+    ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+      as_fn_error $? "invalid package name: $ac_useropt"
+    ac_useropt_orig=$ac_useropt
+    ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+    case $ac_user_opts in
+      *"
+"with_$ac_useropt"
+"*) ;;
+      *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--without-$ac_useropt_orig"
+	 ac_unrecognized_sep=', ';;
+    esac
+    eval with_$ac_useropt=no ;;
+
+  --x)
+    # Obsolete; use --with-x.
+    with_x=yes ;;
+
+  -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \
+  | --x-incl | --x-inc | --x-in | --x-i)
+    ac_prev=x_includes ;;
+  -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \
+  | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*)
+    x_includes=$ac_optarg ;;
+
+  -x-libraries | --x-libraries | --x-librarie | --x-librari \
+  | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l)
+    ac_prev=x_libraries ;;
+  -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \
+  | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*)
+    x_libraries=$ac_optarg ;;
+
+  -*) as_fn_error $? "unrecognized option: \`$ac_option'
+Try \`$0 --help' for more information"
+    ;;
+
+  *=*)
+    ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='`
+    # Reject names that are not valid shell variable names.
+    case $ac_envvar in #(
+      '' | [0-9]* | *[!_$as_cr_alnum]* )
+      as_fn_error $? "invalid variable name: \`$ac_envvar'" ;;
+    esac
+    eval $ac_envvar=\$ac_optarg
+    export $ac_envvar ;;
+
+  *)
+    # FIXME: should be removed in autoconf 3.0.
+    $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2
+    expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+      $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2
+    : ${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}
+    ;;
+
+  esac
+done
+
+if test -n "$ac_prev"; then
+  ac_option=--`echo $ac_prev | sed 's/_/-/g'`
+  as_fn_error $? "missing argument to $ac_option"
+fi
+
+if test -n "$ac_unrecognized_opts"; then
+  case $enable_option_checking in
+    no) ;;
+    fatal) as_fn_error $? "unrecognized options: $ac_unrecognized_opts" ;;
+    *)     $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;;
+  esac
+fi
+
+# Check all directory arguments for consistency.
+for ac_var in	exec_prefix prefix bindir sbindir libexecdir datarootdir \
+		datadir sysconfdir sharedstatedir localstatedir includedir \
+		oldincludedir docdir infodir htmldir dvidir pdfdir psdir \
+		libdir localedir mandir
+do
+  eval ac_val=\$$ac_var
+  # Remove trailing slashes.
+  case $ac_val in
+    */ )
+      ac_val=`expr "X$ac_val" : 'X\(.*[^/]\)' \| "X$ac_val" : 'X\(.*\)'`
+      eval $ac_var=\$ac_val;;
+  esac
+  # Be sure to have absolute directory names.
+  case $ac_val in
+    [\\/$]* | ?:[\\/]* )  continue;;
+    NONE | '' ) case $ac_var in *prefix ) continue;; esac;;
+  esac
+  as_fn_error $? "expected an absolute directory name for --$ac_var: $ac_val"
+done
+
+# There might be people who depend on the old broken behavior: `$host'
+# used to hold the argument of --host etc.
+# FIXME: To remove some day.
+build=$build_alias
+host=$host_alias
+target=$target_alias
+
+# FIXME: To remove some day.
+if test "x$host_alias" != x; then
+  if test "x$build_alias" = x; then
+    cross_compiling=maybe
+    $as_echo "$as_me: WARNING: if you wanted to set the --build type, don't use --host.
+    If a cross compiler is detected then cross compile mode will be used" >&2
+  elif test "x$build_alias" != "x$host_alias"; then
+    cross_compiling=yes
+  fi
+fi
+
+ac_tool_prefix=
+test -n "$host_alias" && ac_tool_prefix=$host_alias-
+
+test "$silent" = yes && exec 6>/dev/null
+
+
+ac_pwd=`pwd` && test -n "$ac_pwd" &&
+ac_ls_di=`ls -di .` &&
+ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` ||
+  as_fn_error $? "working directory cannot be determined"
+test "X$ac_ls_di" = "X$ac_pwd_ls_di" ||
+  as_fn_error $? "pwd does not report name of working directory"
+
+
+# Find the source files, if location was not specified.
+if test -z "$srcdir"; then
+  ac_srcdir_defaulted=yes
+  # Try the directory containing this script, then the parent directory.
+  ac_confdir=`$as_dirname -- "$as_myself" ||
+$as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$as_myself" : 'X\(//\)[^/]' \| \
+	 X"$as_myself" : 'X\(//\)$' \| \
+	 X"$as_myself" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$as_myself" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)[^/].*/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\).*/{
+	    s//\1/
+	    q
+	  }
+	  s/.*/./; q'`
+  srcdir=$ac_confdir
+  if test ! -r "$srcdir/$ac_unique_file"; then
+    srcdir=..
+  fi
+else
+  ac_srcdir_defaulted=no
+fi
+if test ! -r "$srcdir/$ac_unique_file"; then
+  test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .."
+  as_fn_error $? "cannot find sources ($ac_unique_file) in $srcdir"
+fi
+ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work"
+ac_abs_confdir=`(
+	cd "$srcdir" && test -r "./$ac_unique_file" || as_fn_error $? "$ac_msg"
+	pwd)`
+# When building in place, set srcdir=.
+if test "$ac_abs_confdir" = "$ac_pwd"; then
+  srcdir=.
+fi
+# Remove unnecessary trailing slashes from srcdir.
+# Double slashes in file names in object file debugging info
+# mess up M-x gdb in Emacs.
+case $srcdir in
+*/) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;;
+esac
+for ac_var in $ac_precious_vars; do
+  eval ac_env_${ac_var}_set=\${${ac_var}+set}
+  eval ac_env_${ac_var}_value=\$${ac_var}
+  eval ac_cv_env_${ac_var}_set=\${${ac_var}+set}
+  eval ac_cv_env_${ac_var}_value=\$${ac_var}
+done
+
+#
+# Report the --help message.
+#
+if test "$ac_init_help" = "long"; then
+  # Omit some internal or obsolete options to make the list less imposing.
+  # This message is too long to be a string in the A/UX 3.1 sh.
+  cat <<_ACEOF
+\`configure' configures norsnet 1.0.12 to adapt to many kinds of systems.
+
+Usage: $0 [OPTION]... [VAR=VALUE]...
+
+To assign environment variables (e.g., CC, CFLAGS...), specify them as
+VAR=VALUE.  See below for descriptions of some of the useful variables.
+
+Defaults for the options are specified in brackets.
+
+Configuration:
+  -h, --help              display this help and exit
+      --help=short        display options specific to this package
+      --help=recursive    display the short help of all the included packages
+  -V, --version           display version information and exit
+  -q, --quiet, --silent   do not print \`checking ...' messages
+      --cache-file=FILE   cache test results in FILE [disabled]
+  -C, --config-cache      alias for \`--cache-file=config.cache'
+  -n, --no-create         do not create output files
+      --srcdir=DIR        find the sources in DIR [configure dir or \`..']
+
+Installation directories:
+  --prefix=PREFIX         install architecture-independent files in PREFIX
+                          [$ac_default_prefix]
+  --exec-prefix=EPREFIX   install architecture-dependent files in EPREFIX
+                          [PREFIX]
+
+By default, \`make install' will install all the files in
+\`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc.  You can specify
+an installation prefix other than \`$ac_default_prefix' using \`--prefix',
+for instance \`--prefix=\$HOME'.
+
+For better control, use the options below.
+
+Fine tuning of the installation directories:
+  --bindir=DIR            user executables [EPREFIX/bin]
+  --sbindir=DIR           system admin executables [EPREFIX/sbin]
+  --libexecdir=DIR        program executables [EPREFIX/libexec]
+  --sysconfdir=DIR        read-only single-machine data [PREFIX/etc]
+  --sharedstatedir=DIR    modifiable architecture-independent data [PREFIX/com]
+  --localstatedir=DIR     modifiable single-machine data [PREFIX/var]
+  --libdir=DIR            object code libraries [EPREFIX/lib]
+  --includedir=DIR        C header files [PREFIX/include]
+  --oldincludedir=DIR     C header files for non-gcc [/usr/include]
+  --datarootdir=DIR       read-only arch.-independent data root [PREFIX/share]
+  --datadir=DIR           read-only architecture-independent data [DATAROOTDIR]
+  --infodir=DIR           info documentation [DATAROOTDIR/info]
+  --localedir=DIR         locale-dependent data [DATAROOTDIR/locale]
+  --mandir=DIR            man documentation [DATAROOTDIR/man]
+  --docdir=DIR            documentation root [DATAROOTDIR/doc/norsnet]
+  --htmldir=DIR           html documentation [DOCDIR]
+  --dvidir=DIR            dvi documentation [DOCDIR]
+  --pdfdir=DIR            pdf documentation [DOCDIR]
+  --psdir=DIR             ps documentation [DOCDIR]
+_ACEOF
+
+  cat <<\_ACEOF
+
+Program names:
+  --program-prefix=PREFIX            prepend PREFIX to installed program names
+  --program-suffix=SUFFIX            append SUFFIX to installed program names
+  --program-transform-name=PROGRAM   run sed PROGRAM on installed program names
+_ACEOF
+fi
+
+if test -n "$ac_init_help"; then
+  case $ac_init_help in
+     short | recursive ) echo "Configuration of norsnet 1.0.12:";;
+   esac
+  cat <<\_ACEOF
+
+Report bugs to <https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsnet>.
+_ACEOF
+ac_status=$?
+fi
+
+if test "$ac_init_help" = "recursive"; then
+  # If there are subdirs, report their specific --help.
+  for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue
+    test -d "$ac_dir" ||
+      { cd "$srcdir" && ac_pwd=`pwd` && srcdir=. && test -d "$ac_dir"; } ||
+      continue
+    ac_builddir=.
+
+case "$ac_dir" in
+.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
+*)
+  ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'`
+  # A ".." for each directory in $ac_dir_suffix.
+  ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
+  case $ac_top_builddir_sub in
+  "") ac_top_builddir_sub=. ac_top_build_prefix= ;;
+  *)  ac_top_build_prefix=$ac_top_builddir_sub/ ;;
+  esac ;;
+esac
+ac_abs_top_builddir=$ac_pwd
+ac_abs_builddir=$ac_pwd$ac_dir_suffix
+# for backward compatibility:
+ac_top_builddir=$ac_top_build_prefix
+
+case $srcdir in
+  .)  # We are building in place.
+    ac_srcdir=.
+    ac_top_srcdir=$ac_top_builddir_sub
+    ac_abs_top_srcdir=$ac_pwd ;;
+  [\\/]* | ?:[\\/]* )  # Absolute name.
+    ac_srcdir=$srcdir$ac_dir_suffix;
+    ac_top_srcdir=$srcdir
+    ac_abs_top_srcdir=$srcdir ;;
+  *) # Relative name.
+    ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix
+    ac_top_srcdir=$ac_top_build_prefix$srcdir
+    ac_abs_top_srcdir=$ac_pwd/$srcdir ;;
+esac
+ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
+
+    cd "$ac_dir" || { ac_status=$?; continue; }
+    # Check for guested configure.
+    if test -f "$ac_srcdir/configure.gnu"; then
+      echo &&
+      $SHELL "$ac_srcdir/configure.gnu" --help=recursive
+    elif test -f "$ac_srcdir/configure"; then
+      echo &&
+      $SHELL "$ac_srcdir/configure" --help=recursive
+    else
+      $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2
+    fi || ac_status=$?
+    cd "$ac_pwd" || { ac_status=$?; break; }
+  done
+fi
+
+test -n "$ac_init_help" && exit $ac_status
+if $ac_init_version; then
+  cat <<\_ACEOF
+norsnet configure 1.0.12
+generated by GNU Autoconf 2.67
+
+Copyright (C) 2010 Free Software Foundation, Inc.
+This configure script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it.
+_ACEOF
+  exit
+fi
+
+## ------------------------ ##
+## Autoconf initialization. ##
+## ------------------------ ##
+cat >config.log <<_ACEOF
+This file contains any messages produced by compilers while
+running configure, to aid debugging if configure makes a mistake.
+
+It was created by norsnet $as_me 1.0.12, which was
+generated by GNU Autoconf 2.67.  Invocation command line was
+
+  $ $0 $@
+
+_ACEOF
+exec 5>>config.log
+{
+cat <<_ASUNAME
+## --------- ##
+## Platform. ##
+## --------- ##
+
+hostname = `(hostname || uname -n) 2>/dev/null | sed 1q`
+uname -m = `(uname -m) 2>/dev/null || echo unknown`
+uname -r = `(uname -r) 2>/dev/null || echo unknown`
+uname -s = `(uname -s) 2>/dev/null || echo unknown`
+uname -v = `(uname -v) 2>/dev/null || echo unknown`
+
+/usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown`
+/bin/uname -X     = `(/bin/uname -X) 2>/dev/null     || echo unknown`
+
+/bin/arch              = `(/bin/arch) 2>/dev/null              || echo unknown`
+/usr/bin/arch -k       = `(/usr/bin/arch -k) 2>/dev/null       || echo unknown`
+/usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown`
+/usr/bin/hostinfo      = `(/usr/bin/hostinfo) 2>/dev/null      || echo unknown`
+/bin/machine           = `(/bin/machine) 2>/dev/null           || echo unknown`
+/usr/bin/oslevel       = `(/usr/bin/oslevel) 2>/dev/null       || echo unknown`
+/bin/universe          = `(/bin/universe) 2>/dev/null          || echo unknown`
+
+_ASUNAME
+
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    $as_echo "PATH: $as_dir"
+  done
+IFS=$as_save_IFS
+
+} >&5
+
+cat >&5 <<_ACEOF
+
+
+## ----------- ##
+## Core tests. ##
+## ----------- ##
+
+_ACEOF
+
+
+# Keep a trace of the command line.
+# Strip out --no-create and --no-recursion so they do not pile up.
+# Strip out --silent because we don't want to record it for future runs.
+# Also quote any args containing shell meta-characters.
+# Make two passes to allow for proper duplicate-argument suppression.
+ac_configure_args=
+ac_configure_args0=
+ac_configure_args1=
+ac_must_keep_next=false
+for ac_pass in 1 2
+do
+  for ac_arg
+  do
+    case $ac_arg in
+    -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;;
+    -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+    | -silent | --silent | --silen | --sile | --sil)
+      continue ;;
+    *\'*)
+      ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;;
+    esac
+    case $ac_pass in
+    1) as_fn_append ac_configure_args0 " '$ac_arg'" ;;
+    2)
+      as_fn_append ac_configure_args1 " '$ac_arg'"
+      if test $ac_must_keep_next = true; then
+	ac_must_keep_next=false # Got value, back to normal.
+      else
+	case $ac_arg in
+	  *=* | --config-cache | -C | -disable-* | --disable-* \
+	  | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \
+	  | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \
+	  | -with-* | --with-* | -without-* | --without-* | --x)
+	    case "$ac_configure_args0 " in
+	      "$ac_configure_args1"*" '$ac_arg' "* ) continue ;;
+	    esac
+	    ;;
+	  -* ) ac_must_keep_next=true ;;
+	esac
+      fi
+      as_fn_append ac_configure_args " '$ac_arg'"
+      ;;
+    esac
+  done
+done
+{ ac_configure_args0=; unset ac_configure_args0;}
+{ ac_configure_args1=; unset ac_configure_args1;}
+
+# When interrupted or exit'd, cleanup temporary files, and complete
+# config.log.  We remove comments because anyway the quotes in there
+# would cause problems or look ugly.
+# WARNING: Use '\'' to represent an apostrophe within the trap.
+# WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug.
+trap 'exit_status=$?
+  # Save into config.log some information that might help in debugging.
+  {
+    echo
+
+    $as_echo "## ---------------- ##
+## Cache variables. ##
+## ---------------- ##"
+    echo
+    # The following way of writing the cache mishandles newlines in values,
+(
+  for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do
+    eval ac_val=\$$ac_var
+    case $ac_val in #(
+    *${as_nl}*)
+      case $ac_var in #(
+      *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
+$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
+      esac
+      case $ac_var in #(
+      _ | IFS | as_nl) ;; #(
+      BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #(
+      *) { eval $ac_var=; unset $ac_var;} ;;
+      esac ;;
+    esac
+  done
+  (set) 2>&1 |
+    case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #(
+    *${as_nl}ac_space=\ *)
+      sed -n \
+	"s/'\''/'\''\\\\'\'''\''/g;
+	  s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p"
+      ;; #(
+    *)
+      sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p"
+      ;;
+    esac |
+    sort
+)
+    echo
+
+    $as_echo "## ----------------- ##
+## Output variables. ##
+## ----------------- ##"
+    echo
+    for ac_var in $ac_subst_vars
+    do
+      eval ac_val=\$$ac_var
+      case $ac_val in
+      *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+      esac
+      $as_echo "$ac_var='\''$ac_val'\''"
+    done | sort
+    echo
+
+    if test -n "$ac_subst_files"; then
+      $as_echo "## ------------------- ##
+## File substitutions. ##
+## ------------------- ##"
+      echo
+      for ac_var in $ac_subst_files
+      do
+	eval ac_val=\$$ac_var
+	case $ac_val in
+	*\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+	esac
+	$as_echo "$ac_var='\''$ac_val'\''"
+      done | sort
+      echo
+    fi
+
+    if test -s confdefs.h; then
+      $as_echo "## ----------- ##
+## confdefs.h. ##
+## ----------- ##"
+      echo
+      cat confdefs.h
+      echo
+    fi
+    test "$ac_signal" != 0 &&
+      $as_echo "$as_me: caught signal $ac_signal"
+    $as_echo "$as_me: exit $exit_status"
+  } >&5
+  rm -f core *.core core.conftest.* &&
+    rm -f -r conftest* confdefs* conf$$* $ac_clean_files &&
+    exit $exit_status
+' 0
+for ac_signal in 1 2 13 15; do
+  trap 'ac_signal='$ac_signal'; as_fn_exit 1' $ac_signal
+done
+ac_signal=0
+
+# confdefs.h avoids OS command line length limits that DEFS can exceed.
+rm -f -r conftest* confdefs.h
+
+$as_echo "/* confdefs.h */" > confdefs.h
+
+# Predefined preprocessor variables.
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_NAME "$PACKAGE_NAME"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_TARNAME "$PACKAGE_TARNAME"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_VERSION "$PACKAGE_VERSION"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_STRING "$PACKAGE_STRING"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_URL "$PACKAGE_URL"
+_ACEOF
+
+
+# Let the site file select an alternate cache file if it wants to.
+# Prefer an explicitly selected file to automatically selected ones.
+ac_site_file1=NONE
+ac_site_file2=NONE
+if test -n "$CONFIG_SITE"; then
+  # We do not want a PATH search for config.site.
+  case $CONFIG_SITE in #((
+    -*)  ac_site_file1=./$CONFIG_SITE;;
+    */*) ac_site_file1=$CONFIG_SITE;;
+    *)   ac_site_file1=./$CONFIG_SITE;;
+  esac
+elif test "x$prefix" != xNONE; then
+  ac_site_file1=$prefix/share/config.site
+  ac_site_file2=$prefix/etc/config.site
+else
+  ac_site_file1=$ac_default_prefix/share/config.site
+  ac_site_file2=$ac_default_prefix/etc/config.site
+fi
+for ac_site_file in "$ac_site_file1" "$ac_site_file2"
+do
+  test "x$ac_site_file" = xNONE && continue
+  if test /dev/null != "$ac_site_file" && test -r "$ac_site_file"; then
+    { $as_echo "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5
+$as_echo "$as_me: loading site script $ac_site_file" >&6;}
+    sed 's/^/| /' "$ac_site_file" >&5
+    . "$ac_site_file" \
+      || { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+as_fn_error $? "failed to load site script $ac_site_file
+See \`config.log' for more details" "$LINENO" 5 ; }
+  fi
+done
+
+if test -r "$cache_file"; then
+  # Some versions of bash will fail to source /dev/null (special files
+  # actually), so we avoid doing that.  DJGPP emulates it as a regular file.
+  if test /dev/null != "$cache_file" && test -f "$cache_file"; then
+    { $as_echo "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5
+$as_echo "$as_me: loading cache $cache_file" >&6;}
+    case $cache_file in
+      [\\/]* | ?:[\\/]* ) . "$cache_file";;
+      *)                      . "./$cache_file";;
+    esac
+  fi
+else
+  { $as_echo "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5
+$as_echo "$as_me: creating cache $cache_file" >&6;}
+  >$cache_file
+fi
+
+# Check that the precious variables saved in the cache have kept the same
+# value.
+ac_cache_corrupted=false
+for ac_var in $ac_precious_vars; do
+  eval ac_old_set=\$ac_cv_env_${ac_var}_set
+  eval ac_new_set=\$ac_env_${ac_var}_set
+  eval ac_old_val=\$ac_cv_env_${ac_var}_value
+  eval ac_new_val=\$ac_env_${ac_var}_value
+  case $ac_old_set,$ac_new_set in
+    set,)
+      { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5
+$as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;}
+      ac_cache_corrupted=: ;;
+    ,set)
+      { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5
+$as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;}
+      ac_cache_corrupted=: ;;
+    ,);;
+    *)
+      if test "x$ac_old_val" != "x$ac_new_val"; then
+	# differences in whitespace do not lead to failure.
+	ac_old_val_w=`echo x $ac_old_val`
+	ac_new_val_w=`echo x $ac_new_val`
+	if test "$ac_old_val_w" != "$ac_new_val_w"; then
+	  { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5
+$as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;}
+	  ac_cache_corrupted=:
+	else
+	  { $as_echo "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5
+$as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;}
+	  eval $ac_var=\$ac_old_val
+	fi
+	{ $as_echo "$as_me:${as_lineno-$LINENO}:   former value:  \`$ac_old_val'" >&5
+$as_echo "$as_me:   former value:  \`$ac_old_val'" >&2;}
+	{ $as_echo "$as_me:${as_lineno-$LINENO}:   current value: \`$ac_new_val'" >&5
+$as_echo "$as_me:   current value: \`$ac_new_val'" >&2;}
+      fi;;
+  esac
+  # Pass precious variables to config.status.
+  if test "$ac_new_set" = set; then
+    case $ac_new_val in
+    *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;;
+    *) ac_arg=$ac_var=$ac_new_val ;;
+    esac
+    case " $ac_configure_args " in
+      *" '$ac_arg' "*) ;; # Avoid dups.  Use of quotes ensures accuracy.
+      *) as_fn_append ac_configure_args " '$ac_arg'" ;;
+    esac
+  fi
+done
+if $ac_cache_corrupted; then
+  { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+  { $as_echo "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5
+$as_echo "$as_me: error: changes in the environment can compromise the build" >&2;}
+  as_fn_error $? "run \`make distclean' and/or \`rm $cache_file' and start over" "$LINENO" 5
+fi
+## -------------------- ##
+## Main body of script. ##
+## -------------------- ##
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+
+
+am__api_version='1.11'
+
+ac_aux_dir=
+for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do
+  if test -f "$ac_dir/install-sh"; then
+    ac_aux_dir=$ac_dir
+    ac_install_sh="$ac_aux_dir/install-sh -c"
+    break
+  elif test -f "$ac_dir/install.sh"; then
+    ac_aux_dir=$ac_dir
+    ac_install_sh="$ac_aux_dir/install.sh -c"
+    break
+  elif test -f "$ac_dir/shtool"; then
+    ac_aux_dir=$ac_dir
+    ac_install_sh="$ac_aux_dir/shtool install -c"
+    break
+  fi
+done
+if test -z "$ac_aux_dir"; then
+  as_fn_error $? "cannot find install-sh, install.sh, or shtool in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" "$LINENO" 5
+fi
+
+# These three variables are undocumented and unsupported,
+# and are intended to be withdrawn in a future Autoconf release.
+# They can cause serious problems if a builder's source tree is in a directory
+# whose full name contains unusual characters.
+ac_config_guess="$SHELL $ac_aux_dir/config.guess"  # Please don't use this var.
+ac_config_sub="$SHELL $ac_aux_dir/config.sub"  # Please don't use this var.
+ac_configure="$SHELL $ac_aux_dir/configure"  # Please don't use this var.
+
+
+# Find a good install program.  We prefer a C program (faster),
+# so one script is as good as another.  But avoid the broken or
+# incompatible versions:
+# SysV /etc/install, /usr/sbin/install
+# SunOS /usr/etc/install
+# IRIX /sbin/install
+# AIX /bin/install
+# AmigaOS /C/install, which installs bootblocks on floppy discs
+# AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag
+# AFS /usr/afsws/bin/install, which mishandles nonexistent args
+# SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff"
+# OS/2's system install, which has a completely different semantic
+# ./install, which can be erroneously created by make from ./install.sh.
+# Reject install programs that cannot install multiple files.
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5
+$as_echo_n "checking for a BSD-compatible install... " >&6; }
+if test -z "$INSTALL"; then
+if test "${ac_cv_path_install+set}" = set; then :
+  $as_echo_n "(cached) " >&6
+else
+  as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    # Account for people who put trailing slashes in PATH elements.
+case $as_dir/ in #((
+  ./ | .// | /[cC]/* | \
+  /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \
+  ?:[\\/]os2[\\/]install[\\/]* | ?:[\\/]OS2[\\/]INSTALL[\\/]* | \
+  /usr/ucb/* ) ;;
+  *)
+    # OSF1 and SCO ODT 3.0 have their own names for install.
+    # Don't use installbsd from OSF since it installs stuff as root
+    # by default.
+    for ac_prog in ginstall scoinst install; do
+      for ac_exec_ext in '' $ac_executable_extensions; do
+	if { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; }; then
+	  if test $ac_prog = install &&
+	    grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+	    # AIX install.  It has an incompatible calling convention.
+	    :
+	  elif test $ac_prog = install &&
+	    grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+	    # program-specific install script used by HP pwplus--don't use.
+	    :
+	  else
+	    rm -rf conftest.one conftest.two conftest.dir
+	    echo one > conftest.one
+	    echo two > conftest.two
+	    mkdir conftest.dir
+	    if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" &&
+	      test -s conftest.one && test -s conftest.two &&
+	      test -s conftest.dir/conftest.one &&
+	      test -s conftest.dir/conftest.two
+	    then
+	      ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c"
+	      break 3
+	    fi
+	  fi
+	fi
+      done
+    done
+    ;;
+esac
+
+  done
+IFS=$as_save_IFS
+
+rm -rf conftest.one conftest.two conftest.dir
+
+fi
+  if test "${ac_cv_path_install+set}" = set; then
+    INSTALL=$ac_cv_path_install
+  else
+    # As a last resort, use the slow shell script.  Don't cache a
+    # value for INSTALL within a source directory, because that will
+    # break other packages using the cache if that directory is
+    # removed, or if the value is a relative name.
+    INSTALL=$ac_install_sh
+  fi
+fi
+{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5
+$as_echo "$INSTALL" >&6; }
+
+# Use test -z because SunOS4 sh mishandles braces in ${var-val}.
+# It thinks the first close brace ends the variable substitution.
+test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}'
+
+test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}'
+
+test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644'
+
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether build environment is sane" >&5
+$as_echo_n "checking whether build environment is sane... " >&6; }
+# Just in case
+sleep 1
+echo timestamp > conftest.file
+# Reject unsafe characters in $srcdir or the absolute working directory
+# name.  Accept space and tab only in the latter.
+am_lf='
+'
+case `pwd` in
+  *[\\\"\#\$\&\'\`$am_lf]*)
+    as_fn_error $? "unsafe absolute working directory name" "$LINENO" 5 ;;
+esac
+case $srcdir in
+  *[\\\"\#\$\&\'\`$am_lf\ \	]*)
+    as_fn_error $? "unsafe srcdir value: \`$srcdir'" "$LINENO" 5 ;;
+esac
+
+# Do `set' in a subshell so we don't clobber the current shell's
+# arguments.  Must try -L first in case configure is actually a
+# symlink; some systems play weird games with the mod time of symlinks
+# (eg FreeBSD returns the mod time of the symlink's containing
+# directory).
+if (
+   set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null`
+   if test "$*" = "X"; then
+      # -L didn't work.
+      set X `ls -t "$srcdir/configure" conftest.file`
+   fi
+   rm -f conftest.file
+   if test "$*" != "X $srcdir/configure conftest.file" \
+      && test "$*" != "X conftest.file $srcdir/configure"; then
+
+      # If neither matched, then we have a broken ls.  This can happen
+      # if, for instance, CONFIG_SHELL is bash and it inherits a
+      # broken ls alias from the environment.  This has actually
+      # happened.  Such a system could not be considered "sane".
+      as_fn_error $? "ls -t appears to fail.  Make sure there is not a broken
+alias in your environment" "$LINENO" 5
+   fi
+
+   test "$2" = conftest.file
+   )
+then
+   # Ok.
+   :
+else
+   as_fn_error $? "newly created file is older than distributed files!
+Check your system clock" "$LINENO" 5
+fi
+{ $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5
+$as_echo "yes" >&6; }
+test "$program_prefix" != NONE &&
+  program_transform_name="s&^&$program_prefix&;$program_transform_name"
+# Use a double $ so make ignores it.
+test "$program_suffix" != NONE &&
+  program_transform_name="s&\$&$program_suffix&;$program_transform_name"
+# Double any \ or $.
+# By default was `s,x,x', remove it if useless.
+ac_script='s/[\\$]/&&/g;s/;s,x,x,$//'
+program_transform_name=`$as_echo "$program_transform_name" | sed "$ac_script"`
+
+# expand $ac_aux_dir to an absolute path
+am_aux_dir=`cd $ac_aux_dir && pwd`
+
+if test x"${MISSING+set}" != xset; then
+  case $am_aux_dir in
+  *\ * | *\	*)
+    MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;;
+  *)
+    MISSING="\${SHELL} $am_aux_dir/missing" ;;
+  esac
+fi
+# Use eval to expand $SHELL
+if eval "$MISSING --run true"; then
+  am_missing_run="$MISSING --run "
+else
+  am_missing_run=
+  { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: \`missing' script is too old or missing" >&5
+$as_echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;}
+fi
+
+if test x"${install_sh}" != xset; then
+  case $am_aux_dir in
+  *\ * | *\	*)
+    install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;;
+  *)
+    install_sh="\${SHELL} $am_aux_dir/install-sh"
+  esac
+fi
+
+# Installed binaries are usually stripped using `strip' when the user
+# run `make install-strip'.  However `strip' might not be the right
+# tool to use in cross-compilation environments, therefore Automake
+# will honor the `STRIP' environment variable to overrule this program.
+if test "$cross_compiling" != no; then
+  if test -n "$ac_tool_prefix"; then
+  # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args.
+set dummy ${ac_tool_prefix}strip; ac_word=$2
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+$as_echo_n "checking for $ac_word... " >&6; }
+if test "${ac_cv_prog_STRIP+set}" = set; then :
+  $as_echo_n "(cached) " >&6
+else
+  if test -n "$STRIP"; then
+  ac_cv_prog_STRIP="$STRIP" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    for ac_exec_ext in '' $ac_executable_extensions; do
+  if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+    ac_cv_prog_STRIP="${ac_tool_prefix}strip"
+    $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+  done
+IFS=$as_save_IFS
+
+fi
+fi
+STRIP=$ac_cv_prog_STRIP
+if test -n "$STRIP"; then
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: $STRIP" >&5
+$as_echo "$STRIP" >&6; }
+else
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+fi
+
+
+fi
+if test -z "$ac_cv_prog_STRIP"; then
+  ac_ct_STRIP=$STRIP
+  # Extract the first word of "strip", so it can be a program name with args.
+set dummy strip; ac_word=$2
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+$as_echo_n "checking for $ac_word... " >&6; }
+if test "${ac_cv_prog_ac_ct_STRIP+set}" = set; then :
+  $as_echo_n "(cached) " >&6
+else
+  if test -n "$ac_ct_STRIP"; then
+  ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    for ac_exec_ext in '' $ac_executable_extensions; do
+  if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+    ac_cv_prog_ac_ct_STRIP="strip"
+    $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+  done
+IFS=$as_save_IFS
+
+fi
+fi
+ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP
+if test -n "$ac_ct_STRIP"; then
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_STRIP" >&5
+$as_echo "$ac_ct_STRIP" >&6; }
+else
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+fi
+
+  if test "x$ac_ct_STRIP" = x; then
+    STRIP=":"
+  else
+    case $cross_compiling:$ac_tool_warned in
+yes:)
+{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
+$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
+ac_tool_warned=yes ;;
+esac
+    STRIP=$ac_ct_STRIP
+  fi
+else
+  STRIP="$ac_cv_prog_STRIP"
+fi
+
+fi
+INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s"
+
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for a thread-safe mkdir -p" >&5
+$as_echo_n "checking for a thread-safe mkdir -p... " >&6; }
+if test -z "$MKDIR_P"; then
+  if test "${ac_cv_path_mkdir+set}" = set; then :
+  $as_echo_n "(cached) " >&6
+else
+  as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH$PATH_SEPARATOR/opt/sfw/bin
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    for ac_prog in mkdir gmkdir; do
+	 for ac_exec_ext in '' $ac_executable_extensions; do
+	   { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; } || continue
+	   case `"$as_dir/$ac_prog$ac_exec_ext" --version 2>&1` in #(
+	     'mkdir (GNU coreutils) '* | \
+	     'mkdir (coreutils) '* | \
+	     'mkdir (fileutils) '4.1*)
+	       ac_cv_path_mkdir=$as_dir/$ac_prog$ac_exec_ext
+	       break 3;;
+	   esac
+	 done
+       done
+  done
+IFS=$as_save_IFS
+
+fi
+
+  test -d ./--version && rmdir ./--version
+  if test "${ac_cv_path_mkdir+set}" = set; then
+    MKDIR_P="$ac_cv_path_mkdir -p"
+  else
+    # As a last resort, use the slow shell script.  Don't cache a
+    # value for MKDIR_P within a source directory, because that will
+    # break other packages using the cache if that directory is
+    # removed, or if the value is a relative name.
+    MKDIR_P="$ac_install_sh -d"
+  fi
+fi
+{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $MKDIR_P" >&5
+$as_echo "$MKDIR_P" >&6; }
+
+mkdir_p="$MKDIR_P"
+case $mkdir_p in
+  [\\/$]* | ?:[\\/]*) ;;
+  */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;;
+esac
+
+for ac_prog in gawk mawk nawk awk
+do
+  # Extract the first word of "$ac_prog", so it can be a program name with args.
+set dummy $ac_prog; ac_word=$2
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+$as_echo_n "checking for $ac_word... " >&6; }
+if test "${ac_cv_prog_AWK+set}" = set; then :
+  $as_echo_n "(cached) " >&6
+else
+  if test -n "$AWK"; then
+  ac_cv_prog_AWK="$AWK" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    for ac_exec_ext in '' $ac_executable_extensions; do
+  if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+    ac_cv_prog_AWK="$ac_prog"
+    $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+  done
+IFS=$as_save_IFS
+
+fi
+fi
+AWK=$ac_cv_prog_AWK
+if test -n "$AWK"; then
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: $AWK" >&5
+$as_echo "$AWK" >&6; }
+else
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+fi
+
+
+  test -n "$AWK" && break
+done
+
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5
+$as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; }
+set x ${MAKE-make}
+ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'`
+if eval "test \"\${ac_cv_prog_make_${ac_make}_set+set}\"" = set; then :
+  $as_echo_n "(cached) " >&6
+else
+  cat >conftest.make <<\_ACEOF
+SHELL = /bin/sh
+all:
+	@echo '@@@%%%=$(MAKE)=@@@%%%'
+_ACEOF
+# GNU make sometimes prints "make[1]: Entering ...", which would confuse us.
+case `${MAKE-make} -f conftest.make 2>/dev/null` in
+  *@@@%%%=?*=@@@%%%*)
+    eval ac_cv_prog_make_${ac_make}_set=yes;;
+  *)
+    eval ac_cv_prog_make_${ac_make}_set=no;;
+esac
+rm -f conftest.make
+fi
+if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5
+$as_echo "yes" >&6; }
+  SET_MAKE=
+else
+  { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+  SET_MAKE="MAKE=${MAKE-make}"
+fi
+
+rm -rf .tst 2>/dev/null
+mkdir .tst 2>/dev/null
+if test -d .tst; then
+  am__leading_dot=.
+else
+  am__leading_dot=_
+fi
+rmdir .tst 2>/dev/null
+
+if test "`cd $srcdir && pwd`" != "`pwd`"; then
+  # Use -I$(srcdir) only when $(srcdir) != ., so that make's output
+  # is not polluted with repeated "-I."
+  am__isrc=' -I$(srcdir)'
+  # test to see if srcdir already configured
+  if test -f $srcdir/config.status; then
+    as_fn_error $? "source directory already configured; run \"make distclean\" there first" "$LINENO" 5
+  fi
+fi
+
+# test whether we have cygpath
+if test -z "$CYGPATH_W"; then
+  if (cygpath --version) >/dev/null 2>/dev/null; then
+    CYGPATH_W='cygpath -w'
+  else
+    CYGPATH_W=echo
+  fi
+fi
+
+
+# Define the identity of the package.
+ PACKAGE='norsnet'
+ VERSION='1.0.12'
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE "$PACKAGE"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define VERSION "$VERSION"
+_ACEOF
+
+# Some tools Automake needs.
+
+ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"}
+
+
+AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"}
+
+
+AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"}
+
+
+AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"}
+
+
+MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"}
+
+# We need awk for the "check" target.  The system "awk" is bad on
+# some platforms.
+# Always define AMTAR for backward compatibility.
+
+AMTAR=${AMTAR-"${am_missing_run}tar"}
+
+am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'
+
+
+
+
+
+ac_config_files="$ac_config_files Makefile scr/Makefile example/Makefile"
+
+
+cat >confcache <<\_ACEOF
+# This file is a shell script that caches the results of configure
+# tests run on this system so they can be shared between configure
+# scripts and configure runs, see configure's option --config-cache.
+# It is not useful on other systems.  If it contains results you don't
+# want to keep, you may remove or edit it.
+#
+# config.status only pays attention to the cache file if you give it
+# the --recheck option to rerun configure.
+#
+# `ac_cv_env_foo' variables (set or unset) will be overridden when
+# loading this file, other *unset* `ac_cv_foo' will be assigned the
+# following values.
+
+_ACEOF
+
+# The following way of writing the cache mishandles newlines in values,
+# but we know of no workaround that is simple, portable, and efficient.
+# So, we kill variables containing newlines.
+# Ultrix sh set writes to stderr and can't be redirected directly,
+# and sets the high bit in the cache file unless we assign to the vars.
+(
+  for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do
+    eval ac_val=\$$ac_var
+    case $ac_val in #(
+    *${as_nl}*)
+      case $ac_var in #(
+      *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
+$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
+      esac
+      case $ac_var in #(
+      _ | IFS | as_nl) ;; #(
+      BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #(
+      *) { eval $ac_var=; unset $ac_var;} ;;
+      esac ;;
+    esac
+  done
+
+  (set) 2>&1 |
+    case $as_nl`(ac_space=' '; set) 2>&1` in #(
+    *${as_nl}ac_space=\ *)
+      # `set' does not quote correctly, so add quotes: double-quote
+      # substitution turns \\\\ into \\, and sed turns \\ into \.
+      sed -n \
+	"s/'/'\\\\''/g;
+	  s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p"
+      ;; #(
+    *)
+      # `set' quotes correctly as required by POSIX, so do not add quotes.
+      sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p"
+      ;;
+    esac |
+    sort
+) |
+  sed '
+     /^ac_cv_env_/b end
+     t clear
+     :clear
+     s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/
+     t end
+     s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/
+     :end' >>confcache
+if diff "$cache_file" confcache >/dev/null 2>&1; then :; else
+  if test -w "$cache_file"; then
+    test "x$cache_file" != "x/dev/null" &&
+      { $as_echo "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5
+$as_echo "$as_me: updating cache $cache_file" >&6;}
+    cat confcache >$cache_file
+  else
+    { $as_echo "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5
+$as_echo "$as_me: not updating unwritable cache $cache_file" >&6;}
+  fi
+fi
+rm -f confcache
+
+test "x$prefix" = xNONE && prefix=$ac_default_prefix
+# Let make expand exec_prefix.
+test "x$exec_prefix" = xNONE && exec_prefix='${prefix}'
+
+# Transform confdefs.h into DEFS.
+# Protect against shell expansion while executing Makefile rules.
+# Protect against Makefile macro expansion.
+#
+# If the first sed substitution is executed (which looks for macros that
+# take arguments), then branch to the quote section.  Otherwise,
+# look for a macro that doesn't take arguments.
+ac_script='
+:mline
+/\\$/{
+ N
+ s,\\\n,,
+ b mline
+}
+t clear
+:clear
+s/^[	 ]*#[	 ]*define[	 ][	 ]*\([^	 (][^	 (]*([^)]*)\)[	 ]*\(.*\)/-D\1=\2/g
+t quote
+s/^[	 ]*#[	 ]*define[	 ][	 ]*\([^	 ][^	 ]*\)[	 ]*\(.*\)/-D\1=\2/g
+t quote
+b any
+:quote
+s/[	 `~#$^&*(){}\\|;'\''"<>?]/\\&/g
+s/\[/\\&/g
+s/\]/\\&/g
+s/\$/$$/g
+H
+:any
+${
+	g
+	s/^\n//
+	s/\n/ /g
+	p
+}
+'
+DEFS=`sed -n "$ac_script" confdefs.h`
+
+
+ac_libobjs=
+ac_ltlibobjs=
+U=
+for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue
+  # 1. Remove the extension, and $U if already installed.
+  ac_script='s/\$U\././;s/\.o$//;s/\.obj$//'
+  ac_i=`$as_echo "$ac_i" | sed "$ac_script"`
+  # 2. Prepend LIBOBJDIR.  When used with automake>=1.10 LIBOBJDIR
+  #    will be set to the directory where LIBOBJS objects are built.
+  as_fn_append ac_libobjs " \${LIBOBJDIR}$ac_i\$U.$ac_objext"
+  as_fn_append ac_ltlibobjs " \${LIBOBJDIR}$ac_i"'$U.lo'
+done
+LIBOBJS=$ac_libobjs
+
+LTLIBOBJS=$ac_ltlibobjs
+
+
+
+
+: ${CONFIG_STATUS=./config.status}
+ac_write_fail=0
+ac_clean_files_save=$ac_clean_files
+ac_clean_files="$ac_clean_files $CONFIG_STATUS"
+{ $as_echo "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5
+$as_echo "$as_me: creating $CONFIG_STATUS" >&6;}
+as_write_fail=0
+cat >$CONFIG_STATUS <<_ASEOF || as_write_fail=1
+#! $SHELL
+# Generated by $as_me.
+# Run this file to recreate the current configuration.
+# Compiler output produced by configure, useful for debugging
+# configure, is in config.log if it exists.
+
+debug=false
+ac_cs_recheck=false
+ac_cs_silent=false
+
+SHELL=\${CONFIG_SHELL-$SHELL}
+export SHELL
+_ASEOF
+cat >>$CONFIG_STATUS <<\_ASEOF || as_write_fail=1
+## -------------------- ##
+## M4sh Initialization. ##
+## -------------------- ##
+
+# Be more Bourne compatible
+DUALCASE=1; export DUALCASE # for MKS sh
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then :
+  emulate sh
+  NULLCMD=:
+  # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which
+  # is contrary to our usage.  Disable this feature.
+  alias -g '${1+"$@"}'='"$@"'
+  setopt NO_GLOB_SUBST
+else
+  case `(set -o) 2>/dev/null` in #(
+  *posix*) :
+    set -o posix ;; #(
+  *) :
+     ;;
+esac
+fi
+
+
+as_nl='
+'
+export as_nl
+# Printing a long string crashes Solaris 7 /usr/bin/printf.
+as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\'
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo
+# Prefer a ksh shell builtin over an external printf program on Solaris,
+# but without wasting forks for bash or zsh.
+if test -z "$BASH_VERSION$ZSH_VERSION" \
+    && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then
+  as_echo='print -r --'
+  as_echo_n='print -rn --'
+elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then
+  as_echo='printf %s\n'
+  as_echo_n='printf %s'
+else
+  if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then
+    as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"'
+    as_echo_n='/usr/ucb/echo -n'
+  else
+    as_echo_body='eval expr "X$1" : "X\\(.*\\)"'
+    as_echo_n_body='eval
+      arg=$1;
+      case $arg in #(
+      *"$as_nl"*)
+	expr "X$arg" : "X\\(.*\\)$as_nl";
+	arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;;
+      esac;
+      expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl"
+    '
+    export as_echo_n_body
+    as_echo_n='sh -c $as_echo_n_body as_echo'
+  fi
+  export as_echo_body
+  as_echo='sh -c $as_echo_body as_echo'
+fi
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+  PATH_SEPARATOR=:
+  (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && {
+    (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 ||
+      PATH_SEPARATOR=';'
+  }
+fi
+
+
+# IFS
+# We need space, tab and new line, in precisely that order.  Quoting is
+# there to prevent editors from complaining about space-tab.
+# (If _AS_PATH_WALK were called with IFS unset, it would disable word
+# splitting by setting IFS to empty value.)
+IFS=" ""	$as_nl"
+
+# Find who we are.  Look in the path if we contain no directory separator.
+case $0 in #((
+  *[\\/]* ) as_myself=$0 ;;
+  *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+    test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+  done
+IFS=$as_save_IFS
+
+     ;;
+esac
+# We did not find ourselves, most probably we were run as `sh COMMAND'
+# in which case we are not to be found in the path.
+if test "x$as_myself" = x; then
+  as_myself=$0
+fi
+if test ! -f "$as_myself"; then
+  $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+  exit 1
+fi
+
+# Unset variables that we do not need and which cause bugs (e.g. in
+# pre-3.0 UWIN ksh).  But do not cause bugs in bash 2.01; the "|| exit 1"
+# suppresses any "Segmentation fault" message there.  '((' could
+# trigger a bug in pdksh 5.2.14.
+for as_var in BASH_ENV ENV MAIL MAILPATH
+do eval test x\${$as_var+set} = xset \
+  && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
+done
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+LC_ALL=C
+export LC_ALL
+LANGUAGE=C
+export LANGUAGE
+
+# CDPATH.
+(unset CDPATH) >/dev/null 2>&1 && unset CDPATH
+
+
+# as_fn_error STATUS ERROR [LINENO LOG_FD]
+# ----------------------------------------
+# Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are
+# provided, also output the error to LOG_FD, referencing LINENO. Then exit the
+# script with STATUS, using 1 if that was 0.
+as_fn_error ()
+{
+  as_status=$1; test $as_status -eq 0 && as_status=1
+  if test "$4"; then
+    as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
+    $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
+  fi
+  $as_echo "$as_me: error: $2" >&2
+  as_fn_exit $as_status
+} # as_fn_error
+
+
+# as_fn_set_status STATUS
+# -----------------------
+# Set $? to STATUS, without forking.
+as_fn_set_status ()
+{
+  return $1
+} # as_fn_set_status
+
+# as_fn_exit STATUS
+# -----------------
+# Exit the shell with STATUS, even in a "trap 0" or "set -e" context.
+as_fn_exit ()
+{
+  set +e
+  as_fn_set_status $1
+  exit $1
+} # as_fn_exit
+
+# as_fn_unset VAR
+# ---------------
+# Portably unset VAR.
+as_fn_unset ()
+{
+  { eval $1=; unset $1;}
+}
+as_unset=as_fn_unset
+# as_fn_append VAR VALUE
+# ----------------------
+# Append the text in VALUE to the end of the definition contained in VAR. Take
+# advantage of any shell optimizations that allow amortized linear growth over
+# repeated appends, instead of the typical quadratic growth present in naive
+# implementations.
+if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then :
+  eval 'as_fn_append ()
+  {
+    eval $1+=\$2
+  }'
+else
+  as_fn_append ()
+  {
+    eval $1=\$$1\$2
+  }
+fi # as_fn_append
+
+# as_fn_arith ARG...
+# ------------------
+# Perform arithmetic evaluation on the ARGs, and store the result in the
+# global $as_val. Take advantage of shells that can avoid forks. The arguments
+# must be portable across $(()) and expr.
+if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then :
+  eval 'as_fn_arith ()
+  {
+    as_val=$(( $* ))
+  }'
+else
+  as_fn_arith ()
+  {
+    as_val=`expr "$@" || test $? -eq 1`
+  }
+fi # as_fn_arith
+
+
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+   test "X`expr 00001 : '.*\(...\)'`" = X001; then
+  as_expr=expr
+else
+  as_expr=false
+fi
+
+if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then
+  as_basename=basename
+else
+  as_basename=false
+fi
+
+if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then
+  as_dirname=dirname
+else
+  as_dirname=false
+fi
+
+as_me=`$as_basename -- "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+	 X"$0" : 'X\(//\)$' \| \
+	 X"$0" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X/"$0" |
+    sed '/^.*\/\([^/][^/]*\)\/*$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\/\(\/\/\)$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\/\(\/\).*/{
+	    s//\1/
+	    q
+	  }
+	  s/.*/./; q'`
+
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+ECHO_C= ECHO_N= ECHO_T=
+case `echo -n x` in #(((((
+-n*)
+  case `echo 'xy\c'` in
+  *c*) ECHO_T='	';;	# ECHO_T is single tab character.
+  xy)  ECHO_C='\c';;
+  *)   echo `echo ksh88 bug on AIX 6.1` > /dev/null
+       ECHO_T='	';;
+  esac;;
+*)
+  ECHO_N='-n';;
+esac
+
+rm -f conf$$ conf$$.exe conf$$.file
+if test -d conf$$.dir; then
+  rm -f conf$$.dir/conf$$.file
+else
+  rm -f conf$$.dir
+  mkdir conf$$.dir 2>/dev/null
+fi
+if (echo >conf$$.file) 2>/dev/null; then
+  if ln -s conf$$.file conf$$ 2>/dev/null; then
+    as_ln_s='ln -s'
+    # ... but there are two gotchas:
+    # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail.
+    # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable.
+    # In both cases, we have to default to `cp -p'.
+    ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe ||
+      as_ln_s='cp -p'
+  elif ln conf$$.file conf$$ 2>/dev/null; then
+    as_ln_s=ln
+  else
+    as_ln_s='cp -p'
+  fi
+else
+  as_ln_s='cp -p'
+fi
+rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file
+rmdir conf$$.dir 2>/dev/null
+
+
+# as_fn_mkdir_p
+# -------------
+# Create "$as_dir" as a directory, including parents if necessary.
+as_fn_mkdir_p ()
+{
+
+  case $as_dir in #(
+  -*) as_dir=./$as_dir;;
+  esac
+  test -d "$as_dir" || eval $as_mkdir_p || {
+    as_dirs=
+    while :; do
+      case $as_dir in #(
+      *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
+      *) as_qdir=$as_dir;;
+      esac
+      as_dirs="'$as_qdir' $as_dirs"
+      as_dir=`$as_dirname -- "$as_dir" ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$as_dir" : 'X\(//\)[^/]' \| \
+	 X"$as_dir" : 'X\(//\)$' \| \
+	 X"$as_dir" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$as_dir" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)[^/].*/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\).*/{
+	    s//\1/
+	    q
+	  }
+	  s/.*/./; q'`
+      test -d "$as_dir" && break
+    done
+    test -z "$as_dirs" || eval "mkdir $as_dirs"
+  } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir"
+
+
+} # as_fn_mkdir_p
+if mkdir -p . 2>/dev/null; then
+  as_mkdir_p='mkdir -p "$as_dir"'
+else
+  test -d ./-p && rmdir ./-p
+  as_mkdir_p=false
+fi
+
+if test -x / >/dev/null 2>&1; then
+  as_test_x='test -x'
+else
+  if ls -dL / >/dev/null 2>&1; then
+    as_ls_L_option=L
+  else
+    as_ls_L_option=
+  fi
+  as_test_x='
+    eval sh -c '\''
+      if test -d "$1"; then
+	test -d "$1/.";
+      else
+	case $1 in #(
+	-*)set "./$1";;
+	esac;
+	case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in #((
+	???[sx]*):;;*)false;;esac;fi
+    '\'' sh
+  '
+fi
+as_executable_p=$as_test_x
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+exec 6>&1
+## ----------------------------------- ##
+## Main body of $CONFIG_STATUS script. ##
+## ----------------------------------- ##
+_ASEOF
+test $as_write_fail = 0 && chmod +x $CONFIG_STATUS || ac_write_fail=1
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+# Save the log message, to keep $0 and so on meaningful, and to
+# report actual input values of CONFIG_FILES etc. instead of their
+# values after options handling.
+ac_log="
+This file was extended by norsnet $as_me 1.0.12, which was
+generated by GNU Autoconf 2.67.  Invocation command line was
+
+  CONFIG_FILES    = $CONFIG_FILES
+  CONFIG_HEADERS  = $CONFIG_HEADERS
+  CONFIG_LINKS    = $CONFIG_LINKS
+  CONFIG_COMMANDS = $CONFIG_COMMANDS
+  $ $0 $@
+
+on `(hostname || uname -n) 2>/dev/null | sed 1q`
+"
+
+_ACEOF
+
+case $ac_config_files in *"
+"*) set x $ac_config_files; shift; ac_config_files=$*;;
+esac
+
+
+
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+# Files that config.status was made for.
+config_files="$ac_config_files"
+
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+ac_cs_usage="\
+\`$as_me' instantiates files and other configuration actions
+from templates according to the current configuration.  Unless the files
+and actions are specified as TAGs, all are instantiated by default.
+
+Usage: $0 [OPTION]... [TAG]...
+
+  -h, --help       print this help, then exit
+  -V, --version    print version number and configuration settings, then exit
+      --config     print configuration, then exit
+  -q, --quiet, --silent
+                   do not print progress messages
+  -d, --debug      don't remove temporary files
+      --recheck    update $as_me by reconfiguring in the same conditions
+      --file=FILE[:TEMPLATE]
+                   instantiate the configuration file FILE
+
+Configuration files:
+$config_files
+
+Report bugs to <https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsnet>."
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`"
+ac_cs_version="\\
+norsnet config.status 1.0.12
+configured by $0, generated by GNU Autoconf 2.67,
+  with options \\"\$ac_cs_config\\"
+
+Copyright (C) 2010 Free Software Foundation, Inc.
+This config.status script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it."
+
+ac_pwd='$ac_pwd'
+srcdir='$srcdir'
+INSTALL='$INSTALL'
+MKDIR_P='$MKDIR_P'
+AWK='$AWK'
+test -n "\$AWK" || AWK=awk
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+# The default lists apply if the user does not specify any file.
+ac_need_defaults=:
+while test $# != 0
+do
+  case $1 in
+  --*=?*)
+    ac_option=`expr "X$1" : 'X\([^=]*\)='`
+    ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'`
+    ac_shift=:
+    ;;
+  --*=)
+    ac_option=`expr "X$1" : 'X\([^=]*\)='`
+    ac_optarg=
+    ac_shift=:
+    ;;
+  *)
+    ac_option=$1
+    ac_optarg=$2
+    ac_shift=shift
+    ;;
+  esac
+
+  case $ac_option in
+  # Handling of the options.
+  -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r)
+    ac_cs_recheck=: ;;
+  --version | --versio | --versi | --vers | --ver | --ve | --v | -V )
+    $as_echo "$ac_cs_version"; exit ;;
+  --config | --confi | --conf | --con | --co | --c )
+    $as_echo "$ac_cs_config"; exit ;;
+  --debug | --debu | --deb | --de | --d | -d )
+    debug=: ;;
+  --file | --fil | --fi | --f )
+    $ac_shift
+    case $ac_optarg in
+    *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;;
+    '') as_fn_error $? "missing file argument" ;;
+    esac
+    as_fn_append CONFIG_FILES " '$ac_optarg'"
+    ac_need_defaults=false;;
+  --he | --h |  --help | --hel | -h )
+    $as_echo "$ac_cs_usage"; exit ;;
+  -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+  | -silent | --silent | --silen | --sile | --sil | --si | --s)
+    ac_cs_silent=: ;;
+
+  # This is an error.
+  -*) as_fn_error $? "unrecognized option: \`$1'
+Try \`$0 --help' for more information." ;;
+
+  *) as_fn_append ac_config_targets " $1"
+     ac_need_defaults=false ;;
+
+  esac
+  shift
+done
+
+ac_configure_extra_args=
+
+if $ac_cs_silent; then
+  exec 6>/dev/null
+  ac_configure_extra_args="$ac_configure_extra_args --silent"
+fi
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+if \$ac_cs_recheck; then
+  set X '$SHELL' '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion
+  shift
+  \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6
+  CONFIG_SHELL='$SHELL'
+  export CONFIG_SHELL
+  exec "\$@"
+fi
+
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+exec 5>>config.log
+{
+  echo
+  sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX
+## Running $as_me. ##
+_ASBOX
+  $as_echo "$ac_log"
+} >&5
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+
+# Handling of arguments.
+for ac_config_target in $ac_config_targets
+do
+  case $ac_config_target in
+    "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;;
+    "scr/Makefile") CONFIG_FILES="$CONFIG_FILES scr/Makefile" ;;
+    "example/Makefile") CONFIG_FILES="$CONFIG_FILES example/Makefile" ;;
+
+  *) as_fn_error $? "invalid argument: \`$ac_config_target'" "$LINENO" 5 ;;
+  esac
+done
+
+
+# If the user did not use the arguments to specify the items to instantiate,
+# then the envvar interface is used.  Set only those that are not.
+# We use the long form for the default assignment because of an extremely
+# bizarre bug on SunOS 4.1.3.
+if $ac_need_defaults; then
+  test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files
+fi
+
+# Have a temporary directory for convenience.  Make it in the build tree
+# simply because there is no reason against having it here, and in addition,
+# creating and moving files from /tmp can sometimes cause problems.
+# Hook for its removal unless debugging.
+# Note that there is a small window in which the directory will not be cleaned:
+# after its creation but before its name has been assigned to `$tmp'.
+$debug ||
+{
+  tmp=
+  trap 'exit_status=$?
+  { test -z "$tmp" || test ! -d "$tmp" || rm -fr "$tmp"; } && exit $exit_status
+' 0
+  trap 'as_fn_exit 1' 1 2 13 15
+}
+# Create a (secure) tmp directory for tmp files.
+
+{
+  tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` &&
+  test -n "$tmp" && test -d "$tmp"
+}  ||
+{
+  tmp=./conf$$-$RANDOM
+  (umask 077 && mkdir "$tmp")
+} || as_fn_error $? "cannot create a temporary directory in ." "$LINENO" 5
+
+# Set up the scripts for CONFIG_FILES section.
+# No need to generate them if there are no CONFIG_FILES.
+# This happens for instance with `./config.status config.h'.
+if test -n "$CONFIG_FILES"; then
+
+
+ac_cr=`echo X | tr X '\015'`
+# On cygwin, bash can eat \r inside `` if the user requested igncr.
+# But we know of no other shell where ac_cr would be empty at this
+# point, so we can use a bashism as a fallback.
+if test "x$ac_cr" = x; then
+  eval ac_cr=\$\'\\r\'
+fi
+ac_cs_awk_cr=`$AWK 'BEGIN { print "a\rb" }' </dev/null 2>/dev/null`
+if test "$ac_cs_awk_cr" = "a${ac_cr}b"; then
+  ac_cs_awk_cr='\\r'
+else
+  ac_cs_awk_cr=$ac_cr
+fi
+
+echo 'BEGIN {' >"$tmp/subs1.awk" &&
+_ACEOF
+
+
+{
+  echo "cat >conf$$subs.awk <<_ACEOF" &&
+  echo "$ac_subst_vars" | sed 's/.*/&!$&$ac_delim/' &&
+  echo "_ACEOF"
+} >conf$$subs.sh ||
+  as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5
+ac_delim_num=`echo "$ac_subst_vars" | grep -c '^'`
+ac_delim='%!_!# '
+for ac_last_try in false false false false false :; do
+  . ./conf$$subs.sh ||
+    as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5
+
+  ac_delim_n=`sed -n "s/.*$ac_delim\$/X/p" conf$$subs.awk | grep -c X`
+  if test $ac_delim_n = $ac_delim_num; then
+    break
+  elif $ac_last_try; then
+    as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5
+  else
+    ac_delim="$ac_delim!$ac_delim _$ac_delim!! "
+  fi
+done
+rm -f conf$$subs.sh
+
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+cat >>"\$tmp/subs1.awk" <<\\_ACAWK &&
+_ACEOF
+sed -n '
+h
+s/^/S["/; s/!.*/"]=/
+p
+g
+s/^[^!]*!//
+:repl
+t repl
+s/'"$ac_delim"'$//
+t delim
+:nl
+h
+s/\(.\{148\}\)..*/\1/
+t more1
+s/["\\]/\\&/g; s/^/"/; s/$/\\n"\\/
+p
+n
+b repl
+:more1
+s/["\\]/\\&/g; s/^/"/; s/$/"\\/
+p
+g
+s/.\{148\}//
+t nl
+:delim
+h
+s/\(.\{148\}\)..*/\1/
+t more2
+s/["\\]/\\&/g; s/^/"/; s/$/"/
+p
+b
+:more2
+s/["\\]/\\&/g; s/^/"/; s/$/"\\/
+p
+g
+s/.\{148\}//
+t delim
+' <conf$$subs.awk | sed '
+/^[^""]/{
+  N
+  s/\n//
+}
+' >>$CONFIG_STATUS || ac_write_fail=1
+rm -f conf$$subs.awk
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+_ACAWK
+cat >>"\$tmp/subs1.awk" <<_ACAWK &&
+  for (key in S) S_is_set[key] = 1
+  FS = ""
+
+}
+{
+  line = $ 0
+  nfields = split(line, field, "@")
+  substed = 0
+  len = length(field[1])
+  for (i = 2; i < nfields; i++) {
+    key = field[i]
+    keylen = length(key)
+    if (S_is_set[key]) {
+      value = S[key]
+      line = substr(line, 1, len) "" value "" substr(line, len + keylen + 3)
+      len += length(value) + length(field[++i])
+      substed = 1
+    } else
+      len += 1 + keylen
+  }
+
+  print line
+}
+
+_ACAWK
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+if sed "s/$ac_cr//" < /dev/null > /dev/null 2>&1; then
+  sed "s/$ac_cr\$//; s/$ac_cr/$ac_cs_awk_cr/g"
+else
+  cat
+fi < "$tmp/subs1.awk" > "$tmp/subs.awk" \
+  || as_fn_error $? "could not setup config files machinery" "$LINENO" 5
+_ACEOF
+
+# VPATH may cause trouble with some makes, so we remove sole $(srcdir),
+# ${srcdir} and @srcdir@ entries from VPATH if srcdir is ".", strip leading and
+# trailing colons and then remove the whole line if VPATH becomes empty
+# (actually we leave an empty line to preserve line numbers).
+if test "x$srcdir" = x.; then
+  ac_vpsub='/^[	 ]*VPATH[	 ]*=[	 ]*/{
+h
+s///
+s/^/:/
+s/[	 ]*$/:/
+s/:\$(srcdir):/:/g
+s/:\${srcdir}:/:/g
+s/:@srcdir@:/:/g
+s/^:*//
+s/:*$//
+x
+s/\(=[	 ]*\).*/\1/
+G
+s/\n//
+s/^[^=]*=[	 ]*$//
+}'
+fi
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+fi # test -n "$CONFIG_FILES"
+
+
+eval set X "  :F $CONFIG_FILES      "
+shift
+for ac_tag
+do
+  case $ac_tag in
+  :[FHLC]) ac_mode=$ac_tag; continue;;
+  esac
+  case $ac_mode$ac_tag in
+  :[FHL]*:*);;
+  :L* | :C*:*) as_fn_error $? "invalid tag \`$ac_tag'" "$LINENO" 5 ;;
+  :[FH]-) ac_tag=-:-;;
+  :[FH]*) ac_tag=$ac_tag:$ac_tag.in;;
+  esac
+  ac_save_IFS=$IFS
+  IFS=:
+  set x $ac_tag
+  IFS=$ac_save_IFS
+  shift
+  ac_file=$1
+  shift
+
+  case $ac_mode in
+  :L) ac_source=$1;;
+  :[FH])
+    ac_file_inputs=
+    for ac_f
+    do
+      case $ac_f in
+      -) ac_f="$tmp/stdin";;
+      *) # Look for the file first in the build tree, then in the source tree
+	 # (if the path is not absolute).  The absolute path cannot be DOS-style,
+	 # because $ac_f cannot contain `:'.
+	 test -f "$ac_f" ||
+	   case $ac_f in
+	   [\\/$]*) false;;
+	   *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";;
+	   esac ||
+	   as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5 ;;
+      esac
+      case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac
+      as_fn_append ac_file_inputs " '$ac_f'"
+    done
+
+    # Let's still pretend it is `configure' which instantiates (i.e., don't
+    # use $as_me), people would be surprised to read:
+    #    /* config.h.  Generated by config.status.  */
+    configure_input='Generated from '`
+	  $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g'
+	`' by configure.'
+    if test x"$ac_file" != x-; then
+      configure_input="$ac_file.  $configure_input"
+      { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5
+$as_echo "$as_me: creating $ac_file" >&6;}
+    fi
+    # Neutralize special characters interpreted by sed in replacement strings.
+    case $configure_input in #(
+    *\&* | *\|* | *\\* )
+       ac_sed_conf_input=`$as_echo "$configure_input" |
+       sed 's/[\\\\&|]/\\\\&/g'`;; #(
+    *) ac_sed_conf_input=$configure_input;;
+    esac
+
+    case $ac_tag in
+    *:-:* | *:-) cat >"$tmp/stdin" \
+      || as_fn_error $? "could not create $ac_file" "$LINENO" 5  ;;
+    esac
+    ;;
+  esac
+
+  ac_dir=`$as_dirname -- "$ac_file" ||
+$as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$ac_file" : 'X\(//\)[^/]' \| \
+	 X"$ac_file" : 'X\(//\)$' \| \
+	 X"$ac_file" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$ac_file" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)[^/].*/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\/\)$/{
+	    s//\1/
+	    q
+	  }
+	  /^X\(\/\).*/{
+	    s//\1/
+	    q
+	  }
+	  s/.*/./; q'`
+  as_dir="$ac_dir"; as_fn_mkdir_p
+  ac_builddir=.
+
+case "$ac_dir" in
+.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
+*)
+  ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'`
+  # A ".." for each directory in $ac_dir_suffix.
+  ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
+  case $ac_top_builddir_sub in
+  "") ac_top_builddir_sub=. ac_top_build_prefix= ;;
+  *)  ac_top_build_prefix=$ac_top_builddir_sub/ ;;
+  esac ;;
+esac
+ac_abs_top_builddir=$ac_pwd
+ac_abs_builddir=$ac_pwd$ac_dir_suffix
+# for backward compatibility:
+ac_top_builddir=$ac_top_build_prefix
+
+case $srcdir in
+  .)  # We are building in place.
+    ac_srcdir=.
+    ac_top_srcdir=$ac_top_builddir_sub
+    ac_abs_top_srcdir=$ac_pwd ;;
+  [\\/]* | ?:[\\/]* )  # Absolute name.
+    ac_srcdir=$srcdir$ac_dir_suffix;
+    ac_top_srcdir=$srcdir
+    ac_abs_top_srcdir=$srcdir ;;
+  *) # Relative name.
+    ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix
+    ac_top_srcdir=$ac_top_build_prefix$srcdir
+    ac_abs_top_srcdir=$ac_pwd/$srcdir ;;
+esac
+ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
+
+
+  case $ac_mode in
+  :F)
+  #
+  # CONFIG_FILE
+  #
+
+  case $INSTALL in
+  [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;;
+  *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;;
+  esac
+  ac_MKDIR_P=$MKDIR_P
+  case $MKDIR_P in
+  [\\/$]* | ?:[\\/]* ) ;;
+  */*) ac_MKDIR_P=$ac_top_build_prefix$MKDIR_P ;;
+  esac
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+# If the template does not know about datarootdir, expand it.
+# FIXME: This hack should be removed a few years after 2.60.
+ac_datarootdir_hack=; ac_datarootdir_seen=
+ac_sed_dataroot='
+/datarootdir/ {
+  p
+  q
+}
+/@datadir@/p
+/@docdir@/p
+/@infodir@/p
+/@localedir@/p
+/@mandir@/p'
+case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in
+*datarootdir*) ac_datarootdir_seen=yes;;
+*@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*)
+  { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5
+$as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;}
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+  ac_datarootdir_hack='
+  s&@datadir@&$datadir&g
+  s&@docdir@&$docdir&g
+  s&@infodir@&$infodir&g
+  s&@localedir@&$localedir&g
+  s&@mandir@&$mandir&g
+  s&\\\${datarootdir}&$datarootdir&g' ;;
+esac
+_ACEOF
+
+# Neutralize VPATH when `$srcdir' = `.'.
+# Shell code in configure.ac might set extrasub.
+# FIXME: do we really want to maintain this feature?
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+ac_sed_extra="$ac_vpsub
+$extrasub
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+:t
+/@[a-zA-Z_][a-zA-Z_0-9]*@/!b
+s|@configure_input@|$ac_sed_conf_input|;t t
+s&@top_builddir@&$ac_top_builddir_sub&;t t
+s&@top_build_prefix@&$ac_top_build_prefix&;t t
+s&@srcdir@&$ac_srcdir&;t t
+s&@abs_srcdir@&$ac_abs_srcdir&;t t
+s&@top_srcdir@&$ac_top_srcdir&;t t
+s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t
+s&@builddir@&$ac_builddir&;t t
+s&@abs_builddir@&$ac_abs_builddir&;t t
+s&@abs_top_builddir@&$ac_abs_top_builddir&;t t
+s&@INSTALL@&$ac_INSTALL&;t t
+s&@MKDIR_P@&$ac_MKDIR_P&;t t
+$ac_datarootdir_hack
+"
+eval sed \"\$ac_sed_extra\" "$ac_file_inputs" | $AWK -f "$tmp/subs.awk" >$tmp/out \
+  || as_fn_error $? "could not create $ac_file" "$LINENO" 5
+
+test -z "$ac_datarootdir_hack$ac_datarootdir_seen" &&
+  { ac_out=`sed -n '/\${datarootdir}/p' "$tmp/out"`; test -n "$ac_out"; } &&
+  { ac_out=`sed -n '/^[	 ]*datarootdir[	 ]*:*=/p' "$tmp/out"`; test -z "$ac_out"; } &&
+  { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+which seems to be undefined.  Please make sure it is defined" >&5
+$as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+which seems to be undefined.  Please make sure it is defined" >&2;}
+
+  rm -f "$tmp/stdin"
+  case $ac_file in
+  -) cat "$tmp/out" && rm -f "$tmp/out";;
+  *) rm -f "$ac_file" && mv "$tmp/out" "$ac_file";;
+  esac \
+  || as_fn_error $? "could not create $ac_file" "$LINENO" 5
+ ;;
+
+
+
+  esac
+
+done # for ac_tag
+
+
+as_fn_exit 0
+_ACEOF
+ac_clean_files=$ac_clean_files_save
+
+test $ac_write_fail = 0 ||
+  as_fn_error $? "write failure creating $CONFIG_STATUS" "$LINENO" 5
+
+
+# configure is writing to config.log, and then calls config.status.
+# config.status does its own redirection, appending to config.log.
+# Unfortunately, on DOS this fails, as config.log is still kept open
+# by configure, so config.status won't be able to write to it; its
+# output is simply discarded.  So we exec the FD to /dev/null,
+# effectively closing config.log, so it can be properly (re)opened and
+# appended to by config.status.  When coming back to configure, we
+# need to make the FD available again.
+if test "$no_create" != yes; then
+  ac_cs_success=:
+  ac_config_status_args=
+  test "$silent" = yes &&
+    ac_config_status_args="$ac_config_status_args --quiet"
+  exec 5>/dev/null
+  $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false
+  exec 5>>config.log
+  # Use ||, not &&, to avoid exiting from the if with $? = 1, which
+  # would make configure fail if this is the last instruction.
+  $ac_cs_success || as_fn_exit 1
+fi
+if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then
+  { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5
+$as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;}
+fi
+


Property changes on: trunk/packages/norsnet/trunk/debian/configure
___________________________________________________________________
Added: svn:executable
   + *

Added: trunk/packages/norsnet/trunk/debian/configure.ac
===================================================================
--- trunk/packages/norsnet/trunk/debian/configure.ac	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/configure.ac	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,6 @@
+AC_INIT([norsnet], [1.0.12], [https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsnet])
+AC_CONFIG_SRCDIR([scr/createDataFile.pl])
+AM_INIT_AUTOMAKE
+AC_CONFIG_FILES([Makefile scr/Makefile example/Makefile])
+
+AC_OUTPUT

Added: trunk/packages/norsnet/trunk/debian/example/Makefile.am
===================================================================
--- trunk/packages/norsnet/trunk/debian/example/Makefile.am	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/example/Makefile.am	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,2 @@
+exampledir = $(pkgdatadir)/example
+dist_example_DATA = $(srcdir)/cad23*

Added: trunk/packages/norsnet/trunk/debian/example/Makefile.in
===================================================================
--- trunk/packages/norsnet/trunk/debian/example/Makefile.in	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/example/Makefile.in	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,350 @@
+# Makefile.in generated by automake 1.11.1 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004, 2005, 2006, 2007, 2008, 2009  Free Software Foundation,
+# Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkglibexecdir = $(libexecdir)/@PACKAGE@
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+subdir = example
+DIST_COMMON = $(dist_example_DATA) $(srcdir)/Makefile.am \
+	$(srcdir)/Makefile.in
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/configure.ac
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+mkinstalldirs = $(install_sh) -d
+CONFIG_CLEAN_FILES =
+CONFIG_CLEAN_VPATH_FILES =
+SOURCES =
+DIST_SOURCES =
+am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`;
+am__vpath_adj = case $$p in \
+    $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \
+    *) f=$$p;; \
+  esac;
+am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`;
+am__install_max = 40
+am__nobase_strip_setup = \
+  srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'`
+am__nobase_strip = \
+  for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||"
+am__nobase_list = $(am__nobase_strip_setup); \
+  for p in $$list; do echo "$$p $$p"; done | \
+  sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \
+  $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \
+    if (++n[$$2] == $(am__install_max)) \
+      { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \
+    END { for (dir in files) print dir, files[dir] }'
+am__base_list = \
+  sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \
+  sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g'
+am__installdirs = "$(DESTDIR)$(exampledir)"
+DATA = $(dist_example_DATA)
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+ACLOCAL = @ACLOCAL@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+INSTALL = @INSTALL@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+MKDIR_P = @MKDIR_P@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_URL = @PACKAGE_URL@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+VERSION = @VERSION@
+abs_builddir = @abs_builddir@
+abs_srcdir = @abs_srcdir@
+abs_top_builddir = @abs_top_builddir@
+abs_top_srcdir = @abs_top_srcdir@
+am__leading_dot = @am__leading_dot@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build_alias = @build_alias@
+builddir = @builddir@
+datadir = @datadir@
+datarootdir = @datarootdir@
+docdir = @docdir@
+dvidir = @dvidir@
+exec_prefix = @exec_prefix@
+host_alias = @host_alias@
+htmldir = @htmldir@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localedir = @localedir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+pdfdir = @pdfdir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+psdir = @psdir@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+srcdir = @srcdir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+top_build_prefix = @top_build_prefix@
+top_builddir = @top_builddir@
+top_srcdir = @top_srcdir@
+exampledir = $(pkgdatadir)/example
+dist_example_DATA = $(srcdir)/cad23*
+all: all-am
+
+.SUFFIXES:
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \
+	        && { if test -f $@; then exit 0; else break; fi; }; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu example/Makefile'; \
+	$(am__cd) $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu example/Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(am__aclocal_m4_deps):
+install-dist_exampleDATA: $(dist_example_DATA)
+	@$(NORMAL_INSTALL)
+	test -z "$(exampledir)" || $(MKDIR_P) "$(DESTDIR)$(exampledir)"
+	@list='$(dist_example_DATA)'; test -n "$(exampledir)" || list=; \
+	for p in $$list; do \
+	  if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \
+	  echo "$$d$$p"; \
+	done | $(am__base_list) | \
+	while read files; do \
+	  echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(exampledir)'"; \
+	  $(INSTALL_DATA) $$files "$(DESTDIR)$(exampledir)" || exit $$?; \
+	done
+
+uninstall-dist_exampleDATA:
+	@$(NORMAL_UNINSTALL)
+	@list='$(dist_example_DATA)'; test -n "$(exampledir)" || list=; \
+	files=`for p in $$list; do echo $$p; done | sed -e 's|^.*/||'`; \
+	test -n "$$files" || exit 0; \
+	echo " ( cd '$(DESTDIR)$(exampledir)' && rm -f" $$files ")"; \
+	cd "$(DESTDIR)$(exampledir)" && rm -f $$files
+tags: TAGS
+TAGS:
+
+ctags: CTAGS
+CTAGS:
+
+
+distdir: $(DISTFILES)
+	@srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+	list='$(DISTFILES)'; \
+	  dist_files=`for file in $$list; do echo $$file; done | \
+	  sed -e "s|^$$srcdirstrip/||;t" \
+	      -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \
+	case $$dist_files in \
+	  */*) $(MKDIR_P) `echo "$$dist_files" | \
+			   sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \
+			   sort -u` ;; \
+	esac; \
+	for file in $$dist_files; do \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  if test -d $$d/$$file; then \
+	    dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \
+	    if test -d "$(distdir)/$$file"; then \
+	      find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+	    fi; \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \
+	      find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+	    fi; \
+	    cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \
+	  else \
+	    test -f "$(distdir)/$$file" \
+	    || cp -p $$d/$$file "$(distdir)/$$file" \
+	    || exit 1; \
+	  fi; \
+	done
+check-am: all-am
+check: check-am
+all-am: Makefile $(DATA)
+installdirs:
+	for dir in "$(DESTDIR)$(exampledir)"; do \
+	  test -z "$$dir" || $(MKDIR_P) "$$dir"; \
+	done
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+	-test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-am
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+html-am:
+
+info: info-am
+
+info-am:
+
+install-data-am: install-dist_exampleDATA
+
+install-dvi: install-dvi-am
+
+install-dvi-am:
+
+install-exec-am:
+
+install-html: install-html-am
+
+install-html-am:
+
+install-info: install-info-am
+
+install-info-am:
+
+install-man:
+
+install-pdf: install-pdf-am
+
+install-pdf-am:
+
+install-ps: install-ps-am
+
+install-ps-am:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-dist_exampleDATA
+
+.MAKE: install-am install-strip
+
+.PHONY: all all-am check check-am clean clean-generic distclean \
+	distclean-generic distdir dvi dvi-am html html-am info info-am \
+	install install-am install-data install-data-am \
+	install-dist_exampleDATA install-dvi install-dvi-am \
+	install-exec install-exec-am install-html install-html-am \
+	install-info install-info-am install-man install-pdf \
+	install-pdf-am install-ps install-ps-am install-strip \
+	installcheck installcheck-am installdirs maintainer-clean \
+	maintainer-clean-generic mostlyclean mostlyclean-generic pdf \
+	pdf-am ps ps-am uninstall uninstall-am \
+	uninstall-dist_exampleDATA
+
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:

Added: trunk/packages/norsnet/trunk/debian/example/cad23-fil.hssp
===================================================================
--- trunk/packages/norsnet/trunk/debian/example/cad23-fil.hssp	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/example/cad23-fil.hssp	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,742 @@
+HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 1.0 1991
+PDBID      query
+DATE       file generated on 24-Oct-07
+SEQBASE    COPF-tmp25694.msf_tmp
+PARAMETER  CONVERTSEQ of query
+THRESHOLD  according to: ALL
+REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
+CONTACT    e-mail (INTERNET) Schneider at EMBL-Heidelberg.DE or Sander at EMBL-Heidelberg.DE / fax +49-6221-387306
+AVAILABLE  Free academic use. Commercial users must apply for license.
+AVAILABLE  No inclusion in other databanks without permission.
+HEADER     
+COMPND     
+SOURCE     
+AUTHOR     
+SEQLENGTH   337
+NCHAIN        1 chain(s) in query data set
+NALIGN       17
+NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
+NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
+NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
+NOTATION : %IDE: percentage of residue identity of the alignment
+NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
+NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
+NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
+NOTATION : LALI: length of the alignment excluding insertions and deletions
+NOTATION : NGAP: number of insertions and deletions in the alignment
+NOTATION : LGAP: total length of all insertions and deletions
+NOTATION : LSEQ2: length of the entire sequence of the aligned protein
+NOTATION : ACCESSION: SwissProt accession number
+NOTATION : PROTEIN: one-line description of aligned protein
+NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
+NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
+NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
+NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of INSERTION IN THIS sequence
+NOTATION : dots (....) in the alignend SEQUENCE INDICATE POINTS of deletion in this sequence
+NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
+NOTATION : acid/amide form in proportion to their database frequencies
+NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
+NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
+NOTATION : NINS: number of sequences with an insertion in the test protein at this position
+NOTATION : ENTROPY: entropy measure of sequence variability at this position
+NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
+NOTATION : WEIGHT: conservation weight
+
+## PROTEINS : EMBL/SWISSPROT identifier and alignment statistics
+  NR.    ID         STRID   %IDE  %SIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCESSION     PROTEIN
+    1 : Q5DUA3_MOUSE        1.00  0.00   27  337    1  311  311    0    0  311
+    2 : Q6QQE1_DANRE        0.75  0.00   27  337    1  311  311    0    0  311
+    3 : Q174A5_AEDAE        0.32  0.00   28  140    1  106  113    2    7  106
+    4 : Q7PUW9_ANOGA        0.39  0.00   28  116    1   88   89    1    1   88
+    5 : Q299U1_DROPS        0.29  0.00   27  143    1  117  117    0    0  117
+    6 : A7RSN1_9CNID        0.43  0.00   78  134    1   51   57    2    6   51
+    7 : Q86DU3_PECGO        0.35  0.00   46  115    1   69   70    1    1   69
+    8 : Q95WK9_LYMDI        0.26  0.00   44  149    1  100  106    2    6  100
+    9 : Q7QCW0_ANOGA        0.35  0.00   32  114    1   82   83    1    1   82
+   10 : Q9GPJ9_MANSE        0.27  0.00   50  149    1   99  100    1    1   99
+   11 : Q5GI53_PLUXY        0.30  0.00   71  145    1   70   75    1    5   70
+   12 : A4SSW0_AERS4        0.28  0.00    2  147    1  131  146    3   15  131
+   13 : A4IPV5_GEOTN        0.33  0.00  148  246    1   85   99    2   14   85
+   14 : Q9YCU3_AERPE        0.26  0.00  174  270    1   96   97    1    1   96
+   15 : Q3UN77_MOUSE        0.32  0.00   31  134    1  103  104    1    1  103
+   16 : Q3UHT9_MOUSE        0.26  0.00  120  315    1  185  196    4   11  185
+   17 : A6NC80_HUMAN        0.27  0.00   17  146    1  128  130    2    2  128
+## ALIGNMENTS    1 -   17
+ SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
+     1    1   D              0   0    0    1    0
+     2    2   Y              0   0    0    2    4             F
+     3    3   K              0   0    0    2   41             N
+     4    4   D              0   0    0    2   56             R
+     5    5   H              0   0    0    2   41             E
+     6    6   D              0   0    0    2    0             D
+     7    7   G              0   0    0    2    0             G
+     8    8   D              0   0    0    2   63             I
+     9    9   Y              0   0    0    2    4             F
+    10   10   K              0   0    0    2   67             L
+    11   11   D              0   0    0    2    0             D
+    12   12   H              0   0    0    2   52             K
+    13   13   D              0   0    0    2    0             D
+    14   14   I              0   0    0    2   59             S
+    15   15   D              0   0    0    2   30             Q
+    16   16   Y              0   0    0    2   44             L
+    17   17   K              0   0    0    3   61             F    R
+    18   18   D              0   0    0    3   54             V    N
+    19   19   D              0   0    0    3   30             A    D
+    20   20   D              0   0    0    3   61             Y    Q
+    21   21   D              0   0    0    3   33             S    D
+    22   22   K              0   0    0    3   33             K    S
+    23   23   L              0   0    0    3    0             L    L
+    24   24   A              0   0    0    3   41             P    T
+    25   25   A              0   0    0    3   40             E    Q
+    26   26   A              0   0    0    3   66             R    L
+    27   27   N              0   0    0    6   34  NN  D      N    L
+    28   28   S              0   0    0    8   35  YYFFL      W    Q
+    29   29   N              0   0    0    8   28  NNNNN      V    L
+    30   30   V              0   0    0    8   21  VIVVV      L    G
+    31   31   L              0   0    0    9    6  LLLLL      I  L L
+    32   32   D              0   0    0   10   29  DDDDD   D  S  V V
+    33   33   V              0   0    0   10   24  VVTTT   V  V  V V
+    34   34   Q              0   0    0   10   27  QQQQQ   P  Q  V L
+    35   35   P              0   0    0   10   25  PPAAP   P  P  S G
+    36   36   A              0   0    0   10   30  AASSA   L  A  S S
+    37   37   I              0   0    0   10   44  IVEEE   A  A  Q Q
+    38   38   S              0   0    0   10   44  STALA   T  S  E E
+    39   39   V              0   0    0   10   46  VASVQ   E  V  S S
+    40   40   Q              0   0    0   10   41  QRFQL   A  Q  Q Q
+    41   41   L              0   0    0    9   44  LAFTL   L  A  E .
+    42   42   P              0   0    0   10   40  PPVAT   T  V  P E
+    43   43   D              0   0    0    9   38  DDA.A   E  V  D S
+    44   44   D              0   0    0   11   22  DDEEG  DA  D  Q D
+    45   45   M              0   0    0   11   42  MLLMP  ID  R  Q L
+    46   46   S              0   0    0   12   40  STSDT ASE  V  K S
+    47   47   A              0   0    0   12   44  ATGEK GTT  S  L K
+    48   48   L              0   0    0   12   39  LLALG VDL  L  L Q
+    49   49   Q              0   0    0   12   42  QQPSP QSQ  N  T L
+    50   50   M              0   0    0   13   29  MMMVL IAIL V  S I
+    51   51   A              0   0    0   13   50  AALNF TQIT L  V S
+    52   52   I              0   0    0   13   11  IIIIV IILV L  I V
+    53   53   I              0   0    0   13   35  IIWIW YIIY M  I I
+    54   54   V              0   0    0   13   29  VILWL VVVV V  G I
+    55   55   L              0   0    0   13   28  LLFLV LYVL A  L G
+    56   56   A              0   0    0   12   40  AAVFF AVAA .  V L
+    57   57   I              0   0    0   12   39  IVSVT ILAS .  V G
+    58   58   L              0   0    0   12   44  LLNNN LTLL .  S V
+    59   59   L              0   0    0   12   36  LLLIL AVAA .  L A
+    60   60   F              0   0    0   12   25  FFFLF FAVV .  V L
+    61   61   L              0   0    0   13    5  LLILM LLLL L  L L
+    62   62   A              0   0    0   13   35  AAGGA CGCG A  V L
+    63   63   A              0   0    0   13   46  AAAAT LFVF C  L V
+    64   64   M              0   0    0   13   16  MMLLL ILIM V  V L
+    65   65   L              0   0    0   13   27  LLLLL LCLC L  I V
+    66   66   F              0   0    0   13   22  FFIIV LIFL Y  L I
+    67   67   V              0   0    0   13   10  VIVVV IVVV V  I M
+    68   68   L              0   0    0   13   35  LLVVI TLAL M  T T
+    69   69   M              0   0    0   13   16  MMLLL FLFL L  A M
+    70   70   N              0   0    0   13   51  NNGSA ICFI A  L A
+    71   71   W              0   0    0   14   37  WWLIL VIIIWL  V F
+    72   72   Y              0   0    0   14   52  YYSSS RIKRFV  C V
+    73   73   Y              0   0    0   14   55  YYQQQ TRITRW  L V
+    74   74   R              0   0    0   14   32  RRRRR RTRRTS  R R
+    75   75   T              0   0    0   13   48  TTALN AR.ARR  K K
+    76   76   I              0   0    0   14   52  IVSSG LMSLAY  S S
+    77   77   H              0   0    0   14   37  HHYYY NLLNLF  Y Y
+    78   78   K              0   0    0   15   27  KKRRRKRNNRNR  H N
+    79   79   R              0   0    0   15    0  RRRRRRRRRRRR  R R
+    80   80   K              0   0    0   13   38  KKQQQK.RQ.RM  K K
+    81   81   L              0   0    0   15    0  LLLLLLLLLLLL  L L
+    82   82   K              0   0    0   15   39  KKRRRREEKEEN  R Q
+    83   83   A              0   0    0   15   16  AAAAAAAAAAAE  A A
+    84   84   I              0   0    0   15   34  IVAAAALLLLLI  M M
+    85   85   V              0   0    0   15   37  VVRAKTSSSSSS  K K
+    86   86   A              0   0    0   15   46  AAVFVAMMAMTS  A A
+    87   87   G              0   0    0   15   42  GGAGNATTTTTM  G A
+    88   88   S              0   0    0   15   47  SSNSISKRDKKI  K K
+    89   89   A              0   0    0   15   51  ATYTFYYYFYFR  E E
+    90   90   G              0   0    0   15   22  GGAGRGGGGGGA  A A
+    91   91   N              0   0    0   15   29  NNASAASSSSSS  R R
+    92   92   R              0   0    0   15   39  RQRRHSSSISSR  K K
+    93   93   G              0   0    0   15   30  GGGMSTGGSGGT  T T
+    94   94   F              0   0    0   15   49  FLVYSTLLSLLQ  P A
+    95   95   I              0   0    0   15   51  IMMQLQNNKNNP  I A
+    96   96   D              0   0    0   15   42  DDNESTRRPRRD  E G
+    97   97   I              0   0    0   13   28  II.VLVVATAV.  T V
+    98   98   M              0   0    0   13   40  ML.LQNIIRII.  T M
+    99   99   D              0   0    0   15   36  DDSGHSAANASD  A A
+   100  100   M              0   0    0   15   27  MMVVVMAAVAVV  I I
+   101  101   P              0   0    0   15    0  PPPPPPPPPPPP  P P
+   102  102   N              0   0    0   15   37  NNNNNTGGTGGQ  G G
+   103  103   T              0   0    0   15   15  TTTTTTTTTTTG  T T
+   104  104   N              0   0    0   15   15  NNNNNNNNNNNG  N N
+   105  105   K              0   0    0   15   28  KKKKKLKKIKKM  M M
+   106  106   Y              0   0    0   15   31  YYHHHHHHFHHQ  Y Y
+   107  107   S              0   0    0   15   42  STSSSVAASTAE  N N
+   108  108   F              0   0    0   14   32  FFVMVAIVIVV.  T T
+   109  109   D              0   0    0   14   15  DEEKQEEEEEE.  D E
+   110  110   G              0   0    0   14   12  GGGGGGGGGGG.  R R
+   111  111   A              0   0    0   14   17  AASSSSSSSSS.  A A
+   112  112   N              0   0    0   14    0  NNNNNNNNNNN.  N N
+   113  113   P              0   0    0   14    0  PPPPPPPPPPP.  P P
+   114  114   V              0   0    0   14    9  VVIIIIIIVII.  V M
+   115  115   W              0   0    0   12    2  WWWWWWWW FW.  . Y
+   116  116   L              0   0    0   11   27  LLMILV . N.L  L L
+   117  117   D              0   0    0   10   30  DDK KD . E.K  D S
+   118  118   P              0   0    0   10   40  PPA GP . A.H  L P
+   119  119   F              0   0    0    9   38  FFY YY . I.V  P .
+   120  120   C              0   0    0   10   50  CCE E. . K.Y  TCS
+   121  121   R              0   0    0   13   39  RRN NH N TNA  KTN
+   122  122   N              0   0    0   13   22  NNE EN E DEE  DGD
+   123  123   L              0   0    0   13   45  LLW WW T LQL  LEL
+   124  124   E              0   0    0   12   44  EE. EG I DIA  GSD
+   125  125   L              0   0    0   12   54  LL. EL K ARE  LGS
+   126  126   A              0   0    0   11   26  AA. T. A IAA  EAV
+   127  127   A              0   0    0   11   33  AA. A. P SPG  CGS
+   128  128   Q              0   0    0   11   37  QQ. S. D EDK  HKV
+   129  129   A              0   0    0   12   53  AAF V. F GFD  STN
+   130  130   E              0   0    0   12   40  EEK G. D SDY  SES
+   131  131   H              0   0    0   13   43  HHN GN A NSH  SNL
+   132  132   E              0   0    0   13   27  EED QT L DEE  DTD
+   133  133   D              0   0    0   13   28  DDD DD S SDA  LKD
+   134  134   D              0   0    0   13   33  DDD SD D DSR  DKD
+   135  135   L              0   0    0   11   45  LLL L  V LDQ   VV
+   136  136   P              0   0    0   11   49  PPT D  S INQ   ID
+   137  137   E              0   0    0   10   37  EEK D  . ESA   QK
+   138  138   N              0   0    0   11   22  NDN N  N DDN   YN
+   139  139   L              0   0    0   11   22  LLI F  E LLL   LS
+   140  140   S              0   0    0   11   48  SSS L  S PID   AQ
+   141  141   E              0   0    0   10   40  ED  A  D HGK   HE
+   142  142   I              0   0    0   10   17  II  V  L FIL   VI
+   143  143   A              0   0    0   10   38  AA  A  I GET   AK
+   144  144   D              0   0    0    9   25  DD     G NDG   SA
+   145  145   L              0   0    0    9   26  LL     I VLL   SR
+   146  146   W              0   0    0    8   31  WW     E F Y   HW
+   147  147   N              0   0    0    7   33  NN     D M N   K
+   148  148   S              0   0    0    7   31  SS     M D  S  S
+   149  149   P              0   0    0    6    0  PP     P P  P  .
+   150  150   T              0   0    0    5   46  TA          E  K
+   151  151   R              0   0    0    5    8  RR          R  K
+   152  152   T              0   0    0    4   28  TT          .  D
+   153  153   H              0   0    0    4   17  HH          .  Q
+   154  154   G              0   0    0    4    0  GG          .  G
+   155  155   T              0   0    0    4   28  TT          .  E
+   156  156   F              0   0    0    5    9  FF          Y  L
+   157  157   G              0   0    0    5   28  GG          E  E
+   158  158   R              0   0    0    5   14  RR          K  R
+   159  159   E              0   0    0    5   19  EE          D  Q
+   160  160   P              0   0    0    5   25  PP          P  L
+   161  161   A              0   0    0    5   53  AQ          K  L
+   162  162   A              0   0    0    5   45  AA          L  Q
+   163  163   V              0   0    0    5   40  VT          A  A
+   164  164   K              0   0    0    5   15  KK          K  N
+   165  165   P              0   0    0    5   28  PP          K  P
+   166  166   D              0   0    0    5   31  DE          D  I
+   167  167   D              0   0    0    5   51  DD          L  L
+   168  168   D              0   0    0    5   29  DD          K  E
+   169  169   R              0   0    0    5   44  RR          S  A
+   170  170   Y              0   0    0    5    3  YY          F  F
+   171  171   L              0   0    0    5   38  LL          I  G
+   172  172   R              0   0    0    5   19  RR          R  N
+   173  173   A              0   0    0    5   22  AA          S  A
+   174  174   A              0   0    0    6   21  AA          AA K
+   175  175   I              0   0    0    6   31  II          VA T
+   176  176   Q              0   0    0    6   44  QQ          KG V
+   177  177   E              0   0    0    6   24  EE          ER K
+   178  178   Y              0   0    0    6   24  YY          YF N
+   179  179   D              0   0    0    5    0  DD          .D D
+   180  180   N              0   0    0    5   14  NN          .E N
+   181  181   I              0   0    0    5   35  II          .V S
+   182  182   A              0   0    0    5   39  AA          .L S
+   183  183   K              0   0    0    5   32  KK          .A R
+   184  184   L              0   0    0    5    6  LL          .L F
+   185  185   G              0   0    0    5    0  GG          .G G
+   186  186   Q              0   0    0    5   28  QQ          .D K
+   187  187   I              0   0    0    5   18  II          .L F
+   188  188   I              0   0    0    5   21  IM          .V I
+   189  189   R              0   0    0    6   38  RR          FD R
+   190  190   E              0   0    0    6   40  EE          QY N
+   191  191   G              0   0    0    6   45  GG          EG F
+   192  192   P              0   0    0    6   34  PP          KP D
+   193  193   I              0   0    0    6   31  II          IW V
+   194  194   K              0   0    0    6   39  KK          TP N
+   195  195   G              0   0    0    6    9  GG          DG G
+   196  196   S              0   0    0    6   44  SS          SE Y
+   197  197   L              0   0    0    6   19  LL          MV I
+   198  198   L              0   0    0    6   33  LL          DI V
+   199  199   K              0   0    0    6   43  KN          AD G
+   200  200   V              0   0    0    6   27  VV          IV A
+   201  201   V              0   0    0    6   45  VV          GL N
+   202  202   L              0   0    0    6   32  LL          LR I
+   203  203   E              0   0    0    6   29  ED          SG E
+   204  204   D              0   0    0    6   40  DD          DL T
+   205  205   Y              0   0    0    6   28  YY          FG Y
+   206  206   L              0   0    0    6   20  LL          LA L
+   207  207   R              0   0    0    5   17  RR          PR .
+   208  208   L              0   0    0    6   29  LL          NI L
+   209  209   K              0   0    0    6   37  KK          KV E
+   210  210   K              0   0    0    6    9  KK          KR K
+   211  211   L              0   0    0    6   45  LL          LG S
+   212  212   F              0   0    0    6   54  FF          VN R
+   213  213   A              0   0    0    6   30  AA          NH A
+   214  214   Q              0   0    0    6   52  QA          MD I
+   215  215   R              0   0    0    6   12  RR          RH R
+   216  216   M              0   0    0    6   47  ML          GA Q
+   217  217   V              0   0    0    6   24  VV          VV A
+   218  218   Q              0   0    0    6   48  QT          NG K
+   219  219   K              0   0    0    6   42  KK          KY E
+   220  220   A              0   0    0    6   41  AS          TG E
+   221  221   S              0   0    0    6   54  ST          EV R
+   222  222   S              0   0    0    6   32  SS          SD T
+   223  223   C              0   0    0    6   59  CQ          LC F
+   224  224   H              0   0    0    6   22  HR          HR H
+   225  225   S              0   0    0    6   11  SS          SG S
+   226  226   S              0   0    0    6   27  SS          SE G
+   227  227   I              0   0    0    6   41  IV          IE A
+   228  228   S              0   0    0    6   42  ST          KT G
+   229  229   E              0   0    0    6   20  EE          QH E
+   230  230   L              0   0    0    6   44  LL          IW H
+   231  231   I              0   0    0    6   14  II          LL L
+   232  232   H              0   0    0    6   42  HQ          KS K
+   233  233   T              0   0    0    6   41  TS          KV T
+   234  234   D              0   0    0    6   37  DD          EW D
+   235  235   L              0   0    0    6   11  LL          IF L
+   236  236   E              0   0    0    6   53  ED          KR L
+   237  237   E              0   0    0    6   33  EE          EE L
+   238  238   E              0   0    0    6   18  ED          EN E
+   239  239   P              0   0    0    6   45  PD          SI P
+   240  240   G              0   0    0    6   55  GE          AT Y
+   241  241   D              0   0    0    6   28  DE          NQ N
+   242  242   H              0   0    0    6   31  HR          KR K
+   243  243   S              0   0    0    5   58  SI          KL .
+   244  244   P              0   0    0    5   51  PG          AL .
+   245  245   G              0   0    0    5   16  GG          TG .
+   246  246   Q              0   0    0    5   38  QR          RD .
+   247  247   G              0   0    0    4    0  GG           G .
+   248  248   S              0   0    0    4   46  ST           D .
+   249  249   L              0   0    0    5   45  LL           R Y
+   250  250   R              0   0    0    5    0  RR           R R
+   251  251   F              0   0    0    5    0  FF           F F
+   252  252   R              0   0    0    5   46  RK           L L
+   253  253   H              0   0    0    5   43  HH           A S
+   254  254   K              0   0    0    5   22  KK           K N
+   255  255   P              0   0    0    5   60  PL           L G
+   256  256   P              0   0    0    5   26  PP           P H
+   257  257   M              0   0    0    5   25  MI           L V
+   258  258   E              0   0    0    5   26  EE           E T
+   259  259   L              0   0    0    5   14  LL           L I
+   260  260   K              0   0    0    5   36  KR           R P
+   261  261   G              0   0    0    4    0  GG           . G
+   262  262   Q              0   0    0    5   41  QP           L Q
+   263  263   D              0   0    0    5   16  DD           D Q
+   264  264   G              0   0    0    5   16  GG           G D
+   265  265   I              0   0    0    5   40  IV           V K
+   266  266   H              0   0    0    5   42  HH           L D
+   267  267   M              0   0    0    5   40  MA           A M
+   268  268   V              0   0    0    5   26  VV           V F
+   269  269   H              0   0    0    5   16  HH           H Q
+   270  270   G              0   0    0    5   20  GG           G E
+   271  271   S              0   0    0    3    0  SS             .
+   272  272   T              0   0    0    3    0  TT             .
+   273  273   G              0   0    0    3    0  GG             .
+   274  274   T              0   0    0    4    0  TT             T
+   275  275   L              0   0    0    4    5  LL             M
+   276  276   L              0   0    0    4   42  LL             E
+   277  277   A              0   0    0    4   26  AT             A
+   278  278   T              0   0    0    4   54  TS             M
+   279  279   D              0   0    0    4   35  DD             R
+   280  280   L              0   0    0    4   16  LL             I
+   281  281   N              0   0    0    4   42  NN             M
+   282  282   S              0   0    0    4   21  SS             G
+   283  283   L              0   0    0    4   16  LL             I
+   284  284   P              0   0    0    4    0  PP             P
+   285  285   E              0   0    0    4    0  EE             E
+   286  286   D              0   0    0    4    0  DD             D
+   287  287   D              0   0    0    4   12  DD             E
+   288  288   Q              0   0    0    4    0  QQ             Q
+   289  289   K              0   0    0    4   40  KR             M
+   290  290   G              0   0    0    4   19  GA             G
+   291  291   L              0   0    0    4    0  LL             L
+   292  292   D              0   0    0    4   59  DA             L
+   293  293   R              0   0    0    4    0  RR             R
+   294  294   S              0   0    0    4   37  SS             V
+   295  295   L              0   0    0    4   16  LL             I
+   296  296   E              0   0    0    4   30  EE             S
+   297  297   T              0   0    0    4   38  TA             G
+   298  298   L              0   0    0    4   16  LL             V
+   299  299   T              0   0    0    4   60  TH             L
+   300  300   A              0   0    0    4   30  AA             Q
+   301  301   S              0   0    0    4   63  SD             L
+   302  302   E              0   0    0    4   27  EG             G
+   303  303   A              0   0    0    4   39  AG             N
+   304  304   T              0   0    0    4   46  TL             I
+   305  305   A              0   0    0    4   42  AY             A
+   306  306   F              0   0    0    4   47  FA             F
+   307  307   E              0   0    0    4   28  EE             K
+   308  308   R              0   0    0    4   16  RR             K
+   309  309   N              0   0    0    4   23  NN             E
+   310  310   A              0   0    0    4   42  AA             R
+   311  311   R              0   0    0    4   33  RR             N
+   312  312   T              0   0    0    4    0  TT             T
+   313  313   E              0   0    0    4   12  EE             D
+   314  314   S              0   0    0    4   37  SS             Q
+   315  315   A              0   0    0    4    0  AA             A
+   316  316   K              0   0    0    3    0  KK
+   317  317   S              0   0    0    3    0  SS
+   318  318   T              0   0    0    3    0  TT
+   319  319   P              0   0    0    3    0  PP
+   320  320   L              0   0    0    3    0  LL
+   321  321   H              0   0    0    3    0  HH
+   322  322   K              0   0    0    3   26  KR
+   323  323   L              0   0    0    3   70  LN
+   324  324   R              0   0    0    3   26  RK
+   325  325   D              0   0    0    3    0  DD
+   326  326   V              0   0    0    3   48  VT
+   327  327   I              0   0    0    3   26  IL
+   328  328   M              0   0    0    3   67  MS
+   329  329   E              0   0    0    3    0  EE
+   330  330   S              0   0    0    3    0  SS
+   331  331   P              0   0    0    3    0  PP
+   332  332   L              0   0    0    3    0  LL
+   333  333   E              0   0    0    3    0  EE
+   334  334   I              0   0    0    3    0  II
+   335  335   T              0   0    0    3    0  TT
+   336  336   E              0   0    0    3    0  EE
+   337  337   L              0   0    0    3    0  LL
+## SEQUENCE PROFILE AND ENTROPY
+ SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
+    1    1     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100     1    0    0   0.000      0  1.00
+    2    2     0   0   0   0  50   0  50   0   0   0   0   0   0   0   0   0   0   0   0   0     2    0    0   0.693    100  1.51
+    3    3     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  50   0   0  50   0     2    0    0   0.693    100  0.80
+    4    4     0   0   0   0   0   0   0   0   0   0   0   0   0   0  50   0   0   0   0  50     2    0    0   0.693    100  0.59
+    5    5     0   0   0   0   0   0   0   0   0   0   0   0   0  50   0   0   0  50   0   0     2    0    0   0.693    100  0.80
+    6    6     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100     2    0    0   0.000      0  1.58
+    7    7     0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0     2    0    0   0.000      0  1.58
+    8    8     0   0  50   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  50     2    0    0   0.693    100  0.59
+    9    9     0   0   0   0  50   0  50   0   0   0   0   0   0   0   0   0   0   0   0   0     2    0    0   0.693    100  1.51
+   10   10     0  50   0   0   0   0   0   0   0   0   0   0   0   0   0  50   0   0   0   0     2    0    0   0.693    100  0.59
+   11   11     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100     2    0    0   0.000      0  1.58
+   12   12     0   0   0   0   0   0   0   0   0   0   0   0   0  50   0  50   0   0   0   0     2    0    0   0.693    100  0.59
+   13   13     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100     2    0    0   0.000      0  1.58
+   14   14     0   0  50   0   0   0   0   0   0   0  50   0   0   0   0   0   0   0   0   0     2    0    0   0.693    100  0.59
+   15   15     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  50   0   0  50     2    0    0   0.693    100  1.01
+   16   16     0  50   0   0   0   0  50   0   0   0   0   0   0   0   0   0   0   0   0   0     2    0    0   0.693    100  0.73
+   17   17     0   0   0   0  33   0   0   0   0   0   0   0   0   0  33  33   0   0   0   0     3    0    0   1.099    100  0.59
+   18   18    33   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  33  33     3    0    0   1.099    100  0.59
+   19   19     0   0   0   0   0   0   0   0  33   0   0   0   0   0   0   0   0   0   0  67     3    0    0   0.637     58  1.00
+   20   20     0   0   0   0   0   0  33   0   0   0   0   0   0   0   0   0  33   0   0  33     3    0    0   1.099    100  0.59
+   21   21     0   0   0   0   0   0   0   0   0   0  33   0   0   0   0   0   0   0   0  67     3    0    0   0.637     58  0.95
+   22   22     0   0   0   0   0   0   0   0   0   0  33   0   0   0   0  67   0   0   0   0     3    0    0   0.637     58  0.94
+   23   23     0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+   24   24     0   0   0   0   0   0   0   0  33  33   0  33   0   0   0   0   0   0   0   0     3    0    0   1.099    100  0.79
+   25   25     0   0   0   0   0   0   0   0  33   0   0   0   0   0   0   0  33  33   0   0     3    0    0   1.099    100  0.81
+   26   26     0  33   0   0   0   0   0   0  33   0   0   0   0   0  33   0   0   0   0   0     3    0    0   1.099    100  0.59
+   27   27     0  17   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  67  17     6    0    0   0.868     48  0.85
+   28   28     0  13   0   0  25  13  25   0   0   0  13   0   0   0   0   0  13   0   0   0     8    0    0   1.733     83  0.80
+   29   29    13  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  75   0     8    0    0   0.736     35  0.89
+   30   30    63  13  13   0   0   0   0  13   0   0   0   0   0   0   0   0   0   0   0   0     8    0    0   1.074     52  1.10
+   31   31     0  89  11   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     9    0    0   0.349     16  1.45
+   32   32    20   0   0   0   0   0   0   0   0   0  10   0   0   0   0   0   0   0   0  70    10    0    0   0.802     35  0.93
+   33   33    70   0   0   0   0   0   0   0   0   0   0  30   0   0   0   0   0   0   0   0    10    0    0   0.611     27  1.11
+   34   34    10  10   0   0   0   0   0   0   0  10   0   0   0   0   0   0  70   0   0   0    10    0    0   0.940     41  0.96
+   35   35     0   0   0   0   0   0   0  10  20  60  10   0   0   0   0   0   0   0   0   0    10    0    0   1.089     47  1.06
+   36   36     0  10   0   0   0   0   0   0  50   0  40   0   0   0   0   0   0   0   0   0    10    0    0   0.943     41  0.95
+   37   37    10   0  20   0   0   0   0   0  20   0   0   0   0   0   0   0  20  30   0   0    10    0    0   1.557     68  0.70
+   38   38     0  10   0   0   0   0   0   0  20   0  30  20   0   0   0   0   0  20   0   0    10    0    0   1.557     68  0.74
+   39   39    40   0   0   0   0   0   0   0  10   0  30   0   0   0   0   0  10  10   0   0    10    0    0   1.418     62  0.71
+   40   40     0  10   0   0  10   0   0   0  10   0   0   0   0   0  10   0  60   0   0   0    10    0    0   1.228     53  0.81
+   41   41     0  44   0   0  11   0   0   0  22   0   0  11   0   0   0   0   0  11   0   0     9    1    0   1.427     65  0.74
+   42   42    20   0   0   0   0   0   0   0  10  40   0  20   0   0   0   0   0  10   0   0    10    0    0   1.471     64  0.78
+   43   43    11   0   0   0   0   0   0   0  22   0  11   0   0   0   0   0   0  11   0  44     9    1    0   1.427     65  0.81
+   44   44     0   0   0   0   0   0   0   9   9   0   0   0   0   0   0   0   9  18   0  55    11    0    0   1.295     54  1.15
+   45   45     0  27   9  27   0   0   0   0   0   9   0   0   0   0   9   0   9   0   0   9    11    0    0   1.799     75  0.74
+   46   46     8   0   0   0   0   0   0   0   8   0  42  17   0   0   0   8   0   8   0   8    12    0    0   1.699     68  0.80
+   47   47     0   8   0   0   0   0   0  17  17   0   8  25   0   0   0  17   0   8   0   0    12    0    0   1.864     75  0.72
+   48   48     8  58   0   0   0   0   0   8   8   0   0   0   0   0   0   0   8   0   0   8    12    0    0   1.350     54  0.82
+   49   49     0   8   0   0   0   0   0   0   0  17  17   8   0   0   0   0  42   0   8   0    12    0    0   1.583     64  0.71
+   50   50    15  15  23  31   0   0   0   0   8   0   8   0   0   0   0   0   0   0   0   0    13    0    0   1.672     65  0.97
+   51   51     8  15   8   0   8   0   0   0  23   0   8  15   0   0   0   0   8   0   8   0    13    0    0   2.098     82  0.62
+   52   52    23  15  62   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   0.925     36  1.34
+   53   53     0   0  62   8   0  15  15   0   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   1.072     42  0.91
+   54   54    54  15  15   0   0   8   0   8   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   1.304     51  1.02
+   55   55    15  54   0   0   8   0   8   8   8   0   0   0   0   0   0   0   0   0   0   0    13    0    0   1.411     55  0.94
+   56   56    25   8   0   0  17   0   0   0  50   0   0   0   0   0   0   0   0   0   0   0    12    1    0   1.199     48  0.81
+   57   57    25   8  25   0   0   0   0   8   8   0  17   8   0   0   0   0   0   0   0   0    12    1    0   1.820     73  0.80
+   58   58     8  50   0   0   0   0   0   0   0   0   8   8   0   0   0   0   0   0  25   0    12    1    0   1.314     53  0.70
+   59   59     8  50   8   0   0   0   0   0  33   0   0   0   0   0   0   0   0   0   0   0    12    1    0   1.127     45  0.92
+   60   60    25  17   0   0  50   0   0   0   8   0   0   0   0   0   0   0   0   0   0   0    12    1    0   1.199     48  1.02
+   61   61     0  85   8   8   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   0.536     21  1.48
+   62   62     8   8   0   0   0   0   0  31  38   0   0   0  15   0   0   0   0   0   0   0    13    0    0   1.413     55  0.87
+   63   63    15  15   0   0  15   0   0   0  38   0   0   8   8   0   0   0   0   0   0   0    13    0    0   1.626     63  0.70
+   64   64    15  38  15  31   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   1.306     51  1.26
+   65   65     8  69   8   0   0   0   0   0   0   0   0   0  15   0   0   0   0   0   0   0    13    0    0   0.937     37  1.02
+   66   66     8  23  31   0  31   0   8   0   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   1.458     57  1.14
+   67   67    69   0  23   8   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    13    0    0   0.790     31  1.37
+   68   68    15  38   8   8   0   0   0   0   8   0   0  23   0   0   0   0   0   0   0   0    13    0    0   1.586     62  0.90
+   69   69     0  46   0  31  15   0   0   0   8   0   0   0   0   0   0   0   0   0   0   0    13    0    0   1.205     47  1.23
+   70   70     0   8  15   0   8   0   0   8  23   0   8   0   8   0   0   0   0   0  23   0    13    0    0   1.951     76  0.61
+   71   71    14  21  29   0   7  29   0   0   0   0   0   0   0   0   0   0   0   0   0   0    14    0    0   1.512     57  0.91
+   72   72    14   0   7   0   7   0  21   0   0   0  21   0   7   0  14   7   0   0   0   0    14    0    0   1.970     75  0.59
+   73   73     7   7   7   0   0   7  21   0   0   0   0  14   0   0  14   0  21   0   0   0    14    0    0   1.970     75  0.59
+   74   74     0   0   0   0   0   0   0   0   0   0   7  14   0   0  79   0   0   0   0   0    14    0    0   0.656     25  1.14
+   75   75     0   8   0   0   0   0   0   0  23   0   0  23   0   0  23  15   0   0   8   0    13    1    0   1.698     66  0.67
+   76   76     7  14  14   7   0   0   7   7   7   0  36   0   0   0   0   0   0   0   0   0    14    0    0   1.866     71  0.67
+   77   77     0  21   0   0   7   0  36   0   0   0   0   0   0  21   0   0   0   0  14   0    14    0    0   1.494     57  0.82
+   78   78     0   0   0   0   0   0   0   0   0   0   0   0   0   7  40  27   0   0  27   0    15    0    0   1.252     46  0.99
+   79   79     0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0    15    0    0   0.000      0  1.58
+   80   80     0   0   0   8   0   0   0   0   0   0   0   0   0   0  15  46  31   0   0   0    13    2    0   1.205     47  0.99
+   81   81     0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    15    0    0   0.000      0  1.58
+   82   82     0   0   0   0   0   0   0   0   0   0   0   0   0   0  33  27   7  27   7   0    15    0    0   1.432     53  0.91
+   83   83     0   0   0   0   0   0   0   0  93   0   0   0   0   0   0   0   0   7   0   0    15    0    0   0.245      9  1.44
+   84   84     7  33  20  13   0   0   0   0  27   0   0   0   0   0   0   0   0   0   0   0    15    0    0   1.490     55  0.93
+   85   85    20   0   0   0   0   0   0   0   7   0  40   7   0   0   7  20   0   0   0   0    15    0    0   1.552     57  0.75
+   86   86    13   0   0  20   7   0   0   0  47   0   7   7   0   0   0   0   0   0   0   0    15    0    0   1.488     55  0.80
+   87   87     0   0   0   7   0   0   0  33  20   0   0  33   0   0   0   0   0   0   7   0    15    0    0   1.415     52  0.89
+   88   88     0   0  13   0   0   0   0   0   0   0  33   0   0   0   7  33   0   0   7   7    15    0    0   1.543     57  0.76
+   89   89     0   0   0   0  20   0  33   0  13   0   0  13   0   0   7   0   0  13   0   0    15    0    0   1.675     62  0.61
+   90   90     0   0   0   0   0   0   0  67  27   0   0   0   0   0   7   0   0   0   0   0    15    0    0   0.803     30  1.16
+   91   91     0   0   0   0   0   0   0   0  20   0  47   0   0   0  13   0   0   0  20   0    15    0    0   1.268     47  0.87
+   92   92     0   0   7   0   0   0   0   0   0   0  33   0   0   7  33  13   7   0   0   0    15    0    0   1.543     57  0.79
+   93   93     0   0   0   7   0   0   0  53   0   0  13  27   0   0   0   0   0   0   0   0    15    0    0   1.137     42  1.00
+   94   94     7  33   0   0  13   0   7   0   7   7  13   7   0   0   0   0   7   0   0   0    15    0    0   1.987     73  0.65
+   95   95     0   7  20  13   0   0   0   0   7   7   0   0   0   0   0   7  13   0  27   0    15    0    0   1.934     71  0.62
+   96   96     0   0   0   0   0   0   0   7   0   7   7   7   0   0  27   0   0  13   7  27    15    0    0   1.876     69  0.76
+   97   97    38   8  23   0   0   0   0   0  15   0   0  15   0   0   0   0   0   0   0   0    13    2    0   1.479     58  0.96
+   98   98     0  15  31  23   0   0   0   0   0   0   0   8   0   0   8   0   8   0   8   0    13    2    0   1.778     69  0.77
+   99   99     0   0   0   0   0   0   0   7  33   0  20   0   0   7   0   0   0   0   7  27    15    0    0   1.582     58  0.87
+  100  100    40   0  13  27   0   0   0   0  20   0   0   0   0   0   0   0   0   0   0   0    15    0    0   1.310     48  0.99
+  101  101     0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    15    0    0   0.000      0  1.58
+  102  102     0   0   0   0   0   0   0  40   0   0   0  13   0   0   0   0   7   0  40   0    15    0    0   1.182     44  0.96
+  103  103     0   0   0   0   0   0   0   7   0   0   0  93   0   0   0   0   0   0   0   0    15    0    0   0.245      9  1.45
+  104  104     0   0   0   0   0   0   0   7   0   0   0   0   0   0   0   0   0   0  93   0    15    0    0   0.245      9  1.45
+  105  105     0   7   7  20   0   0   0   0   0   0   0   0   0   0   0  67   0   0   0   0    15    0    0   0.953     35  1.03
+  106  106     0   0   0   0   7   0  33   0   0   0   0   0   0  53   0   0   7   0   0   0    15    0    0   1.063     39  0.99
+  107  107     7   0   0   0   0   0   0   0  20   0  40  13   0   0   0   0   0   7  13   0    15    0    0   1.587     59  0.84
+  108  108    36   0  14   7  21   0   0   0   7   0   0  14   0   0   0   0   0   0   0   0    14    1    0   1.631     62  0.85
+  109  109     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   7   7  64   0  21    14    1    0   0.991     38  1.27
+  110  110     0   0   0   0   0   0   0  86   0   0   0   0   0   0  14   0   0   0   0   0    14    1    0   0.410     16  1.18
+  111  111     0   0   0   0   0   0   0   0  36   0  64   0   0   0   0   0   0   0   0   0    14    1    0   0.652     25  1.15
+  112  112     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0    14    1    0   0.000      0  1.58
+  113  113     0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    14    1    0   0.000      0  1.58
+  114  114    36   0  57   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    14    1    0   0.876     33  1.34
+  115  115     0   0   0   0   8  83   8   0   0   0   0   0   0   0   0   0   0   0   0   0    12    2    0   0.566     23  1.50
+  116  116     9  64   9   9   0   0   0   0   0   0   0   0   0   0   0   0   0   0   9   0    11    2    0   1.160     48  1.15
+  117  117     0   0   0   0   0   0   0   0   0   0  10   0   0   0   0  30   0  10   0  50    10    2    0   1.168     51  0.97
+  118  118     0  10   0   0   0   0   0  10  20  50   0   0   0  10   0   0   0   0   0   0    10    2    0   1.359     59  0.81
+  119  119    11   0  11   0  33   0  33   0   0  11   0   0   0   0   0   0   0   0   0   0     9    3    0   1.465     67  0.84
+  120  120     0   0   0   0   0   0  10   0   0   0  10  10  40   0   0  10   0  20   0   0    10    3    0   1.609     70  0.62
+  121  121     0   0   0   0   0   0   0   0   8   0   0  15   0   8  23   8   0   0  38   0    13    0    0   1.586     62  0.78
+  122  122     0   0   0   0   0   0   0   8   0   0   0   0   0   0   0   0   0  38  31  23    13    0    0   1.266     49  1.11
+  123  123     0  54   0   0   0  23   0   0   0   0   0   8   0   0   0   0   8   8   0   0    13    0    0   1.264     49  0.82
+  124  124     0   0  17   0   0   0   0  17   8   0   8   0   0   0   0   0   0  33   0  17    12    1    0   1.676     67  0.81
+  125  125     0  42   0   0   0   0   0   8   8   0   8   0   0   0   8   8   0  17   0   0    12    1    0   1.699     68  0.59
+  126  126     9   0   9   0   0   0   0   0  64   0   0   9   0   0   0   0   0   9   0   0    11    2    0   1.160     48  0.99
+  127  127     0   0   0   0   0   0   0  18  36  18  18   0   9   0   0   0   0   0   0   0    11    2    0   1.516     63  0.92
+  128  128     9   0   0   0   0   0   0   0   0   0   9   0   0   9   0  18  27   9   0  18    11    2    0   1.846     77  0.75
+  129  129     8   0   0   0  25   0   0   8  25   0   8   8   0   0   0   0   0   0   8   8    12    1    0   1.936     78  0.59
+  130  130     0   0   0   0   0   0   8   8   0   0  25   0   0   0   0   8   0  33   0  17    12    1    0   1.633     66  0.78
+  131  131     0   8   0   0   0   0   0   8   8   0  15   0   0  31   0   0   0   0  31   0    13    0    0   1.605     63  0.75
+  132  132     0   8   0   0   0   0   0   0   0   0   0  15   0   0   0   0   8  38   0  31    13    0    0   1.413     55  0.96
+  133  133     0   8   0   0   0   0   0   0   8   0  15   0   0   0   0   8   0   0   0  62    13    0    0   1.179     46  0.90
+  134  134     0   0   0   0   0   0   0   0   0   0  15   0   0   0   8   8   0   0   0  69    13    0    0   0.937     37  1.05
+  135  135    27  55   0   0   0   0   0   0   0   0   0   0   0   0   0   0   9   0   0   9    11    0    0   1.121     47  0.97
+  136  136     0   0  18   0   0   0   0   0   0  27   9   9   0   0   0   0   9   0   9  18    11    0    0   1.846     77  0.64
+  137  137     0   0   0   0   0   0   0   0  10   0  10   0   0   0   0  20  10  40   0  10    10    1    0   1.609     70  0.87
+  138  138     0   0   0   0   0   0   9   0   0   0   0   0   0   0   0   0   0   0  64  27    11    0    0   0.860     36  1.11
+  139  139     0  64   9   0   9   0   0   0   0   0   9   0   0   0   0   0   0   9   0   0    11    0    0   1.160     48  1.01
+  140  140     0   9   9   0   0   0   0   0   9   9  45   0   0   0   0   0   9   0   0   9    11    0    0   1.666     69  0.71
+  141  141     0   0   0   0   0   0   0  10  10   0   0   0   0  20   0  10   0  30   0  20    10    0    0   1.696     74  0.85
+  142  142    20  20  50   0  10   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    10    0    0   1.221     53  1.23
+  143  143     0   0  10   0   0   0   0  10  50   0   0  10   0   0   0  10   0  10   0   0    10    0    0   1.498     65  0.84
+  144  144     0   0   0   0   0   0   0  22  11   0  11   0   0   0   0   0   0   0  11  44     9    0    0   1.427     65  0.96
+  145  145    11  56  11   0   0   0   0   0   0   0  11   0   0   0  11   0   0   0   0   0     9    0    0   1.303     59  0.82
+  146  146     0   0   0   0  13  50  13   0   0   0   0   0   0  13   0   0   0  13   0   0     8    0    0   1.386     67  0.82
+  147  147     0   0   0  14   0   0   0   0   0   0   0   0   0   0   0  14   0   0  57  14     7    0    0   1.154     59  0.85
+  148  148     0   0   0  14   0   0   0   0   0   0  71   0   0   0   0   0   0   0   0  14     7    0    0   0.796     41  0.93
+  149  149     0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0     6    1    0   0.000      0  1.58
+  150  150     0   0   0   0   0   0   0   0  20   0   0  40   0   0   0  20   0  20   0   0     5    0    0   1.332     83  0.67
+  151  151     0   0   0   0   0   0   0   0   0   0   0   0   0   0  80  20   0   0   0   0     5    0    0   0.500     31  1.31
+  152  152     0   0   0   0   0   0   0   0   0   0   0  75   0   0   0   0   0   0   0  25     4    1    0   0.562     41  0.82
+  153  153     0   0   0   0   0   0   0   0   0   0   0   0   0  75   0   0  25   0   0   0     4    1    0   0.562     41  1.11
+  154  154     0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0     4    1    0   0.000      0  1.58
+  155  155     0   0   0   0   0   0   0   0   0   0   0  75   0   0   0   0   0  25   0   0     4    1    0   0.562     41  0.82
+  156  156     0  20   0   0  60   0  20   0   0   0   0   0   0   0   0   0   0   0   0   0     5    0    0   0.950     59  1.34
+  157  157     0   0   0   0   0   0   0  60   0   0   0   0   0   0   0   0   0  40   0   0     5    0    0   0.673     42  1.03
+  158  158     0   0   0   0   0   0   0   0   0   0   0   0   0   0  80  20   0   0   0   0     5    0    0   0.500     31  1.33
+  159  159     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  20  60   0  20     5    0    0   0.950     59  1.14
+  160  160     0  20   0   0   0   0   0   0   0  80   0   0   0   0   0   0   0   0   0   0     5    0    0   0.500     31  0.88
+  161  161     0  20   0   0   0   0   0   0  40   0   0   0   0   0   0  20  20   0   0   0     5    0    0   1.332     83  0.59
+  162  162     0  20   0   0   0   0   0   0  60   0   0   0   0   0   0   0  20   0   0   0     5    0    0   0.950     59  0.63
+  163  163    40   0   0   0   0   0   0   0  40   0   0  20   0   0   0   0   0   0   0   0     5    0    0   1.055     66  0.83
+  164  164     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  80   0   0  20   0     5    0    0   0.500     31  1.15
+  165  165     0   0   0   0   0   0   0   0   0  80   0   0   0   0   0  20   0   0   0   0     5    0    0   0.500     31  1.07
+  166  166     0   0  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0  20   0  60     5    0    0   0.950     59  0.84
+  167  167     0  40   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  60     5    0    0   0.673     42  0.59
+  168  168     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  20   0  20   0  60     5    0    0   0.950     59  1.00
+  169  169     0   0   0   0   0   0   0   0  20   0  20   0   0   0  60   0   0   0   0   0     5    0    0   0.950     59  0.59
+  170  170     0   0   0   0  40   0  60   0   0   0   0   0   0   0   0   0   0   0   0   0     5    0    0   0.673     42  1.52
+  171  171     0  60  20   0   0   0   0  20   0   0   0   0   0   0   0   0   0   0   0   0     5    0    0   0.950     59  0.64
+  172  172     0   0   0   0   0   0   0   0   0   0   0   0   0   0  80   0   0   0  20   0     5    0    0   0.500     31  1.03
+  173  173     0   0   0   0   0   0   0   0  80   0  20   0   0   0   0   0   0   0   0   0     5    0    0   0.500     31  1.18
+  174  174     0   0   0   0   0   0   0   0  83   0   0   0   0   0   0  17   0   0   0   0     6    0    0   0.451     25  1.14
+  175  175    17   0  50   0   0   0   0   0  17   0   0  17   0   0   0   0   0   0   0   0     6    0    0   1.242     69  0.82
+  176  176    17   0   0   0   0   0   0  17   0   0   0   0   0   0   0  17  50   0   0   0     6    0    0   1.242     69  0.62
+  177  177     0   0   0   0   0   0   0   0   0   0   0   0   0   0  17  17   0  67   0   0     6    0    0   0.868     48  0.92
+  178  178     0   0   0   0  17   0  67   0   0   0   0   0   0   0   0   0   0   0  17   0     6    0    0   0.868     48  1.06
+  179  179     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100     5    1    0   0.000      0  1.58
+  180  180     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  20  80   0     5    1    0   0.500     31  1.20
+  181  181    20   0  60   0   0   0   0   0   0   0  20   0   0   0   0   0   0   0   0   0     5    1    0   0.950     59  0.85
+  182  182     0  20   0   0   0   0   0   0  60   0  20   0   0   0   0   0   0   0   0   0     5    1    0   0.950     59  0.64
+  183  183     0   0   0   0   0   0   0   0  20   0   0   0   0   0  20  60   0   0   0   0     5    1    0   0.950     59  0.79
+  184  184     0  80   0   0  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     5    1    0   0.500     31  1.46
+  185  185     0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0     5    1    0   0.000      0  1.58
+  186  186     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  20  60   0   0  20     5    1    0   0.950     59  0.93
+  187  187     0  20  60   0  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     5    1    0   0.950     59  1.14
+  188  188    20   0  60  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     5    1    0   0.950     59  1.25
+  189  189     0   0   0   0  17   0   0   0   0   0   0   0   0   0  67   0   0   0   0  17     6    0    0   0.868     48  0.65
+  190  190     0   0   0   0   0   0  17   0   0   0   0   0   0   0   0   0  17  50  17   0     6    0    0   1.242     69  0.65
+  191  191     0   0   0   0  17   0   0  67   0   0   0   0   0   0   0   0   0  17   0   0     6    0    0   0.868     48  0.73
+  192  192     0   0   0   0   0   0   0   0   0  67   0   0   0   0   0  17   0   0   0  17     6    0    0   0.868     48  0.87
+  193  193    17   0  67   0   0  17   0   0   0   0   0   0   0   0   0   0   0   0   0   0     6    0    0   0.868     48  0.88
+  194  194     0   0   0   0   0   0   0   0   0  17   0  17   0   0   0  50   0   0  17   0     6    0    0   1.242     69  0.71
+  195  195     0   0   0   0   0   0   0  83   0   0   0   0   0   0   0   0   0   0   0  17     6    0    0   0.451     25  1.36
+  196  196     0   0   0   0   0   0  17   0   0   0  67   0   0   0   0   0   0  17   0   0     6    0    0   0.868     48  0.72
+  197  197    17  50  17  17   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     6    0    0   1.242     69  1.18
+  198  198    17  50  17   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  17     6    0    0   1.242     69  0.80
+  199  199     0   0   0   0   0   0   0  17  17   0   0   0   0   0   0  33   0   0  17  17     6    0    0   1.561     87  0.73
+  200  200    67   0  17   0   0   0   0   0  17   0   0   0   0   0   0   0   0   0   0   0     6    0    0   0.868     48  1.10
+  201  201    50  17   0   0   0   0   0  17   0   0   0   0   0   0   0   0   0   0  17   0     6    0    0   1.242     69  0.64
+  202  202     0  67  17   0   0   0   0   0   0   0   0   0   0   0  17   0   0   0   0   0     6    0    0   0.868     48  0.87
+  203  203     0   0   0   0   0   0   0  17   0   0  17   0   0   0   0   0   0  50   0  17     6    0    0   1.242     69  0.98
+  204  204     0  17   0   0   0   0   0   0   0   0   0  17   0   0   0   0   0   0   0  67     6    0    0   0.868     48  0.72
+  205  205     0   0   0   0  17   0  67  17   0   0   0   0   0   0   0   0   0   0   0   0     6    0    0   0.868     48  0.91
+  206  206     0  83   0   0   0   0   0   0  17   0   0   0   0   0   0   0   0   0   0   0     6    0    0   0.451     25  1.11
+  207  207     0   0   0   0   0   0   0   0   0  20   0   0   0   0  80   0   0   0   0   0     5    1    0   0.500     31  1.13
+  208  208     0  67  17   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  17   0     6    0    0   0.868     48  0.90
+  209  209    17   0   0   0   0   0   0   0   0   0   0   0   0   0   0  67   0  17   0   0     6    0    0   0.868     48  0.80
+  210  210     0   0   0   0   0   0   0   0   0   0   0   0   0   0  17  83   0   0   0   0     6    0    0   0.451     25  1.37
+  211  211     0  67   0   0   0   0   0  17   0   0  17   0   0   0   0   0   0   0   0   0     6    0    0   0.868     48  0.63
+  212  212    17   0   0   0  50   0   0   0   0   0   0   0   0   0  17   0   0   0  17   0     6    0    0   1.242     69  0.59
+  213  213     0   0   0   0   0   0   0   0  67   0   0   0   0  17   0   0   0   0  17   0     6    0    0   0.868     48  0.87
+  214  214     0   0  17  17   0   0   0   0  17   0   0   0   0   0   0   0  33   0   0  17     6    0    0   1.561     87  0.59
+  215  215     0   0   0   0   0   0   0   0   0   0   0   0   0  17  83   0   0   0   0   0     6    0    0   0.451     25  1.28
+  216  216     0  17   0  33   0   0   0  17  17   0   0   0   0   0   0   0  17   0   0   0     6    0    0   1.561     87  0.59
+  217  217    83   0   0   0   0   0   0   0  17   0   0   0   0   0   0   0   0   0   0   0     6    0    0   0.451     25  1.20
+  218  218     0   0   0   0   0   0   0  17   0   0   0  17   0   0   0  17  33   0  17   0     6    0    0   1.561     87  0.70
+  219  219     0   0   0   0   0   0  17   0   0   0   0   0   0   0   0  67   0  17   0   0     6    0    0   0.868     48  0.69
+  220  220     0   0   0   0   0   0   0  17  33   0  17  17   0   0   0   0   0  17   0   0     6    0    0   1.561     87  0.81
+  221  221    17   0   0   0   0   0   0   0   0   0  33  17   0   0  17   0   0  17   0   0     6    0    0   1.561     87  0.59
+  222  222     0   0   0   0   0   0   0   0   0   0  67  17   0   0   0   0   0   0   0  17     6    0    0   0.868     48  0.92
+  223  223     0  17   0   0  17   0   0   0   0   0   0   0  50   0   0   0  17   0   0   0     6    0    0   1.242     69  0.59
+  224  224     0   0   0   0   0   0   0   0   0   0   0   0   0  67  33   0   0   0   0   0     6    0    0   0.637     36  1.19
+  225  225     0   0   0   0   0   0   0  17   0   0  83   0   0   0   0   0   0   0   0   0     6    0    0   0.451     25  1.31
+  226  226     0   0   0   0   0   0   0  17   0   0  67   0   0   0   0   0   0  17   0   0     6    0    0   0.868     48  1.01
+  227  227    17   0  50   0   0   0   0   0  17   0   0   0   0   0   0   0   0  17   0   0     6    0    0   1.242     69  0.75
+  228  228     0   0   0   0   0   0   0  17   0   0  33  33   0   0   0  17   0   0   0   0     6    0    0   1.330     74  0.79
+  229  229     0   0   0   0   0   0   0   0   0   0   0   0   0  17   0   0  17  67   0   0     6    0    0   0.868     48  1.11
+  230  230     0  50  17   0   0  17   0   0   0   0   0   0   0  17   0   0   0   0   0   0     6    0    0   1.242     69  0.68
+  231  231     0  50  50   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     6    0    0   0.693     39  1.24
+  232  232     0   0   0   0   0   0   0   0   0   0  17   0   0  33   0  33  17   0   0   0     6    0    0   1.330     74  0.69
+  233  233    17   0   0   0   0   0   0   0   0   0  17  50   0   0   0  17   0   0   0   0     6    0    0   1.242     69  0.76
+  234  234     0   0   0   0   0  17   0   0   0   0   0   0   0   0   0   0   0  17   0  67     6    0    0   0.868     48  0.70
+  235  235     0  67  17   0  17   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     6    0    0   0.868     48  1.31
+  236  236     0  17   0   0   0   0   0   0   0   0   0   0   0   0  17  17   0  33   0  17     6    0    0   1.561     87  0.59
+  237  237     0  17   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  83   0   0     6    0    0   0.451     25  1.05
+  238  238     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  67  17  17     6    0    0   0.868     48  1.22
+  239  239     0   0  17   0   0   0   0   0   0  50  17   0   0   0   0   0   0   0   0  17     6    0    0   1.242     69  0.71
+  240  240     0   0   0   0   0   0  17  33  17   0   0  17   0   0   0   0   0  17   0   0     6    0    0   1.561     87  0.59
+  241  241     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  17  17  33  33     6    0    0   1.330     74  1.01
+  242  242     0   0   0   0   0   0   0   0   0   0   0   0   0  33  33  33   0   0   0   0     6    0    0   1.099     61  0.97
+  243  243     0  20  20   0   0   0   0   0   0   0  40   0   0   0   0  20   0   0   0   0     5    1    0   1.332     83  0.59
+  244  244     0  20   0   0   0   0   0  20  20  40   0   0   0   0   0   0   0   0   0   0     5    1    0   1.332     83  0.59
+  245  245     0   0   0   0   0   0   0  80   0   0   0  20   0   0   0   0   0   0   0   0     5    1    0   0.500     31  1.17
+  246  246     0   0   0   0   0   0   0   0   0   0   0   0   0   0  40   0  40   0   0  20     5    1    0   1.055     66  0.87
+  247  247     0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0     4    1    0   0.000      0  1.58
+  248  248     0   0   0   0   0   0   0   0   0   0  50  25   0   0   0   0   0   0   0  25     4    1    0   1.040     75  0.67
+  249  249     0  60   0   0   0   0  20   0   0   0   0   0   0   0  20   0   0   0   0   0     5    0    0   0.950     59  0.59
+  250  250     0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0     5    0    0   0.000      0  1.58
+  251  251     0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     5    0    0   0.000      0  1.58
+  252  252     0  40   0   0   0   0   0   0   0   0   0   0   0   0  40  20   0   0   0   0     5    0    0   1.055     66  0.59
+  253  253     0   0   0   0   0   0   0   0  20   0  20   0   0  60   0   0   0   0   0   0     5    0    0   0.950     59  0.59
+  254  254     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  80   0   0  20   0     5    0    0   0.500     31  1.15
+  255  255     0  40   0   0   0   0   0  20   0  40   0   0   0   0   0   0   0   0   0   0     5    0    0   1.055     66  0.59
+  256  256     0   0   0   0   0   0   0   0   0  80   0   0   0  20   0   0   0   0   0   0     5    0    0   0.500     31  1.07
+  257  257    20  20  20  40   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     5    0    0   1.332     83  1.15
+  258  258     0   0   0   0   0   0   0   0   0   0   0  20   0   0   0   0   0  80   0   0     5    0    0   0.500     31  1.07
+  259  259     0  80  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     5    0    0   0.500     31  1.31
+  260  260     0   0   0   0   0   0   0   0   0  20   0   0   0   0  40  40   0   0   0   0     5    0    0   1.055     66  0.91
+  261  261     0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0     4    1    0   0.000      0  1.58
+  262  262     0  20   0   0   0   0   0   0   0  20   0   0   0   0   0   0  60   0   0   0     5    0    0   0.950     59  0.78
+  263  263     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  20   0   0  80     5    0    0   0.500     31  1.27
+  264  264     0   0   0   0   0   0   0  80   0   0   0   0   0   0   0   0   0   0   0  20     5    0    0   0.500     31  1.27
+  265  265    40   0  40   0   0   0   0   0   0   0   0   0   0   0   0  20   0   0   0   0     5    0    0   1.055     66  0.82
+  266  266     0  20   0   0   0   0   0   0   0   0   0   0   0  60   0   0   0   0   0  20     5    0    0   0.950     59  0.61
+  267  267     0   0   0  60   0   0   0   0  40   0   0   0   0   0   0   0   0   0   0   0     5    0    0   0.673     42  0.91
+  268  268    80   0   0   0  20   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     5    0    0   0.500     31  1.07
+  269  269     0   0   0   0   0   0   0   0   0   0   0   0   0  80   0   0  20   0   0   0     5    0    0   0.500     31  1.27
+  270  270     0   0   0   0   0   0   0  80   0   0   0   0   0   0   0   0   0  20   0   0     5    0    0   0.500     31  1.19
+  271  271     0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0     3    1    0   0.000      0  1.58
+  272  272     0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0     3    1    0   0.000      0  1.58
+  273  273     0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0     3    1    0   0.000      0  1.58
+  274  274     0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0     4    0    0   0.000      0  1.58
+  275  275     0  75   0  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.46
+  276  276     0  75   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  25   0   0     4    0    0   0.562     41  0.59
+  277  277     0   0   0   0   0   0   0   0  75   0   0  25   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.21
+  278  278     0   0   0  25   0   0   0   0   0   0  25  50   0   0   0   0   0   0   0   0     4    0    0   1.040     75  0.59
+  279  279     0   0   0   0   0   0   0   0   0   0   0   0   0   0  25   0   0   0   0  75     4    0    0   0.562     41  0.71
+  280  280     0  75  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.17
+  281  281     0   0   0  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0  75   0     4    0    0   0.562     41  0.59
+  282  282     0   0   0   0   0   0   0  25   0   0  75   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.05
+  283  283     0  75  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.17
+  284  284     0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0     4    0    0   0.000      0  1.58
+  285  285     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0     4    0    0   0.000      0  1.58
+  286  286     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100     4    0    0   0.000      0  1.58
+  287  287     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  25   0  75     4    0    0   0.562     41  1.29
+  288  288     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0     4    0    0   0.000      0  1.58
+  289  289     0   0   0  25   0   0   0   0   0   0   0   0   0   0  25  50   0   0   0   0     4    0    0   1.040     75  0.73
+  290  290     0   0   0   0   0   0   0  75  25   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.31
+  291  291     0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.000      0  1.58
+  292  292     0  25   0   0   0   0   0   0  25   0   0   0   0   0   0   0   0   0   0  50     4    0    0   1.040     75  0.59
+  293  293     0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0     4    0    0   0.000      0  1.58
+  294  294    25   0   0   0   0   0   0   0   0   0  75   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  0.65
+  295  295     0  75  25   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.17
+  296  296     0   0   0   0   0   0   0   0   0   0  25   0   0   0   0   0   0  75   0   0     4    0    0   0.562     41  0.82
+  297  297     0   0   0   0   0   0   0  25  25   0   0  50   0   0   0   0   0   0   0   0     4    0    0   1.040     75  0.86
+  298  298    25  75   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  1.17
+  299  299     0  25   0   0   0   0   0   0   0   0   0  50   0  25   0   0   0   0   0   0     4    0    0   1.040     75  0.59
+  300  300     0   0   0   0   0   0   0   0  75   0   0   0   0   0   0   0  25   0   0   0     4    0    0   0.562     41  0.82
+  301  301     0  25   0   0   0   0   0   0   0   0  50   0   0   0   0   0   0   0   0  25     4    0    0   1.040     75  0.59
+  302  302     0   0   0   0   0   0   0  50   0   0   0   0   0   0   0   0   0  50   0   0     4    0    0   0.693     50  1.07
+  303  303     0   0   0   0   0   0   0  25  50   0   0   0   0   0   0   0   0   0  25   0     4    0    0   1.040     75  0.76
+  304  304     0  25  25   0   0   0   0   0   0   0   0  50   0   0   0   0   0   0   0   0     4    0    0   1.040     75  0.74
+  305  305     0   0   0   0   0   0  25   0  75   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  0.98
+  306  306     0   0   0   0  75   0   0   0  25   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.562     41  0.92
+  307  307     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  25   0  75   0   0     4    0    0   0.562     41  0.88
+  308  308     0   0   0   0   0   0   0   0   0   0   0   0   0   0  75  25   0   0   0   0     4    0    0   0.562     41  1.17
+  309  309     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  25  75   0     4    0    0   0.562     41  1.00
+  310  310     0   0   0   0   0   0   0   0  75   0   0   0   0   0  25   0   0   0   0   0     4    0    0   0.562     41  0.59
+  311  311     0   0   0   0   0   0   0   0   0   0   0   0   0   0  75   0   0   0  25   0     4    0    0   0.562     41  0.76
+  312  312     0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0     4    0    0   0.000      0  1.58
+  313  313     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  75   0  25     4    0    0   0.562     41  1.29
+  314  314     0   0   0   0   0   0   0   0   0   0  75   0   0   0   0   0  25   0   0   0     4    0    0   0.562     41  0.65
+  315  315     0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0     4    0    0   0.000      0  1.58
+  316  316     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0     3    0    0   0.000      0  1.58
+  317  317     0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  318  318     0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  319  319     0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  320  320     0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  321  321     0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  322  322     0   0   0   0   0   0   0   0   0   0   0   0   0   0  33  67   0   0   0   0     3    0    0   0.637     58  1.08
+  323  323     0  67   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  33   0     3    0    0   0.637     58  0.59
+  324  324     0   0   0   0   0   0   0   0   0   0   0   0   0   0  67  33   0   0   0   0     3    0    0   0.637     58  1.08
+  325  325     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100     3    0    0   0.000      0  1.58
+  326  326    67   0   0   0   0   0   0   0   0   0   0  33   0   0   0   0   0   0   0   0     3    0    0   0.637     58  0.66
+  327  327     0  33  67   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     3    0    0   0.637     58  1.08
+  328  328     0   0   0  67   0   0   0   0   0   0  33   0   0   0   0   0   0   0   0   0     3    0    0   0.637     58  0.59
+  329  329     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0     3    0    0   0.000      0  1.58
+  330  330     0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  331  331     0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  332  332     0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  333  333     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0     3    0    0   0.000      0  1.58
+  334  334     0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  335  335     0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+  336  336     0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0     3    0    0   0.000      0  1.58
+  337  337     0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     3    0    0   0.000      0  1.58
+//

Added: trunk/packages/norsnet/trunk/debian/example/cad23-fil.rdbProf
===================================================================
--- trunk/packages/norsnet/trunk/debian/example/cad23-fil.rdbProf	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/example/cad23-fil.rdbProf	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,452 @@
+# Perl-RDB 
+# PROF3
+# 
+# Copyright          : Burkhard Rost, CUBIC NYC / LION Heidelberg
+# Email              : rost at columbia.edu
+# WWW                : http://cubic.bioc.columbia.edu
+# Version            : 2000.02
+# 
+# --------------------------------------------------------------------------------
+# About your protein :
+# 
+# VALUE    PROT_ID   : query
+# VALUE    PROT_NCHN : 1
+# VALUE    PROT_NRES : 337
+# VALUE    PROT_NALI : 17
+# VALUE    PROT_NFAR : 15
+# VALUE    PROT_NFAR50-5: 1
+# VALUE    PROT_NFAR40-5: 1
+# VALUE    PROT_NFAR30-5: 1
+# VALUE    PROT_NFAR5-5: 0
+# 
+# --------------------------------------------------------------------------------
+# About the alignment:
+# 
+# VALUE    ALI_ORIG  : ./cad23-fil.hssp
+# 
+# --------------------------------------------------------------------------------
+# PROFhtm summary:
+# 
+# VALUE    HTM_NHTM_BEST       :      1     (number of helices for best model)
+# VALUE    HTM_NHTM_2ND_BEST   :      0     (number of helices for second best model)
+# VALUE    HTM_REL_BEST        :  0.000     (reliability of best model =zscore)
+# VALUE    HTM_REL_BEST_DIFF   :  0.053     (reliability of best model =1st-2nd)
+# VALUE    HTM_REL_BEST_DPROJ  :      5     (reliability of best model projection of (1st-2nd)
+# VALUE    HTM_MODEL           : iteratively adding transmembrane helices (HTM's)
+# VALUE    HTM_MODEL_DAT       : 1          , 0.9656       , 0.8915     ,   49 -    71
+# VALUE    HTM_HTMTOP_OBS      :  unk       (first loop region)
+# VALUE    HTM_HTMTOP_PRD      :  out       (first loop region, mode=top_fin)
+# VALUE    HTM_HTMTOP_MODPRD   :  out       (first loop region, mode=PRHL)
+# VALUE    HTM_HTMTOP_RID      : 16.018     (difference num(K+R), even-odd)
+# VALUE    HTM_HTMTOP_RIP      :      9     (reliability index =int(min{9,2*sqrt((DC)^2)}) )
+# 
+# --------------------------------------------------------------------------------
+# About PROF specifics:
+# 
+# VALUE    PROF_FPAR : acc=/home/rost/pub/prof/net/PROFboth_best.par
+# VALUE    PROF_NNET : acc=6
+# 
+# --------------------------------------------------------------------------------
+# Notation used      :
+# 
+# ------------------------------------------------------------------------
+# NOTATION HEADER    : PROTEIN
+# NOTATION PROT_ID   : identifier of protein [w]
+# NOTATION PROT_NRES : number of residues [d]
+# NOTATION PROT_NCHN : number of chains (if PDB protein) [d]
+# NOTATION PROT_NALI : number of proteins aligned in family [d]
+# NOTATION PROT_NFAR : number of distant relatives [d]
+# 
+# ------------------------------------------------------------------------
+# NOTATION HEADER    : ALIGNMENT
+# NOTATION HEADER    : ALIGNMENT: input file
+# 
+# ------------------------------------------------------------------------
+# NOTATION HEADER    : INTERNAL
+# NOTATION PROF_FPAR : name of parameter file, used [w]
+# NOTATION PROF_NNET : number of networks used for prediction [d]
+# 
+# 
+# ------------------------------------------------------------------------
+# NOTATION BODY      : PROTEIN
+# NOTATION NO        : counting residues [d]
+# NOTATION AA        : amino acid one letter code [A-Z!a-z]
+# NOTATION CHN       : protein chain [A-Z!a-z]
+# 
+# ------------------------------------------------------------------------
+# NOTATION BODY      : PROF
+# 
+# ------------------------------------------------------------------------
+# NOTATION BODY      : PROFsec
+# NOTATION OHEL      : observed secondary structure: H=helix, E=extended (sheet), blank=other (loop)
+# NOTATION PHEL      : PROF predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop) PROF = PROF: Profile network prediction HeiDelberg
+# NOTATION RI_S      : reliability index for PROFsec prediction (0=lo 9=high) Note: for the brief presentation strong predictions marked by '*'
+# NOTATION pH        : 'probability' for assigning helix (1=high, 0=low)
+# NOTATION pE        : 'probability' for assigning strand (1=high, 0=low)
+# NOTATION pL        : 'probability' for assigning neither helix, nor strand (1=high, 0=low)
+# NOTATION OtH       : actual neural network output from PROFsec for helix unit
+# NOTATION OtE       : actual neural network output from PROFsec for strand unit
+# NOTATION OtL       : actual neural network output from PROFsec for 'no-regular' unit
+# 
+# ------------------------------------------------------------------------
+# NOTATION BODY      : PROFacc
+# NOTATION OACC      : observed solvent accessibility (acc) in square Angstroem (taken from DSSP: W Kabsch and C Sander, Biopolymers, 22, 2577-2637, 1983)
+# NOTATION PACC      : PROF predicted solvent accessibility (acc) in square Angstroem
+# NOTATION OREL      : observed relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%).
+# NOTATION PREL      : PROF predicted relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%).
+# NOTATION RI_A      : reliability index for PROFacc prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*'
+# NOTATION Obe       : observerd relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%.
+# NOTATION Pbe       : PROF predicted  relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%.
+# NOTATION Obie      : observerd relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%.
+# NOTATION Pbie      : PROF predicted relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%.
+# NOTATION Ot4       : actual neural network output from PROFsec for unit 0 coding for a relative solvent accessibility of 4*4 - 5*5 percent (16-25%). Note: OtN, with N=0-9 give the same information for the other output units!
+# 
+# ------------------------------------------------------------------------
+# NOTATION BODY      : PROFhtm
+# NOTATION OMN       : observed membrane helix: M=helical transmembrane region, blank=non-membrane
+# NOTATION PMN       : PROF predicted membrane helix: M=helical transmembrane region, blank=non-membrane PROF = PROF: Profile network prediction HeiDelberg
+# NOTATION PRMN      : refined PROF prediction: M=helical transmembrane region, blank=non-membrane
+# NOTATION RI_M      : reliability index for PROFhtm prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*'
+# NOTATION pM        : 'probability' for assigning transmembrane helix
+# NOTATION pN        : 'probability' for assigning globular region
+# 
+# --------------------------------------------------------------------------------
+# 
+No	AA	OHEL	PHEL	RI_S	OACC	PACC	OREL	PREL	RI_A	PMN	PRMN	PiMo	RI_M	pH	pE	pL	pM	pN	Obe	Pbe	Obie	Pbie	OtH	OtE	OtL	Ot0	Ot1	Ot2	Ot3	Ot4	Ot5	Ot6	Ot7	Ot8	Ot9	OtM	OtN
+1	D	L	L	9	0	146	0	90	9	L	L	o	9	0	0	9	0	9	b	e	b	e	0	0	97	1	1	2	5	8	12	18	24	33	36	2	97
+2	Y	L	L	8	0	44	0	20	0	L	L	o	9	0	0	9	0	9	b	e	b	i	5	4	88	11	13	17	21	23	22	17	13	11	10	1	98
+3	K	L	L	6	0	114	0	56	9	L	L	o	9	1	0	7	0	9	b	e	b	e	13	7	79	0	1	2	5	10	18	28	34	33	29	1	98
+4	D	L	L	2	0	91	0	56	7	L	L	o	9	3	0	5	0	9	b	e	b	e	36	5	60	3	4	6	10	15	20	26	29	28	25	1	98
+5	H	L	L	3	0	132	0	72	4	L	L	o	9	3	0	6	0	9	b	e	b	e	31	4	66	6	7	10	14	18	20	21	21	23	23	1	98
+6	D	L	L	4	0	91	0	56	4	L	L	o	9	2	0	6	0	9	b	e	b	e	28	5	71	7	8	10	13	16	19	23	24	23	21	1	98
+7	G	L	L	7	0	10	0	12	2	L	L	o	9	0	0	8	0	9	b	b	b	i	9	4	87	20	21	22	23	21	18	14	12	10	10	1	98
+8	D	L	L	5	0	68	0	42	4	L	L	o	9	1	1	7	0	9	b	e	b	e	11	18	70	6	7	9	13	17	22	26	25	22	18	1	98
+9	Y	L	L	3	0	13	0	6	3	L	L	o	9	1	2	5	0	9	b	b	b	b	17	24	55	22	23	24	24	21	17	12	8	7	6	1	98
+10	K	L	L	3	0	86	0	42	7	L	L	o	9	2	1	6	0	9	b	e	b	e	23	15	58	3	3	5	9	15	21	25	25	20	15	1	98
+11	D	L	L	4	0	91	0	56	3	L	L	o	9	2	0	6	0	9	b	e	b	e	26	7	68	9	10	12	14	16	19	21	22	22	21	1	98
+12	H	L	L	3	0	103	0	56	6	L	L	o	9	3	0	6	0	9	b	e	b	e	32	4	63	3	4	7	12	17	21	23	24	23	22	1	98
+13	D	L	L	3	0	117	0	72	3	L	L	o	9	2	0	6	0	9	b	e	b	e	30	7	64	9	10	11	13	15	18	20	22	23	23	1	98
+14	I	L	L	3	0	33	0	20	0	L	L	o	9	3	0	6	0	9	b	e	b	i	31	4	65	10	12	15	19	20	20	18	16	13	11	1	98
+15	D	L	L	2	0	91	0	56	6	L	L	o	9	3	0	5	0	9	b	e	b	e	33	7	58	4	5	6	9	12	18	23	27	27	25	1	98
+16	Y	L	H	0	0	26	0	12	0	L	L	o	9	4	0	4	0	9	b	b	b	i	47	5	43	14	16	21	24	24	21	18	15	12	10	1	98
+17	K	L	H	0	0	114	0	56	9	L	L	o	9	5	0	4	0	9	b	e	b	e	48	4	44	1	2	3	6	11	17	25	31	30	27	1	98
+18	D	L	H	0	0	91	0	56	6	L	L	o	9	4	0	4	0	9	b	e	b	e	46	4	45	4	5	7	11	15	20	24	26	26	24	1	98
+19	D	L	L	1	0	68	0	42	3	L	L	o	9	4	0	5	0	9	b	e	b	e	43	2	54	10	10	11	14	17	20	22	22	20	18	1	98
+20	D	L	H	3	0	48	0	30	2	L	L	o	9	6	0	3	0	9	b	e	b	i	65	2	32	8	9	13	18	22	24	24	21	17	14	1	98
+21	D	L	H	3	0	91	0	56	8	L	L	o	9	6	0	3	0	9	b	e	b	e	67	1	30	2	3	4	6	10	16	25	31	31	28	1	98
+22	K	L	H	5	0	114	0	56	8	L	L	o	9	7	0	2	0	9	b	e	b	e	73	3	20	2	3	4	7	12	19	27	30	26	21	1	98
+23	L	L	H	5	0	0	0	0	7	L	L	o	9	7	0	2	0	9	b	b	b	b	74	1	22	33	29	22	18	14	10	7	4	3	2	1	98
+24	A	L	H	4	0	44	0	42	2	L	L	o	9	7	0	2	0	9	b	e	b	e	72	2	24	9	10	11	16	21	24	25	21	15	10	1	98
+25	A	L	H	4	0	95	0	90	7	L	L	o	9	7	0	2	0	9	b	e	b	e	71	1	26	4	5	5	7	9	13	18	25	28	29	1	98
+26	A	L	H	3	0	31	0	30	1	L	L	o	9	6	0	3	0	9	b	e	b	i	63	2	33	10	12	15	20	23	24	21	17	13	10	1	98
+27	N	L	L	0	0	113	0	72	5	L	L	o	9	4	0	5	0	9	b	e	b	e	46	3	54	7	7	8	10	13	17	22	25	26	25	1	98
+28	S	L	L	4	0	15	0	12	1	L	L	o	9	2	0	6	0	9	b	b	b	i	27	4	69	16	20	24	25	23	18	15	12	10	9	1	98
+29	N	L	L	5	0	87	0	56	4	L	L	o	9	1	0	7	0	9	b	e	b	e	18	9	70	8	8	9	12	15	19	23	25	23	21	1	98
+30	V	L	L	0	0	0	0	0	2	L	L	o	9	1	3	4	0	9	b	b	b	b	12	41	50	24	23	21	20	18	17	15	12	9	7	1	98
+31	L	L	E	1	0	0	0	0	6	L	L	o	9	0	5	3	0	9	b	b	b	b	7	54	39	30	28	25	22	17	13	9	6	4	3	1	98
+32	D	L	E	2	0	48	0	30	0	L	L	o	9	0	5	3	0	9	b	e	b	i	6	59	38	17	17	17	19	20	21	19	15	11	8	2	97
+33	V	L	L	0	0	0	0	0	5	L	L	o	9	0	4	4	0	9	b	b	b	b	5	49	50	30	27	22	20	16	13	9	6	4	3	2	97
+34	Q	L	L	3	0	0	0	0	2	L	L	o	9	0	2	6	0	9	b	b	b	b	6	30	66	22	22	21	21	20	18	15	11	7	5	2	97
+35	P	L	L	1	0	0	0	0	1	L	L	o	9	3	1	5	0	9	b	b	b	b	39	12	51	23	21	19	19	19	19	18	15	11	9	1	98
+36	A	L	H	1	0	0	0	0	1	L	L	o	9	5	0	3	0	9	b	b	b	b	56	9	39	22	22	20	21	20	19	17	16	13	12	1	98
+37	I	L	H	2	0	20	0	12	0	L	L	o	9	5	0	3	0	9	b	b	b	i	58	9	33	20	20	20	21	21	20	19	17	15	14	1	98
+38	S	L	H	2	0	39	0	30	1	L	L	o	9	5	0	3	0	9	b	e	b	i	56	9	31	13	13	13	16	18	20	20	20	18	17	2	97
+39	V	L	H	0	0	42	0	30	1	L	L	o	9	4	1	4	0	9	b	e	b	i	43	12	40	12	13	15	18	21	22	22	21	19	17	3	96
+40	Q	L	L	0	0	83	0	42	3	L	L	o	8	3	1	4	0	9	b	e	b	e	38	16	45	9	9	11	14	17	20	23	23	22	20	5	94
+41	L	L	L	4	0	19	0	12	1	L	L	o	8	2	1	6	0	9	b	b	b	i	24	10	66	17	19	22	24	22	19	15	12	10	9	7	92
+42	P	L	L	2	0	57	0	42	3	L	L	o	8	3	0	6	0	9	b	e	b	e	32	8	61	10	11	12	15	18	21	23	23	22	20	8	91
+43	D	L	L	3	0	146	0	90	8	L	L	o	8	3	0	6	0	9	b	e	b	e	31	5	64	2	3	4	7	11	15	20	25	32	34	9	90
+44	D	L	L	3	0	117	0	72	6	L	L	o	7	3	0	6	1	8	b	e	b	e	32	4	62	4	5	6	9	12	17	22	27	29	29	14	85
+45	M	L	L	2	0	22	0	12	1	L	L	o	4	3	0	5	2	7	b	b	b	i	37	4	57	18	20	21	23	21	18	15	12	11	10	28	71
+46	S	L	L	1	0	93	0	72	4	L	L	o	0	4	0	5	4	5	b	e	b	e	41	5	53	7	7	8	10	13	17	21	24	25	24	48	51
+47	A	L	L	0	0	59	0	56	2	H	L	o	3	4	0	4	6	3	b	e	b	e	48	6	43	10	10	11	13	15	17	19	20	20	19	66	33
+48	L	L	L	0	0	0	0	0	4	H	L	o	5	4	0	4	7	2	b	b	b	b	41	8	45	27	25	23	21	19	15	11	8	6	4	77	22
+49	Q	L	L	0	0	0	0	0	3	H	H	T	6	3	2	4	8	1	b	b	b	b	35	22	39	24	22	20	19	19	17	14	10	7	5	83	16
+50	M	L	H	1	0	0	0	0	7	H	H	T	7	4	3	1	8	1	b	b	b	b	47	31	18	35	30	20	16	12	10	7	5	3	2	87	12
+51	A	L	H	2	0	0	0	0	7	H	H	T	7	5	3	1	8	1	b	b	b	b	56	33	12	34	29	19	16	12	9	6	4	2	1	89	10
+52	I	L	H	3	0	0	0	0	9	H	H	T	8	6	2	0	9	0	b	b	b	b	64	28	6	46	35	15	9	5	3	2	1	0	0	90	9
+53	I	L	H	5	0	0	0	0	9	H	H	T	8	7	1	0	9	0	b	b	b	b	74	18	6	40	33	19	13	9	6	4	2	0	0	91	8
+54	V	L	H	7	0	0	0	0	9	H	H	T	8	8	0	0	9	0	b	b	b	b	83	8	7	43	34	16	10	6	4	2	1	0	0	91	8
+55	L	L	H	8	0	0	0	0	9	H	H	T	8	9	0	0	9	0	b	b	b	b	92	2	4	43	33	16	10	6	4	3	1	0	0	90	9
+56	A	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	93	1	5	45	34	14	8	6	4	2	1	0	0	89	10
+57	I	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	93	0	4	45	34	14	8	5	3	2	1	0	0	89	10
+58	L	L	H	9	0	0	0	0	8	H	H	T	7	9	0	0	8	1	b	b	b	b	94	0	3	36	30	17	13	10	7	4	2	1	0	88	11
+59	L	L	H	9	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	94	0	3	39	31	16	11	8	5	3	2	1	0	88	11
+60	F	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	92	0	4	42	33	17	11	7	4	2	1	0	0	88	11
+61	L	L	H	9	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	94	0	3	47	36	16	9	5	3	1	0	0	0	88	11
+62	A	L	H	9	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	94	0	3	43	33	13	8	5	4	3	2	1	0	88	11
+63	A	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	93	0	4	42	33	15	10	7	5	3	1	0	0	88	11
+64	M	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	90	0	5	47	36	16	9	5	3	1	0	0	0	88	11
+65	L	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	93	0	4	48	36	14	7	4	2	1	0	0	0	88	11
+66	F	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	93	1	4	42	33	18	11	7	4	2	1	0	0	88	11
+67	V	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	91	1	5	48	36	14	7	4	2	1	0	0	0	89	10
+68	L	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	91	1	5	43	34	18	11	7	4	2	1	0	0	89	10
+69	M	L	H	8	0	0	0	0	9	H	H	T	7	9	0	0	8	1	b	b	b	b	90	1	6	44	34	17	10	6	4	2	1	0	0	89	10
+70	N	L	H	7	0	0	0	0	7	H	H	T	7	8	0	0	8	1	b	b	b	b	86	2	8	33	28	19	16	13	10	7	4	2	1	88	11
+71	W	L	H	8	0	0	0	0	6	H	H	T	6	9	0	0	8	1	b	b	b	b	90	1	5	31	28	21	18	14	11	7	4	2	1	84	15
+72	Y	L	H	7	0	0	0	0	6	H	L	i	5	8	0	0	7	2	b	b	b	b	87	2	9	30	26	20	17	15	12	8	5	3	2	78	21
+73	Y	L	H	7	0	0	0	0	4	H	L	i	3	8	0	1	6	3	b	b	b	b	85	1	11	28	25	20	17	15	13	10	7	4	3	66	33
+74	R	L	H	6	0	74	0	30	0	H	L	i	0	8	0	1	5	4	b	e	b	i	81	1	14	12	13	15	19	22	24	22	17	11	7	53	46
+75	T	L	H	7	0	42	0	30	0	L	L	i	0	8	0	1	4	5	b	e	b	i	83	1	13	13	14	16	19	22	24	22	18	13	9	45	53
+76	I	L	H	6	0	0	0	0	4	L	L	i	3	8	0	1	3	6	b	b	b	b	79	0	15	27	24	20	18	16	13	10	8	6	5	34	65
+77	H	L	H	6	0	36	0	20	1	L	L	i	6	8	0	1	1	8	b	e	b	i	81	0	15	18	18	19	22	23	22	18	13	9	6	18	81
+78	K	L	H	6	0	61	0	30	1	L	L	i	7	8	0	1	1	8	b	e	b	i	83	0	14	11	12	13	17	21	24	24	21	15	12	11	87
+79	R	L	H	6	0	29	0	12	1	L	L	i	8	8	0	1	0	9	b	b	b	i	79	1	15	17	18	21	22	22	20	17	12	8	6	9	90
+80	K	L	H	7	0	41	0	20	0	L	L	i	8	8	0	1	0	9	b	e	b	i	84	1	12	16	16	17	20	23	22	19	13	8	5	7	92
+81	L	L	H	7	0	0	0	0	7	L	L	i	9	9	0	0	0	9	b	b	b	b	87	0	9	36	31	21	16	11	8	6	4	2	1	4	95
+82	K	L	H	8	0	61	0	30	0	L	L	i	9	9	0	0	0	9	b	e	b	i	91	1	6	12	13	16	20	24	26	23	17	11	7	2	97
+83	A	L	H	8	0	0	0	0	5	L	L	i	9	9	0	0	0	9	b	b	b	b	90	1	5	33	28	18	15	12	11	9	7	5	4	1	98
+84	I	L	H	8	0	0	0	0	6	L	L	i	9	9	0	0	0	9	b	b	b	b	91	3	5	31	28	21	19	16	12	8	5	3	2	1	98
+85	V	L	H	7	0	0	0	0	2	L	L	i	9	8	0	0	0	9	b	b	b	b	87	4	9	23	22	19	19	18	17	16	13	9	7	1	98
+86	A	L	H	6	0	0	0	0	3	L	L	i	9	8	0	1	0	9	b	b	b	b	82	4	14	28	25	19	17	16	15	13	11	8	7	1	98
+87	G	L	H	2	0	0	0	0	2	L	L	i	9	6	0	3	0	9	b	b	b	b	60	3	33	26	23	19	17	16	15	13	11	10	9	2	97
+88	S	L	H	3	0	54	0	42	2	L	L	i	9	6	0	3	0	9	b	e	b	e	63	4	30	11	11	12	15	19	21	23	22	19	17	2	97
+89	A	L	H	1	0	31	0	30	1	L	L	i	9	5	0	4	0	9	b	e	b	i	51	7	41	11	12	15	19	22	24	23	21	17	14	2	97
+90	G	L	L	2	0	0	0	0	2	L	L	i	9	3	0	6	0	9	b	b	b	b	35	5	60	23	22	20	19	18	16	14	12	11	11	2	97
+91	N	L	L	3	0	113	0	72	2	L	L	i	9	2	0	6	0	9	b	e	b	e	28	6	64	11	11	11	14	16	18	20	22	23	22	1	98
+92	R	L	L	5	0	178	0	72	4	L	L	i	9	1	0	7	0	9	b	e	b	e	18	9	72	6	7	9	13	16	19	21	22	24	23	1	98
+93	G	L	L	5	0	35	0	42	1	L	L	i	9	1	1	7	0	9	b	e	b	e	14	14	70	13	13	13	15	18	20	21	21	20	19	1	98
+94	F	L	L	5	0	23	0	12	2	L	L	i	9	1	1	6	0	9	b	b	b	i	16	17	68	20	21	22	23	21	17	14	11	9	8	1	98
+95	I	L	L	3	0	33	0	20	0	L	L	i	9	1	2	5	0	9	b	e	b	i	18	24	58	16	16	18	20	22	22	21	18	14	11	1	98
+96	D	L	L	1	0	48	0	30	1	L	L	i	9	2	3	4	0	9	b	e	b	i	24	32	46	11	12	14	17	19	22	22	20	16	13	1	98
+97	I	L	L	0	0	0	0	0	3	L	L	i	9	2	3	3	0	9	b	b	b	b	27	36	37	26	24	21	20	19	17	14	11	8	7	1	98
+98	M	L	L	1	0	22	0	12	2	L	L	i	9	2	3	4	0	9	b	b	b	i	22	34	44	21	21	21	22	21	19	16	12	9	8	1	98
+99	D	L	L	2	0	68	0	42	2	L	L	i	9	1	3	5	0	9	b	e	b	e	12	31	58	13	13	13	15	17	20	22	22	21	20	1	98
+100	M	L	L	5	0	0	0	0	3	L	L	i	9	0	2	7	0	9	b	b	b	b	5	20	74	25	24	22	21	20	17	13	9	7	6	1	98
+101	P	L	L	5	0	0	0	0	0	L	L	i	9	0	1	7	0	9	b	b	b	b	6	17	76	20	19	19	20	20	19	18	17	16	15	1	98
+102	N	L	L	7	0	113	0	72	1	L	L	i	9	0	0	8	0	9	b	e	b	e	7	9	80	13	13	13	15	17	19	21	21	22	21	1	98
+103	T	L	L	6	0	17	0	12	1	L	L	i	9	0	1	7	0	9	b	b	b	i	9	13	76	21	21	21	22	21	19	16	13	11	10	1	98
+104	N	L	L	6	0	18	0	12	0	L	L	i	9	0	1	7	0	9	b	b	b	i	8	12	78	19	19	19	20	20	19	18	16	15	14	1	98
+105	K	L	L	3	0	86	0	42	3	L	L	i	9	1	2	5	0	9	b	e	b	e	17	24	58	9	10	12	16	20	23	24	23	20	17	1	98
+106	Y	L	L	2	0	26	0	12	1	L	L	i	9	1	3	5	0	9	b	b	b	i	14	30	55	17	19	22	24	23	20	16	12	9	8	1	98
+107	S	L	L	2	0	39	0	30	1	L	L	i	9	1	3	5	0	9	b	e	b	i	14	32	52	16	15	15	16	19	21	21	20	17	16	1	98
+108	F	L	L	3	0	0	0	0	3	L	L	i	9	1	2	6	0	9	b	b	b	b	11	27	60	23	23	23	23	20	17	13	10	8	7	1	98
+109	D	L	L	6	0	91	0	56	3	L	L	i	9	0	1	7	0	9	b	e	b	e	8	14	74	8	9	10	13	15	18	21	22	22	22	1	98
+110	G	L	L	6	0	16	0	20	0	L	L	i	9	0	1	7	0	9	b	e	b	i	9	11	79	20	19	19	20	21	20	18	16	14	12	1	98
+111	A	L	L	6	0	0	0	0	2	L	L	i	9	0	1	7	0	9	b	b	b	b	9	12	77	24	23	20	20	18	16	14	12	11	10	1	98
+112	N	L	L	6	0	0	0	0	2	L	L	i	9	0	1	8	0	9	b	b	b	b	8	12	80	23	23	22	21	20	18	15	12	9	8	1	98
+113	P	L	L	4	0	0	0	0	4	L	L	i	9	2	1	6	0	9	b	b	b	b	22	14	64	28	26	22	21	18	15	11	8	5	4	1	98
+114	V	L	L	1	0	0	0	0	5	L	L	i	9	2	2	4	0	9	b	b	b	b	22	29	48	29	27	22	20	17	13	9	6	4	3	1	98
+115	W	L	L	1	0	0	0	0	4	L	L	i	9	1	3	5	0	9	b	b	b	b	18	32	50	29	27	24	22	19	16	12	8	6	5	1	98
+116	L	L	L	4	0	0	0	0	4	L	L	i	9	1	1	6	0	9	b	b	b	b	18	18	63	30	28	23	20	17	14	10	7	5	4	1	98
+117	D	L	L	6	0	48	0	30	1	L	L	i	9	1	1	7	0	9	b	e	b	i	11	11	77	10	11	13	16	18	20	20	19	17	15	1	98
+118	P	L	L	3	0	40	0	30	1	L	L	i	9	2	0	6	0	9	b	e	b	i	29	8	64	14	14	15	17	19	20	20	19	17	16	1	98
+119	F	L	L	1	0	0	0	0	2	L	L	i	9	3	0	5	0	9	b	b	b	b	37	8	52	22	22	21	21	20	17	14	12	10	8	1	98
+120	C	L	H	0	0	0	0	0	1	L	L	i	9	4	0	4	0	9	b	b	b	b	47	7	45	21	20	20	21	20	18	16	13	11	9	1	98
+121	R	L	H	0	0	138	0	56	6	L	L	i	9	4	0	4	0	9	b	e	b	e	47	5	47	4	5	6	9	13	18	23	26	24	21	1	98
+122	N	L	H	2	0	65	0	42	1	L	L	i	9	5	0	3	0	9	b	e	b	e	58	4	38	14	14	15	18	19	21	22	20	17	14	1	98
+123	L	L	H	2	0	0	0	0	3	L	L	i	9	6	0	3	0	9	b	b	b	b	60	4	34	25	24	22	20	18	15	11	8	7	6	1	98
+124	E	L	H	2	0	108	0	56	3	L	L	i	9	5	0	3	0	9	b	e	b	e	57	6	37	10	10	11	13	16	19	22	24	22	20	1	98
+125	L	L	H	1	0	68	0	42	2	L	L	i	9	5	0	3	0	9	b	e	b	e	56	7	38	10	11	14	17	20	22	23	22	19	16	1	98
+126	A	L	L	0	0	0	0	0	1	L	L	i	9	4	0	5	0	9	b	b	b	b	44	7	51	24	22	20	19	19	18	16	14	13	11	1	98
+127	A	L	L	2	0	0	0	0	0	L	L	i	9	3	0	6	0	9	b	b	b	b	34	6	63	20	20	20	20	20	19	17	16	14	13	1	98
+128	Q	L	L	4	0	142	0	72	6	L	L	i	9	2	0	6	0	9	b	e	b	e	26	5	72	5	5	7	10	14	18	23	27	28	28	1	98
+129	A	L	L	5	0	76	0	72	3	L	L	i	9	2	0	7	0	9	b	e	b	e	23	5	73	8	9	12	16	19	20	21	21	22	22	0	99
+130	E	L	L	5	0	174	0	90	6	L	L	i	9	2	0	7	0	9	b	e	b	e	23	3	75	4	5	6	9	13	18	22	26	28	29	0	99
+131	H	L	L	4	0	132	0	72	3	L	L	i	9	2	0	7	0	9	b	e	b	e	27	3	70	8	9	12	15	18	19	20	20	22	22	0	99
+132	E	L	L	3	0	139	0	72	4	L	L	i	9	3	0	6	0	9	b	e	b	e	34	2	67	6	7	9	13	16	19	22	23	25	25	0	99
+133	D	L	L	3	0	146	0	90	7	L	L	i	9	3	0	6	0	9	b	e	b	e	33	3	65	3	4	6	9	12	16	21	26	30	31	0	99
+134	D	L	L	2	0	91	0	56	4	L	L	i	9	3	0	5	0	9	b	e	b	e	37	6	57	7	7	9	12	15	19	23	25	24	23	1	99
+135	L	L	L	1	0	3	0	2	3	L	L	i	9	4	0	5	0	9	b	b	b	b	40	4	56	21	22	22	22	20	17	13	9	6	5	0	99
+136	P	L	H	0	0	57	0	42	2	L	L	i	9	5	0	4	0	9	b	e	b	e	52	3	46	11	11	12	16	19	21	22	22	19	16	1	98
+137	E	L	H	1	0	139	0	72	9	L	L	i	9	5	0	4	0	9	b	e	b	e	52	2	40	1	1	2	4	8	15	25	34	35	34	1	99
+138	N	L	H	1	0	31	0	20	0	L	L	i	9	5	0	4	0	9	b	e	b	i	54	1	41	18	17	18	20	21	21	19	16	13	10	1	99
+139	L	L	H	5	0	0	0	0	6	L	L	i	9	7	0	2	0	9	b	b	b	b	74	1	20	30	27	23	20	17	12	8	5	3	2	1	98
+140	S	L	H	7	0	72	0	56	6	L	L	i	9	8	0	1	0	9	b	e	b	e	84	1	11	6	6	7	9	14	19	25	27	23	18	1	98
+141	E	L	H	7	0	81	0	42	4	L	L	i	9	8	0	0	0	9	b	e	b	e	86	2	9	5	6	9	14	19	25	27	24	16	9	1	98
+142	I	L	H	7	0	0	0	0	8	L	L	i	9	8	0	0	0	9	b	b	b	b	85	2	9	40	32	19	12	9	6	4	3	2	1	1	98
+143	A	L	H	6	0	0	0	0	3	L	L	i	9	8	0	1	0	9	b	b	b	b	76	2	15	24	23	21	20	19	17	14	11	7	5	1	98
+144	D	L	H	3	0	91	0	56	5	L	L	i	9	6	0	3	0	9	b	e	b	e	64	3	30	7	7	7	9	13	18	25	29	26	23	1	98
+145	L	L	H	3	0	19	0	12	1	L	L	i	9	6	0	3	0	9	b	b	b	i	64	3	31	19	19	20	21	21	19	15	11	8	7	1	98
+146	W	L	H	0	0	0	0	0	3	L	L	i	9	4	0	4	0	9	b	b	b	b	48	5	47	22	22	22	22	20	16	13	10	8	7	1	98
+147	N	L	L	5	0	87	0	56	3	L	L	i	9	2	0	7	0	9	b	e	b	e	22	4	72	8	9	10	13	16	19	22	24	23	23	1	98
+148	S	L	L	7	0	26	0	20	0	L	L	i	9	0	0	8	0	9	b	e	b	i	6	6	85	12	13	15	19	22	22	20	16	12	10	1	98
+149	P	L	L	7	0	16	0	12	1	L	L	i	9	1	0	8	0	9	b	b	b	i	10	6	80	19	20	21	22	21	19	16	14	13	12	1	98
+150	T	L	L	4	0	102	0	72	6	L	L	i	9	2	0	7	0	9	b	e	b	e	23	5	69	6	6	7	10	13	18	22	26	28	28	1	98
+151	R	L	L	3	0	74	0	30	1	L	L	i	9	2	0	6	0	9	b	e	b	i	29	6	65	11	13	16	20	23	24	22	19	16	14	1	98
+152	T	L	L	4	0	127	0	90	3	L	L	i	9	2	0	6	0	9	b	e	b	e	25	6	69	8	9	10	13	15	18	21	22	25	26	1	98
+153	H	L	L	5	0	55	0	30	2	L	L	i	9	1	1	7	0	9	b	e	b	i	18	11	68	9	11	13	17	19	21	21	20	19	17	1	98
+154	G	L	L	6	0	10	0	12	1	L	L	i	9	1	1	7	0	9	b	b	b	i	10	10	79	21	21	21	22	21	19	16	14	12	11	1	98
+155	T	L	L	5	0	59	0	42	3	L	L	i	9	1	1	7	0	9	b	e	b	e	12	16	69	9	9	11	14	17	21	24	24	22	20	1	98
+156	F	L	L	4	0	11	0	6	3	L	L	i	9	1	1	6	0	9	b	b	b	b	15	18	64	22	23	24	24	21	17	12	9	7	7	1	98
+157	G	L	L	6	0	47	0	56	2	L	L	i	9	1	0	7	0	9	b	e	b	e	12	9	78	11	11	12	14	17	19	21	22	22	22	1	98
+158	R	L	L	6	0	74	0	30	1	L	L	i	9	1	0	7	0	9	b	e	b	i	11	9	78	9	11	14	18	20	22	21	18	14	11	1	99
+159	E	L	L	6	0	81	0	42	2	L	L	i	9	1	0	8	0	9	b	e	b	e	11	7	79	10	10	12	16	18	21	22	22	20	18	1	98
+160	P	L	L	1	0	57	0	42	2	L	L	i	9	4	0	5	0	9	b	e	b	e	41	4	57	11	11	13	16	19	21	22	22	21	19	0	99
+161	A	L	L	0	0	95	0	90	5	L	L	i	9	5	0	4	0	9	b	e	b	e	56	4	43	6	6	8	11	14	17	21	24	27	28	0	99
+162	A	L	L	0	0	95	0	90	4	L	L	i	9	5	0	4	0	9	b	e	b	e	52	4	47	8	8	10	12	14	16	20	23	26	27	0	99
+163	V	L	L	4	0	127	0	90	2	L	L	i	9	2	0	6	0	9	b	e	b	e	24	6	69	10	10	11	14	16	18	18	19	22	23	0	99
+164	K	L	L	8	0	114	0	56	8	L	L	i	9	0	0	9	0	9	b	e	b	e	5	4	90	1	2	4	8	14	20	25	28	26	24	0	99
+165	P	L	L	7	0	97	0	72	5	L	L	i	9	1	0	8	0	9	b	e	b	e	12	3	83	5	5	8	11	15	19	22	24	25	25	0	99
+166	D	L	L	4	0	117	0	72	8	L	L	i	9	2	0	7	0	9	b	e	b	e	26	2	67	3	3	5	7	12	18	24	27	29	29	1	98
+167	D	L	H	5	0	48	0	30	2	L	L	i	9	7	0	2	0	9	b	e	b	i	74	0	23	9	10	13	18	22	24	24	20	15	12	1	98
+168	D	L	H	8	0	91	0	56	6	L	L	i	9	9	0	0	0	9	b	e	b	e	89	0	7	4	5	7	10	14	19	24	26	24	21	1	98
+169	R	L	H	8	0	104	0	42	6	L	L	i	9	9	0	0	0	9	b	e	b	e	91	1	5	4	5	7	11	16	21	26	26	20	15	1	98
+170	Y	L	H	8	0	0	0	0	6	L	L	i	9	9	0	0	0	9	b	b	b	b	91	2	4	31	28	23	21	18	13	8	5	2	1	1	98
+171	L	L	H	9	0	0	0	0	5	L	L	i	9	9	0	0	0	9	b	b	b	b	94	1	2	30	26	20	18	16	12	9	6	3	2	1	98
+172	R	L	H	9	0	74	0	30	1	L	L	i	9	9	0	0	0	9	b	e	b	i	94	1	2	9	11	14	21	25	27	24	16	8	3	1	98
+173	A	L	H	9	0	0	0	0	2	L	L	i	9	9	0	0	0	9	b	b	b	b	94	0	3	23	21	17	17	16	15	13	11	7	5	1	98
+174	A	L	H	9	0	0	0	0	8	L	L	i	9	9	0	0	0	9	b	b	b	b	95	0	3	39	30	16	11	9	6	4	3	2	1	1	98
+175	I	L	H	8	0	0	0	0	6	L	L	i	9	9	0	0	0	9	b	b	b	b	91	0	5	32	28	20	16	14	11	8	6	4	3	1	98
+176	Q	L	H	6	0	110	0	56	6	L	L	i	9	8	0	1	0	9	b	e	b	e	83	1	15	4	5	7	10	15	20	25	26	22	19	1	98
+177	E	L	H	4	0	81	0	42	6	L	L	i	9	7	0	2	0	9	b	e	b	e	70	1	28	4	5	8	12	17	22	26	26	23	19	1	98
+178	Y	L	L	0	0	13	0	6	4	L	L	i	9	4	0	5	0	9	b	b	b	b	45	1	53	22	22	23	22	20	15	11	7	4	3	1	98
+179	D	L	L	4	0	68	0	42	3	L	L	i	9	2	0	7	0	9	b	e	b	e	26	1	75	9	10	12	15	19	22	24	22	19	16	1	98
+180	N	L	L	2	0	65	0	42	2	L	L	i	9	3	0	5	0	9	b	e	b	e	41	1	61	11	12	13	16	20	23	24	21	16	13	1	98
+181	I	L	H	5	0	0	0	0	3	L	L	i	9	7	0	2	0	9	b	b	b	b	73	1	19	25	24	21	21	19	16	13	11	9	8	1	98
+182	A	L	H	7	0	59	0	56	4	L	L	i	9	8	0	1	0	9	b	e	b	e	85	1	11	8	8	9	12	15	19	23	24	22	19	1	98
+183	K	L	H	8	0	114	0	56	4	L	L	i	9	9	0	0	0	9	b	e	b	e	90	1	6	6	7	8	11	15	20	24	25	22	18	1	98
+184	L	L	H	7	0	0	0	0	7	L	L	i	9	8	0	1	0	9	b	b	b	b	83	2	13	36	30	21	16	13	10	7	5	3	2	1	98
+185	G	L	H	4	0	0	0	0	4	L	L	i	9	7	0	2	0	9	b	b	b	b	70	2	25	29	26	20	18	16	15	12	9	6	4	1	98
+186	Q	L	H	5	0	83	0	42	4	L	L	i	9	7	0	2	0	9	b	e	b	e	74	5	21	7	8	10	13	17	22	26	25	19	14	1	98
+187	I	L	H	6	0	0	0	0	4	L	L	i	9	7	0	1	0	9	b	b	b	b	79	9	13	28	25	22	20	18	14	9	6	4	3	1	98
+188	I	L	H	6	0	0	0	0	7	L	L	i	9	7	0	1	0	9	b	b	b	b	76	8	15	38	32	23	18	14	10	6	3	2	1	1	98
+189	R	L	H	4	0	138	0	56	5	L	L	i	9	6	0	2	0	9	b	e	b	e	68	7	26	5	6	8	11	15	20	25	27	24	21	1	98
+190	E	L	H	0	0	108	0	56	7	L	L	i	9	4	0	4	0	9	b	e	b	e	45	5	45	3	4	6	11	14	20	25	28	27	24	1	98
+191	G	L	L	6	0	16	0	20	0	L	L	i	9	1	0	8	0	9	b	e	b	i	11	4	79	12	13	16	20	22	22	20	17	15	14	2	97
+192	P	L	L	7	0	76	0	56	3	L	L	i	9	0	0	8	0	9	b	e	b	e	8	6	83	10	10	11	14	17	21	23	24	24	23	3	96
+193	I	L	L	7	0	20	0	12	3	L	L	i	9	0	1	8	0	9	b	b	b	i	6	10	81	19	22	25	26	22	16	12	9	8	8	2	97
+194	K	L	L	4	0	114	0	56	8	L	L	i	9	1	1	6	0	9	b	e	b	e	13	19	66	2	3	4	8	13	20	27	31	30	27	2	97
+195	G	L	L	3	0	0	0	0	2	L	L	i	9	1	2	5	0	9	b	b	b	b	18	22	57	23	23	22	21	19	17	14	11	9	8	2	97
+196	S	L	E	0	0	26	0	20	0	L	L	i	9	2	4	3	0	9	b	e	b	i	27	40	33	15	16	17	20	22	22	20	15	11	8	3	96
+197	L	L	E	1	0	0	0	0	4	L	L	i	9	3	4	1	0	9	b	b	b	b	37	47	20	30	27	22	19	17	14	11	8	5	4	4	95
+198	L	L	E	0	0	0	0	0	4	L	L	i	9	3	4	2	0	9	b	b	b	b	40	41	21	27	25	22	21	19	16	12	8	5	4	3	96
+199	K	L	H	1	0	86	0	42	1	L	L	i	9	4	3	2	0	9	b	e	b	e	45	35	22	13	13	13	16	18	20	21	19	16	13	3	96
+200	V	L	H	1	0	0	0	0	4	L	L	i	9	4	3	1	0	9	b	b	b	b	48	30	19	28	25	21	19	17	15	12	9	6	5	4	95
+201	V	L	H	3	0	0	0	0	6	L	L	i	8	5	1	2	0	9	b	b	b	b	57	19	21	32	27	21	18	16	12	9	6	3	2	6	93
+202	L	L	H	4	0	0	0	0	4	L	L	i	8	6	1	2	0	9	b	b	b	b	62	13	21	30	26	20	17	15	14	11	9	6	5	6	93
+203	E	L	H	3	0	81	0	42	3	L	L	i	8	6	0	2	0	9	b	e	b	e	63	6	24	8	9	11	14	17	20	22	21	18	16	5	94
+204	D	L	H	3	0	48	0	30	2	L	L	i	9	6	0	2	0	9	b	e	b	i	66	5	27	9	10	12	16	20	23	23	20	16	13	4	95
+205	Y	L	H	4	0	0	0	0	3	L	L	i	9	7	0	2	0	9	b	b	b	b	69	4	24	26	24	21	20	19	15	12	9	7	5	3	96
+206	L	L	H	3	0	0	0	0	4	L	L	i	9	6	0	2	0	9	b	b	b	b	65	5	27	25	24	22	20	17	14	10	8	5	4	2	97
+207	R	L	H	4	0	104	0	42	1	L	L	i	9	7	0	2	0	9	b	e	b	e	71	3	25	11	11	13	17	21	24	25	20	14	10	2	97
+208	L	L	H	5	0	0	0	0	4	L	L	i	9	7	0	2	0	9	b	b	b	b	71	1	21	29	26	22	19	17	14	10	8	6	5	1	98
+209	K	L	H	6	0	61	0	30	2	L	L	i	9	8	0	1	0	9	b	e	b	i	79	2	13	8	9	10	15	19	23	23	20	14	10	1	98
+210	K	L	H	7	0	86	0	42	3	L	L	i	9	8	0	1	0	9	b	e	b	e	82	2	11	8	9	10	13	17	21	24	24	21	19	1	98
+211	L	L	H	7	0	19	0	12	2	L	L	i	9	8	0	1	0	9	b	b	b	i	84	2	12	20	21	22	23	22	20	16	12	8	6	1	98
+212	F	L	H	7	0	0	0	0	4	L	L	i	9	8	0	1	0	9	b	b	b	b	86	3	11	29	25	20	18	16	13	10	7	5	3	1	98
+213	A	L	H	7	0	0	0	0	3	L	L	i	9	8	0	1	0	9	b	b	b	b	83	3	13	25	23	18	17	16	15	13	11	8	6	1	98
+214	Q	L	H	7	0	59	0	30	1	L	L	i	9	8	0	1	0	9	b	e	b	i	85	4	11	11	12	14	18	21	24	24	22	16	12	1	98
+215	R	L	H	6	0	49	0	20	0	L	L	i	9	7	0	1	0	9	b	e	b	i	79	5	16	14	16	20	23	24	23	20	16	12	9	1	98
+216	M	L	H	5	0	0	0	0	3	L	L	i	9	7	0	1	0	9	b	b	b	b	75	5	19	27	24	20	19	17	15	12	10	8	7	1	98
+217	V	L	H	1	0	0	0	0	3	L	L	i	9	5	0	3	0	9	b	b	b	b	54	6	39	26	24	21	20	17	14	11	9	8	7	1	98
+218	Q	L	H	0	0	83	0	42	3	L	L	i	9	4	0	4	0	9	b	e	b	e	48	5	45	8	9	10	13	17	21	24	24	22	20	1	98
+219	K	L	H	0	0	114	0	56	7	L	L	i	9	4	0	4	0	9	b	e	b	e	47	6	46	2	3	5	10	15	21	26	29	28	26	1	98
+220	A	L	L	0	0	59	0	56	2	L	L	i	9	4	0	4	0	9	b	e	b	e	44	8	46	10	11	12	14	17	19	20	21	21	20	1	98
+221	S	L	L	3	0	39	0	30	1	L	L	i	9	2	0	6	0	9	b	e	b	i	29	9	61	11	13	16	19	21	22	22	20	18	17	1	98
+222	S	L	L	4	0	72	0	56	2	L	L	i	9	2	1	6	0	9	b	e	b	e	25	11	65	12	12	12	14	16	19	21	23	23	22	1	98
+223	C	L	L	5	0	16	0	12	0	L	L	i	9	1	0	7	0	9	b	b	b	i	18	9	71	16	17	20	22	22	20	17	14	12	11	1	98
+224	H	L	L	6	0	22	0	12	0	L	L	i	9	1	0	7	0	9	b	b	b	i	13	9	77	17	18	19	20	20	20	18	16	13	11	1	98
+225	S	L	L	4	0	0	0	0	2	L	L	i	9	2	0	7	0	9	b	b	b	b	23	7	71	21	21	20	20	19	17	15	12	10	9	1	98
+226	S	L	L	2	0	39	0	30	0	L	L	i	9	3	0	6	0	9	b	e	b	i	34	5	61	15	14	14	17	20	22	21	18	14	12	1	98
+227	I	L	H	4	0	0	0	0	3	L	L	i	9	7	0	2	0	9	b	b	b	b	70	2	25	25	23	20	20	18	16	13	10	7	6	1	98
+228	S	L	H	5	0	54	0	42	1	L	L	i	9	7	0	1	0	9	b	e	b	e	77	2	18	13	13	13	16	18	21	22	21	17	14	1	98
+229	E	L	H	7	0	108	0	56	6	L	L	i	9	9	0	0	0	9	b	e	b	e	87	1	8	4	4	6	9	13	18	24	28	25	22	1	98
+230	L	L	H	7	0	32	0	20	0	L	L	i	9	8	0	0	0	9	b	e	b	i	83	3	9	16	16	19	22	24	23	19	13	9	6	1	98
+231	I	L	H	5	0	0	0	0	7	L	L	i	9	7	0	1	0	9	b	b	b	b	73	6	14	36	30	21	16	13	9	7	5	3	2	0	99
+232	H	L	H	4	0	55	0	30	1	L	L	i	9	6	0	2	0	9	b	e	b	i	65	5	24	10	11	14	18	21	23	23	20	15	11	0	99
+233	T	L	H	2	0	79	0	56	6	L	L	i	9	5	0	3	0	9	b	e	b	e	55	6	33	4	5	7	10	14	18	23	26	24	22	1	98
+234	D	L	H	2	0	68	0	42	3	L	L	i	9	6	0	3	0	9	b	e	b	e	59	5	33	6	8	12	17	21	23	24	20	15	10	1	98
+235	L	L	H	2	0	0	0	0	6	L	L	i	9	6	0	3	0	9	b	b	b	b	61	3	36	29	29	27	23	18	12	8	5	4	3	0	99
+236	E	L	H	1	0	108	0	56	8	L	L	i	9	5	0	4	0	9	b	e	b	e	53	5	39	2	3	5	8	13	19	27	30	28	24	0	99
+237	E	L	L	1	0	139	0	72	7	L	L	i	9	4	0	5	0	9	b	e	b	e	39	5	52	2	3	5	8	11	16	22	27	28	28	1	99
+238	E	L	L	6	0	81	0	42	3	L	L	i	9	1	0	7	0	9	b	e	b	e	18	3	78	6	7	11	16	21	24	25	22	18	15	1	98
+239	P	L	L	6	0	57	0	42	3	L	L	i	9	1	0	8	0	9	b	e	b	e	18	2	82	8	9	11	14	18	21	23	23	23	22	0	99
+240	G	L	L	6	0	75	0	90	6	L	L	i	9	1	0	8	0	9	b	e	b	e	16	3	81	5	5	7	10	13	16	21	25	29	30	0	99
+241	D	L	L	5	0	117	0	72	6	L	L	i	9	1	0	7	0	9	b	e	b	e	18	8	73	4	5	7	10	13	17	22	26	28	28	0	99
+242	H	L	L	6	0	55	0	30	2	L	L	i	9	1	0	8	0	9	b	e	b	i	11	8	80	8	10	14	18	21	22	21	19	18	16	0	99
+243	S	L	L	7	0	93	0	72	3	L	L	i	9	0	0	8	0	9	b	e	b	e	8	6	85	9	9	11	14	17	20	22	23	24	24	0	99
+244	P	L	L	8	0	122	0	90	3	L	L	i	9	0	0	9	0	9	b	e	b	e	6	4	90	9	9	10	13	15	17	19	20	26	28	0	99
+245	G	L	L	8	0	75	0	90	3	L	L	i	9	0	0	9	0	9	b	e	b	e	3	6	89	9	9	10	12	14	16	18	20	25	27	0	99
+246	Q	L	L	5	0	83	0	42	3	L	L	i	9	0	1	7	0	9	b	e	b	e	5	18	77	7	8	11	15	18	21	23	23	21	19	0	99
+247	G	L	L	3	0	0	0	0	2	L	L	i	9	0	3	6	0	9	b	b	b	b	5	34	65	25	24	22	21	19	17	14	12	11	10	0	99
+248	S	L	L	0	0	39	0	30	0	L	L	i	9	0	4	4	0	9	b	e	b	i	6	47	49	16	17	17	20	21	22	20	17	13	10	1	98
+249	L	L	E	0	0	0	0	0	3	L	L	i	9	1	4	4	0	9	b	b	b	b	10	49	40	23	23	22	22	20	17	14	10	8	6	1	98
+250	R	L	E	2	0	29	0	12	2	L	L	i	9	0	5	3	0	9	b	b	b	i	9	56	35	20	21	22	24	23	21	16	11	6	4	1	98
+251	F	L	E	2	0	0	0	0	6	L	L	i	9	0	6	3	0	9	b	b	b	b	6	59	33	34	31	24	20	15	11	7	5	4	3	1	98
+252	R	L	E	1	0	74	0	30	0	L	L	i	9	0	5	3	0	9	b	e	b	i	6	55	39	13	14	17	21	23	24	21	16	11	8	1	98
+253	H	L	E	0	0	36	0	20	0	L	L	i	9	0	5	4	0	9	b	e	b	i	5	52	46	15	16	17	20	22	22	21	19	16	14	1	98
+254	K	L	L	5	0	147	0	72	5	L	L	i	9	0	2	7	0	9	b	e	b	e	3	21	77	6	7	8	11	15	19	22	24	25	25	0	99
+255	P	L	L	8	0	40	0	30	1	L	L	i	9	0	0	9	0	9	b	e	b	i	2	7	91	13	14	16	19	21	22	21	19	17	15	1	99
+256	P	L	L	6	0	57	0	42	2	L	L	i	9	0	1	8	0	9	b	e	b	e	3	14	83	10	11	12	15	18	21	23	22	19	17	0	99
+257	M	L	E	1	0	0	0	0	4	L	L	i	9	0	5	4	0	9	b	b	b	b	3	58	42	25	25	25	24	20	15	11	8	6	5	1	99
+258	E	L	E	5	0	81	0	42	4	L	L	i	9	0	7	2	0	9	b	e	b	e	5	76	22	6	7	9	14	18	23	26	26	21	17	1	98
+259	L	L	E	3	0	0	0	0	6	L	L	i	9	0	6	3	0	9	b	b	b	b	3	66	34	32	29	24	20	17	13	8	5	3	3	0	99
+260	K	L	E	0	0	114	0	56	6	L	L	i	9	0	4	4	0	9	b	e	b	e	4	52	49	4	5	6	10	15	20	25	26	23	21	1	99
+261	G	L	L	5	0	0	0	0	1	L	L	i	9	0	1	7	0	9	b	b	b	b	3	19	77	23	22	21	20	19	17	15	13	12	12	0	99
+262	Q	L	L	7	0	83	0	42	3	L	L	i	9	0	0	8	0	9	b	e	b	e	4	8	84	8	9	10	14	17	21	22	22	21	19	1	98
+263	D	L	L	7	0	68	0	42	1	L	L	i	9	0	0	8	0	9	b	e	b	e	4	9	84	12	13	14	17	19	21	22	21	19	17	1	98
+264	G	L	L	3	0	0	0	0	3	L	L	i	9	0	3	6	0	9	b	b	b	b	6	31	62	27	25	22	20	18	16	13	10	7	6	1	98
+265	I	L	E	3	0	0	0	0	3	L	L	i	9	0	6	2	0	9	b	b	b	b	7	62	29	24	23	21	20	18	16	13	10	7	5	1	98
+266	H	L	E	5	0	0	0	0	3	L	L	i	9	0	7	2	0	9	b	b	b	b	7	70	20	25	24	22	21	19	17	13	10	6	4	1	98
+267	M	L	E	4	0	0	0	0	7	L	L	i	9	1	6	2	0	9	b	b	b	b	10	65	23	36	30	21	16	12	9	6	4	3	2	1	98
+268	V	L	E	3	0	0	0	0	6	L	L	i	9	0	6	2	0	9	b	b	b	b	7	66	27	33	29	21	17	14	11	7	5	3	2	1	98
+269	H	L	E	0	0	0	0	0	4	L	L	i	9	0	5	4	0	9	b	b	b	b	7	52	44	27	26	24	23	19	16	11	7	4	2	1	98
+270	G	L	L	4	0	0	0	0	3	L	L	i	9	0	2	6	0	9	b	b	b	b	10	23	68	27	25	20	19	17	15	13	10	8	7	1	98
+271	S	L	L	5	0	0	0	0	6	L	L	i	9	1	1	7	0	9	b	b	b	b	18	11	70	31	28	22	19	16	13	9	6	3	2	1	98
+272	T	L	H	1	0	0	0	0	3	L	L	i	9	5	0	3	0	9	b	b	b	b	53	8	40	26	25	21	20	18	16	13	10	8	6	1	98
+273	G	L	H	4	0	0	0	0	6	L	L	i	9	7	0	2	0	9	b	b	b	b	70	4	24	33	29	19	17	14	12	9	6	4	3	2	97
+274	T	L	H	6	0	0	0	0	5	L	L	i	9	7	0	1	0	9	b	b	b	b	79	6	15	30	26	19	18	15	13	9	6	4	3	2	97
+275	L	L	H	7	0	0	0	0	5	L	L	i	9	8	0	1	0	9	b	b	b	b	81	6	10	33	28	21	18	16	13	10	7	5	4	1	98
+276	L	L	H	5	0	0	0	0	3	L	L	i	9	7	1	1	0	9	b	b	b	b	69	10	18	27	24	21	20	18	16	12	9	6	4	1	98
+277	A	L	H	3	0	0	0	0	6	L	L	i	9	6	0	2	0	9	b	b	b	b	59	9	27	33	28	19	15	12	9	7	5	4	3	1	98
+278	T	L	H	0	0	42	0	30	0	L	L	i	9	4	0	4	0	9	b	e	b	i	45	7	43	15	15	16	19	22	23	21	18	13	10	1	98
+279	D	L	L	2	0	68	0	42	5	L	L	i	9	3	0	6	0	9	b	e	b	e	36	4	63	4	5	8	13	18	24	27	26	21	16	1	98
+280	L	L	L	1	0	3	0	2	3	L	L	i	9	4	0	5	0	9	b	b	b	b	44	3	55	22	23	23	22	20	16	13	9	8	7	1	98
+281	N	L	L	4	0	113	0	72	5	L	L	i	9	2	0	6	0	9	b	e	b	e	30	3	71	6	6	7	10	14	17	21	24	27	27	1	98
+282	S	L	L	4	0	93	0	72	4	L	L	i	9	2	0	7	0	9	b	e	b	e	25	4	73	8	8	9	12	15	18	21	23	24	24	1	98
+283	L	L	L	8	0	9	0	6	4	L	L	i	9	0	0	9	0	9	b	b	b	b	5	2	92	20	23	26	26	22	16	10	7	5	5	1	98
+284	P	L	L	8	0	40	0	30	1	L	L	i	9	0	0	8	0	9	b	e	b	i	9	1	89	11	12	13	17	21	24	24	20	13	9	1	98
+285	E	L	H	3	0	108	0	56	6	L	L	i	9	6	0	3	0	9	b	e	b	e	65	0	32	5	5	7	10	14	18	22	24	23	22	1	98
+286	D	L	H	4	0	91	0	56	3	L	L	i	9	7	0	2	0	9	b	e	b	e	68	0	28	7	8	10	13	15	18	20	21	20	18	1	98
+287	D	L	H	4	0	32	0	20	1	L	L	i	9	7	0	2	0	9	b	e	b	i	73	0	26	20	20	19	20	21	21	18	13	9	7	1	98
+288	Q	L	H	6	0	0	0	0	3	L	L	i	9	8	0	1	0	9	b	b	b	b	81	1	13	25	24	21	20	18	15	12	9	6	5	1	98
+289	K	L	H	7	0	86	0	42	7	L	L	i	9	8	0	1	0	9	b	e	b	e	83	2	11	3	3	5	9	14	21	27	27	20	14	0	99
+290	G	L	H	7	0	0	0	0	2	L	L	i	9	8	0	0	0	9	b	b	b	b	85	2	9	27	24	19	17	17	16	15	12	9	7	0	99
+291	L	L	H	8	0	0	0	0	6	L	L	i	9	9	0	0	0	9	b	b	b	b	92	0	5	33	29	21	18	15	11	7	5	3	2	0	99
+292	D	L	H	8	0	48	0	30	0	L	L	i	9	9	0	0	0	9	b	e	b	i	92	1	6	14	14	15	18	21	24	23	19	14	10	0	99
+293	R	L	H	7	0	29	0	12	1	L	L	i	9	8	0	1	0	9	b	b	b	i	84	1	10	16	17	20	22	22	21	17	12	7	5	0	99
+294	S	L	H	7	0	0	0	0	6	L	L	i	9	8	0	1	0	9	b	b	b	b	87	1	10	31	27	20	17	15	12	9	6	3	2	0	99
+295	L	L	H	9	0	0	0	0	7	L	L	i	9	9	0	0	0	9	b	b	b	b	94	0	3	32	28	21	18	14	11	7	4	2	1	1	98
+296	E	L	H	9	0	108	0	56	7	L	L	i	9	9	0	0	0	9	b	e	b	e	94	0	4	4	4	6	8	13	20	26	29	25	21	1	98
+297	T	L	H	8	0	59	0	42	1	L	L	i	9	9	0	0	0	9	b	e	b	e	90	0	6	13	13	13	16	18	21	22	22	18	15	1	98
+298	L	L	H	6	0	0	0	0	6	L	L	i	9	8	0	1	0	9	b	b	b	b	77	0	15	32	29	24	20	16	12	8	5	4	3	1	98
+299	T	L	H	4	0	59	0	42	2	L	L	i	9	7	0	2	0	9	b	e	b	e	70	1	26	12	12	13	15	19	22	24	22	18	15	1	98
+300	A	L	H	4	0	76	0	72	2	L	L	i	9	7	0	2	0	9	b	e	b	e	70	1	26	11	11	11	12	14	17	19	21	22	21	1	98
+301	S	L	L	0	0	54	0	42	2	L	L	i	9	4	0	5	0	9	b	e	b	e	44	2	51	10	11	13	17	20	23	24	21	18	15	1	98
+302	E	L	H	2	0	108	0	56	3	L	L	i	9	5	0	3	0	9	b	e	b	e	58	2	38	11	11	10	12	15	19	22	24	23	21	1	98
+303	A	L	H	1	0	12	0	12	1	L	L	i	9	5	0	4	0	9	b	b	b	i	52	1	42	21	21	21	22	20	18	15	13	11	10	1	98
+304	T	L	H	5	0	59	0	42	1	L	L	i	9	7	0	2	0	9	b	e	b	e	72	4	20	14	14	15	18	21	23	24	21	15	11	1	98
+305	A	L	H	7	0	0	0	0	1	L	L	i	9	8	0	0	0	9	b	b	b	b	85	3	9	24	22	19	19	19	19	17	14	10	7	1	98
+306	F	L	H	8	0	0	0	0	3	L	L	i	9	9	0	0	0	9	b	b	b	b	87	3	6	26	24	20	18	17	15	12	10	8	7	1	98
+307	E	L	H	6	0	81	0	42	3	L	L	i	9	8	0	1	0	9	b	e	b	e	79	4	10	9	9	10	14	17	22	25	24	19	14	1	98
+308	R	L	H	5	0	74	0	30	1	L	L	i	9	7	0	1	0	9	b	e	b	i	70	6	17	11	12	14	19	23	24	23	19	14	10	1	98
+309	N	L	H	3	0	65	0	42	2	L	L	i	9	6	0	3	0	9	b	e	b	e	61	4	29	10	11	13	16	19	21	22	22	20	19	1	98
+310	A	L	H	0	0	59	0	56	3	L	L	i	9	5	0	4	0	9	b	e	b	e	50	4	46	7	8	11	14	17	19	21	22	22	21	1	98
+311	R	L	L	2	0	104	0	42	6	L	L	i	9	3	0	6	0	9	b	e	b	e	32	6	60	3	4	7	12	17	21	26	26	25	22	1	98
+312	T	L	L	3	0	42	0	30	1	L	L	i	9	2	0	6	0	9	b	e	b	i	28	8	65	12	13	15	19	21	22	21	20	17	15	1	98
+313	E	L	L	3	0	139	0	72	6	L	L	i	9	3	0	6	0	9	b	e	b	e	32	9	62	4	4	7	10	13	17	21	25	28	28	1	98
+314	S	L	L	4	0	93	0	72	5	L	L	i	9	2	0	6	0	9	b	e	b	e	25	7	71	7	7	8	11	14	19	23	26	28	28	1	98
+315	A	L	L	5	0	0	0	0	2	L	L	i	9	1	0	7	0	9	b	b	b	b	18	8	74	25	24	22	22	20	17	14	12	11	11	1	98
+316	K	L	L	6	0	147	0	72	6	L	L	i	9	1	1	7	0	9	b	e	b	e	13	11	75	5	6	7	10	14	19	24	27	28	27	1	98
+317	S	L	L	6	0	15	0	12	0	L	L	i	9	1	1	7	0	9	b	b	b	i	10	10	78	19	19	19	21	20	19	17	15	14	13	1	98
+318	T	L	L	7	0	42	0	30	0	L	L	i	9	0	1	8	0	9	b	e	b	i	9	10	81	16	16	17	20	21	22	20	17	15	13	1	98
+319	P	L	L	5	0	97	0	72	1	L	L	i	9	1	0	7	0	9	b	e	b	e	17	8	74	16	15	15	17	19	20	20	20	21	20	1	98
+320	L	L	L	4	0	19	0	12	0	L	L	i	9	2	0	6	0	9	b	b	b	i	26	8	67	19	19	19	21	21	21	18	15	12	11	1	98
+321	H	L	L	5	0	22	0	12	2	L	L	i	9	1	1	7	0	9	b	b	b	i	18	11	69	22	22	23	24	22	19	15	12	9	8	1	98
+322	K	L	L	3	0	114	0	56	6	L	L	i	9	2	1	5	0	9	b	e	b	e	27	15	60	5	6	7	10	14	20	25	27	26	25	1	98
+323	L	L	L	4	0	19	0	12	0	L	L	i	9	2	1	6	0	9	b	b	b	i	22	10	67	17	18	20	21	21	20	17	15	14	13	1	98
+324	R	L	L	4	0	104	0	42	3	L	L	i	9	2	1	6	0	9	b	e	b	e	24	11	66	7	8	12	15	19	21	22	21	19	17	1	98
+325	D	L	L	5	0	68	0	42	2	L	L	i	9	1	1	6	0	9	b	e	b	e	17	14	68	10	10	12	15	17	19	21	21	21	20	1	98
+326	V	L	L	1	0	42	0	30	0	L	L	i	9	1	3	5	0	9	b	e	b	i	15	34	49	13	14	15	19	21	22	20	17	13	11	1	98
+327	I	L	L	0	0	0	0	0	2	L	L	i	9	1	4	3	0	9	b	b	b	b	12	46	38	23	22	22	21	20	18	15	12	10	8	1	98
+328	M	L	L	0	0	37	0	20	0	L	L	i	9	1	3	4	0	9	b	e	b	i	13	40	48	17	17	18	20	22	22	19	16	13	10	1	98
+329	E	L	L	2	0	58	0	30	1	L	L	i	9	1	2	5	0	9	b	e	b	i	18	30	54	11	12	14	16	18	19	19	19	19	18	1	98
+330	S	L	L	6	0	0	0	0	3	L	L	i	9	0	1	7	0	9	b	b	b	b	7	15	79	24	24	23	23	21	18	14	10	6	4	0	99
+331	P	L	L	5	0	0	0	0	1	L	L	i	9	1	0	7	0	9	b	b	b	b	18	9	70	23	21	19	20	20	20	18	16	13	11	1	98
+332	L	L	L	1	0	0	0	0	2	L	L	i	9	3	1	4	0	9	b	b	b	b	30	18	44	23	23	22	22	20	18	15	13	12	11	1	98
+333	E	L	L	0	0	58	0	30	1	L	L	i	9	3	2	3	0	9	b	e	b	i	29	26	35	12	13	14	17	19	21	21	20	18	16	1	98
+334	I	L	L	1	0	0	0	0	3	L	L	i	9	2	2	4	0	9	b	b	b	b	28	24	43	29	26	22	20	19	16	14	11	9	8	1	98
+335	T	L	L	3	0	0	0	0	0	L	L	i	9	1	2	5	0	9	b	b	b	b	17	25	56	20	19	19	19	20	20	19	18	16	15	1	98
+336	E	L	L	4	0	174	0	90	7	L	L	i	9	1	2	6	0	9	b	e	b	e	12	21	66	4	4	6	8	12	16	21	24	27	28	1	98
+337	L	L	L	9	0	147	0	90	2	L	L	i	9	0	0	9	0	9	b	e	b	e	2	3	94	10	10	11	13	15	15	16	16	19	20	1	98

Added: trunk/packages/norsnet/trunk/debian/example/cad23.f
===================================================================
--- trunk/packages/norsnet/trunk/debian/example/cad23.f	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/example/cad23.f	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,7 @@
+>cad23-cyt
+DYKDHDGDYKDHDIDYKDDDDKLAAANSNVLDVQPAISVQLPDDMSALQMAIIVLAILLF
+LAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKYSFDGANPVWLDPFC
+RNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAVKPDDDRYLRAAIQEYDN
+IAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQRMVQKASSCHSSISELIHTDLEEEPG
+DHSPGQGSLRFRHKPPMELKGQDGIHMVHGSTGTLLATDLNSLPEDDQKGLDRSLETLTA
+SEATAFERNARTESAKSTPLHKLRDVIMESPLEITEL

Added: trunk/packages/norsnet/trunk/debian/example/cad23.norsnet
===================================================================
--- trunk/packages/norsnet/trunk/debian/example/cad23.norsnet	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/example/cad23.norsnet	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,338 @@
+pos	res	node1	node2	pred	n40	n40fil	n59	n59fil
+1	D	48	51	0.48	N	-	-	-
+2	Y	31	68	0.31	-	-	-	-
+3	K	20	79	0.20	-	-	-	-
+4	D	35	64	0.35	-	-	-	-
+5	H	31	68	0.31	-	-	-	-
+6	D	24	74	0.24	-	-	-	-
+7	G	58	41	0.59	N	-	-	-
+8	D	58	42	0.58	N	-	-	-
+9	Y	49	50	0.49	N	-	-	-
+10	K	35	64	0.35	-	-	-	-
+11	D	38	61	0.38	-	-	-	-
+12	H	29	70	0.29	-	-	-	-
+13	D	25	74	0.25	-	-	-	-
+14	I	25	73	0.26	-	-	-	-
+15	D	24	76	0.24	-	-	-	-
+16	Y	28	71	0.28	-	-	-	-
+17	K	28	72	0.28	-	-	-	-
+18	D	24	75	0.24	-	-	-	-
+19	D	25	74	0.25	-	-	-	-
+20	D	29	70	0.29	-	-	-	-
+21	D	27	72	0.27	-	-	-	-
+22	K	26	73	0.26	-	-	-	-
+23	L	29	70	0.29	-	-	-	-
+24	A	29	70	0.29	-	-	-	-
+25	A	38	61	0.38	-	-	-	-
+26	A	33	66	0.33	-	-	-	-
+27	N	32	68	0.32	-	-	-	-
+28	S	22	76	0.22	-	-	-	-
+29	N	14	85	0.14	-	-	-	-
+30	V	17	82	0.17	-	-	-	-
+31	L	18	81	0.18	-	-	-	-
+32	D	11	88	0.11	-	-	-	-
+33	V	13	86	0.13	-	-	-	-
+34	Q	24	75	0.24	-	-	-	-
+35	P	36	63	0.36	-	-	-	-
+36	A	40	59	0.40	N	-	-	-
+37	I	40	59	0.40	N	-	-	-
+38	S	38	61	0.38	-	-	-	-
+39	V	48	51	0.48	N	-	-	-
+40	Q	58	42	0.58	N	-	-	-
+41	L	51	48	0.52	N	-	-	-
+42	P	45	54	0.45	N	-	-	-
+43	D	31	68	0.31	-	-	-	-
+44	D	27	72	0.27	-	-	-	-
+45	M	23	76	0.23	-	-	-	-
+46	S	19	80	0.19	-	-	-	-
+47	A	20	79	0.20	-	-	-	-
+48	L	16	83	0.16	-	-	-	-
+49	Q	13	86	0.13	-	-	-	-
+50	M	16	84	0.16	-	-	-	-
+51	A	14	85	0.14	-	-	-	-
+52	I	13	86	0.13	-	-	-	-
+53	I	8	91	0.08	-	-	-	-
+54	V	6	93	0.06	-	-	-	-
+55	L	4	95	0.04	-	-	-	-
+56	A	2	97	0.02	-	-	-	-
+57	I	2	97	0.02	-	-	-	-
+58	L	2	97	0.02	-	-	-	-
+59	L	3	96	0.03	-	-	-	-
+60	F	5	94	0.05	-	-	-	-
+61	L	5	94	0.05	-	-	-	-
+62	A	5	94	0.05	-	-	-	-
+63	A	6	94	0.06	-	-	-	-
+64	M	5	94	0.05	-	-	-	-
+65	L	5	94	0.05	-	-	-	-
+66	F	6	93	0.06	-	-	-	-
+67	V	5	94	0.05	-	-	-	-
+68	L	4	95	0.04	-	-	-	-
+69	M	4	95	0.04	-	-	-	-
+70	N	4	95	0.04	-	-	-	-
+71	W	4	95	0.04	-	-	-	-
+72	Y	5	94	0.05	-	-	-	-
+73	Y	6	93	0.06	-	-	-	-
+74	R	5	94	0.05	-	-	-	-
+75	T	5	94	0.05	-	-	-	-
+76	I	5	94	0.05	-	-	-	-
+77	H	7	92	0.07	-	-	-	-
+78	K	8	91	0.08	-	-	-	-
+79	R	9	90	0.09	-	-	-	-
+80	K	15	85	0.15	-	-	-	-
+81	L	16	84	0.16	-	-	-	-
+82	K	15	84	0.15	-	-	-	-
+83	A	20	79	0.20	-	-	-	-
+84	I	24	75	0.24	-	-	-	-
+85	V	27	73	0.27	-	-	-	-
+86	A	32	68	0.32	-	-	-	-
+87	G	28	71	0.28	-	-	-	-
+88	S	32	68	0.32	-	-	-	-
+89	A	29	70	0.29	-	-	-	-
+90	G	28	71	0.28	-	-	-	-
+91	N	32	67	0.32	-	-	-	-
+92	R	36	63	0.36	-	-	-	-
+93	G	42	57	0.42	N	-	-	-
+94	F	45	54	0.45	N	-	-	-
+95	I	52	47	0.53	N	-	-	-
+96	D	46	52	0.47	N	-	-	-
+97	I	57	42	0.58	N	-	-	-
+98	M	47	53	0.47	N	-	-	-
+99	D	38	61	0.38	-	-	-	-
+100	M	46	53	0.46	N	-	-	-
+101	P	41	59	0.41	N	-	-	-
+102	N	47	53	0.47	N	-	-	-
+103	T	45	54	0.45	N	-	-	-
+104	N	44	55	0.44	N	-	-	-
+105	K	55	44	0.56	N	-	-	-
+106	Y	56	43	0.57	N	-	-	-
+107	S	46	53	0.46	N	-	-	-
+108	F	52	47	0.53	N	-	-	-
+109	D	54	45	0.55	N	-	-	-
+110	G	57	42	0.58	N	-	-	-
+111	A	52	47	0.53	N	-	-	-
+112	N	52	47	0.53	N	-	-	-
+113	P	55	44	0.56	N	-	-	-
+114	V	57	42	0.58	N	-	-	-
+115	W	61	38	0.62	N	-	N	-
+116	L	34	65	0.34	-	-	-	-
+117	D	27	72	0.27	-	-	-	-
+118	P	19	80	0.19	-	-	-	-
+119	F	22	77	0.22	-	-	-	-
+120	C	16	83	0.16	-	-	-	-
+121	R	24	75	0.24	-	-	-	-
+122	N	39	60	0.39	-	-	-	-
+123	L	49	51	0.49	N	-	-	-
+124	E	45	55	0.45	N	-	-	-
+125	L	41	58	0.41	N	-	-	-
+126	A	45	54	0.45	N	-	-	-
+127	A	40	59	0.40	N	-	-	-
+128	Q	41	58	0.41	N	-	-	-
+129	A	43	56	0.43	N	-	-	-
+130	E	44	55	0.44	N	-	-	-
+131	H	49	50	0.49	N	-	-	-
+132	E	34	65	0.34	-	-	-	-
+133	D	32	67	0.32	-	-	-	-
+134	D	34	65	0.34	-	-	-	-
+135	L	32	67	0.32	-	-	-	-
+136	P	32	68	0.32	-	-	-	-
+137	E	29	70	0.29	-	-	-	-
+138	N	33	66	0.33	-	-	-	-
+139	L	30	70	0.30	-	-	-	-
+140	S	35	64	0.35	-	-	-	-
+141	E	43	56	0.43	N	-	-	-
+142	I	38	61	0.38	-	-	-	-
+143	A	32	68	0.32	-	-	-	-
+144	D	32	67	0.32	-	-	-	-
+145	L	36	64	0.36	-	-	-	-
+146	W	33	66	0.33	-	-	-	-
+147	N	30	69	0.30	-	-	-	-
+148	S	29	70	0.29	-	-	-	-
+149	P	37	62	0.37	-	-	-	-
+150	T	52	47	0.53	N	-	-	-
+151	R	63	36	0.64	N	-	N	-
+152	T	67	33	0.67	N	-	N	-
+153	H	63	36	0.64	N	-	N	-
+154	G	65	35	0.65	N	-	N	-
+155	T	64	34	0.65	N	-	N	-
+156	F	75	25	0.75	N	-	N	-
+157	G	66	33	0.67	N	-	N	-
+158	R	59	40	0.60	N	-	N	-
+159	E	55	44	0.56	N	-	-	-
+160	P	44	54	0.45	N	-	-	-
+161	A	45	54	0.45	N	-	-	-
+162	A	37	62	0.37	-	-	-	-
+163	V	34	66	0.34	-	-	-	-
+164	K	27	72	0.27	-	-	-	-
+165	P	27	72	0.27	-	-	-	-
+166	D	20	79	0.20	-	-	-	-
+167	D	13	86	0.13	-	-	-	-
+168	D	10	89	0.10	-	-	-	-
+169	R	15	84	0.15	-	-	-	-
+170	Y	21	78	0.21	-	-	-	-
+171	L	25	74	0.25	-	-	-	-
+172	R	26	74	0.26	-	-	-	-
+173	A	15	84	0.15	-	-	-	-
+174	A	7	92	0.07	-	-	-	-
+175	I	10	89	0.10	-	-	-	-
+176	Q	10	89	0.10	-	-	-	-
+177	E	11	88	0.11	-	-	-	-
+178	Y	17	82	0.17	-	-	-	-
+179	D	12	87	0.12	-	-	-	-
+180	N	9	90	0.09	-	-	-	-
+181	I	10	89	0.10	-	-	-	-
+182	A	15	84	0.15	-	-	-	-
+183	K	14	85	0.14	-	-	-	-
+184	L	19	80	0.19	-	-	-	-
+185	G	28	72	0.28	-	-	-	-
+186	Q	28	71	0.28	-	-	-	-
+187	I	27	72	0.27	-	-	-	-
+188	I	23	76	0.23	-	-	-	-
+189	R	16	82	0.16	-	-	-	-
+190	E	10	89	0.10	-	-	-	-
+191	G	11	88	0.11	-	-	-	-
+192	P	20	80	0.20	-	-	-	-
+193	I	13	86	0.13	-	-	-	-
+194	K	9	89	0.09	-	-	-	-
+195	G	11	88	0.11	-	-	-	-
+196	S	14	86	0.14	-	-	-	-
+197	L	18	80	0.18	-	-	-	-
+198	L	21	78	0.21	-	-	-	-
+199	K	15	84	0.15	-	-	-	-
+200	V	18	81	0.18	-	-	-	-
+201	V	11	88	0.11	-	-	-	-
+202	L	10	89	0.10	-	-	-	-
+203	E	6	93	0.06	-	-	-	-
+204	D	7	92	0.07	-	-	-	-
+205	Y	7	92	0.07	-	-	-	-
+206	L	7	92	0.07	-	-	-	-
+207	R	8	91	0.08	-	-	-	-
+208	L	10	89	0.10	-	-	-	-
+209	K	8	91	0.08	-	-	-	-
+210	K	10	89	0.10	-	-	-	-
+211	L	12	87	0.12	-	-	-	-
+212	F	14	85	0.14	-	-	-	-
+213	A	19	80	0.19	-	-	-	-
+214	Q	20	79	0.20	-	-	-	-
+215	R	26	73	0.26	-	-	-	-
+216	M	24	75	0.24	-	-	-	-
+217	V	29	70	0.29	-	-	-	-
+218	Q	30	69	0.30	-	-	-	-
+219	K	31	68	0.31	-	-	-	-
+220	A	28	71	0.28	-	-	-	-
+221	S	29	71	0.29	-	-	-	-
+222	S	28	71	0.28	-	-	-	-
+223	C	41	59	0.41	N	-	-	-
+224	H	35	64	0.35	-	-	-	-
+225	S	34	65	0.34	-	-	-	-
+226	S	49	50	0.49	N	-	-	-
+227	I	59	40	0.60	N	-	N	-
+228	S	43	56	0.43	N	-	-	-
+229	E	43	56	0.43	N	-	-	-
+230	L	50	50	0.50	N	-	-	-
+231	I	51	49	0.51	N	-	-	-
+232	H	39	61	0.39	-	-	-	-
+233	T	26	74	0.26	-	-	-	-
+234	D	30	69	0.30	-	-	-	-
+235	L	33	66	0.33	-	-	-	-
+236	E	34	65	0.34	-	-	-	-
+237	E	43	56	0.43	N	-	-	-
+238	E	62	37	0.63	N	-	N	-
+239	P	62	37	0.63	N	-	N	-
+240	G	55	44	0.56	N	-	-	-
+241	D	53	46	0.54	N	-	-	-
+242	H	56	42	0.57	N	-	-	-
+243	S	60	39	0.61	N	-	N	-
+244	P	55	44	0.56	N	-	-	-
+245	G	46	52	0.47	N	-	-	-
+246	Q	37	62	0.37	-	-	-	-
+247	G	48	52	0.48	N	-	-	-
+248	S	52	48	0.52	N	-	-	-
+249	L	56	43	0.57	N	-	-	-
+250	R	35	64	0.35	-	-	-	-
+251	F	38	60	0.39	-	-	-	-
+252	R	40	59	0.40	N	-	-	-
+253	H	26	73	0.26	-	-	-	-
+254	K	33	66	0.33	-	-	-	-
+255	P	29	70	0.29	-	-	-	-
+256	P	31	68	0.31	-	-	-	-
+257	M	23	76	0.23	-	-	-	-
+258	E	19	80	0.19	-	-	-	-
+259	L	18	80	0.18	-	-	-	-
+260	K	24	75	0.24	-	-	-	-
+261	G	34	64	0.35	-	-	-	-
+262	Q	45	54	0.45	N	-	-	-
+263	D	31	67	0.32	-	-	-	-
+264	G	26	73	0.26	-	-	-	-
+265	I	12	86	0.12	-	-	-	-
+266	H	14	85	0.14	-	-	-	-
+267	M	14	85	0.14	-	-	-	-
+268	V	25	74	0.25	-	-	-	-
+269	H	24	75	0.24	-	-	-	-
+270	G	17	82	0.17	-	-	-	-
+271	S	21	78	0.21	-	-	-	-
+272	T	32	67	0.32	-	-	-	-
+273	G	28	71	0.28	-	-	-	-
+274	T	37	63	0.37	-	-	-	-
+275	L	49	51	0.49	N	-	-	-
+276	L	57	43	0.57	N	-	-	-
+277	A	63	37	0.63	N	-	N	-
+278	T	25	74	0.25	-	-	-	-
+279	D	24	75	0.24	-	-	-	-
+280	L	32	67	0.32	-	-	-	-
+281	N	23	76	0.23	-	-	-	-
+282	S	22	77	0.22	-	-	-	-
+283	L	20	79	0.20	-	-	-	-
+284	P	20	79	0.20	-	-	-	-
+285	E	23	77	0.23	-	-	-	-
+286	D	25	74	0.25	-	-	-	-
+287	D	20	79	0.20	-	-	-	-
+288	Q	16	83	0.16	-	-	-	-
+289	K	29	70	0.29	-	-	-	-
+290	G	48	52	0.48	N	-	-	-
+291	L	27	73	0.27	-	-	-	-
+292	D	20	79	0.20	-	-	-	-
+293	R	18	82	0.18	-	-	-	-
+294	S	20	80	0.20	-	-	-	-
+295	L	18	81	0.18	-	-	-	-
+296	E	14	86	0.14	-	-	-	-
+297	T	17	82	0.17	-	-	-	-
+298	L	16	83	0.16	-	-	-	-
+299	T	16	83	0.16	-	-	-	-
+300	A	16	83	0.16	-	-	-	-
+301	S	12	87	0.12	-	-	-	-
+302	E	16	83	0.16	-	-	-	-
+303	A	16	83	0.16	-	-	-	-
+304	T	25	74	0.25	-	-	-	-
+305	A	24	75	0.24	-	-	-	-
+306	F	24	76	0.24	-	-	-	-
+307	E	27	72	0.27	-	-	-	-
+308	R	26	73	0.26	-	-	-	-
+309	N	33	67	0.33	-	-	-	-
+310	A	37	62	0.37	-	-	-	-
+311	R	41	58	0.41	N	-	-	-
+312	T	51	48	0.52	N	-	-	-
+313	E	58	41	0.59	N	-	-	-
+314	S	56	44	0.56	N	-	-	-
+315	A	58	42	0.58	N	-	-	-
+316	K	63	36	0.64	N	-	N	-
+317	S	71	28	0.72	N	-	N	-
+318	T	81	18	0.82	N	-	N	-
+319	P	76	23	0.77	N	-	N	-
+320	L	67	32	0.68	N	-	N	-
+321	H	58	41	0.59	N	-	-	-
+322	K	60	39	0.61	N	-	N	-
+323	L	64	36	0.64	N	-	N	-
+324	R	47	52	0.47	N	-	-	-
+325	D	40	58	0.41	N	-	-	-
+326	V	36	63	0.36	-	-	-	-
+327	I	37	62	0.37	-	-	-	-
+328	M	31	68	0.31	-	-	-	-
+329	E	33	66	0.33	-	-	-	-
+330	S	54	45	0.55	N	-	-	-
+331	P	45	54	0.45	N	-	-	-
+332	L	41	58	0.41	N	-	-	-
+333	E	34	65	0.34	-	-	-	-
+334	I	48	50	0.49	N	-	-	-
+335	T	38	60	0.39	-	-	-	-
+336	E	37	62	0.37	-	-	-	-
+337	L	45	54	0.45	N	-	-	-

Added: trunk/packages/norsnet/trunk/debian/example/cad23.profbval
===================================================================
(Binary files differ)


Property changes on: trunk/packages/norsnet/trunk/debian/example/cad23.profbval
___________________________________________________________________
Added: svn:mime-type
   + application/octet-stream

Added: trunk/packages/norsnet/trunk/debian/install-sh
===================================================================
--- trunk/packages/norsnet/trunk/debian/install-sh	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/install-sh	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,520 @@
+#!/bin/sh
+# install - install a program, script, or datafile
+
+scriptversion=2009-04-28.21; # UTC
+
+# This originates from X11R5 (mit/util/scripts/install.sh), which was
+# later released in X11R6 (xc/config/util/install.sh) with the
+# following copyright and license.
+#
+# Copyright (C) 1994 X Consortium
+#
+# Permission is hereby granted, free of charge, to any person obtaining a copy
+# of this software and associated documentation files (the "Software"), to
+# deal in the Software without restriction, including without limitation the
+# rights to use, copy, modify, merge, publish, distribute, sublicense, and/or
+# sell copies of the Software, and to permit persons to whom the Software is
+# furnished to do so, subject to the following conditions:
+#
+# The above copyright notice and this permission notice shall be included in
+# all copies or substantial portions of the Software.
+#
+# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
+# IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
+# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.  IN NO EVENT SHALL THE
+# X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN
+# AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC-
+# TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+#
+# Except as contained in this notice, the name of the X Consortium shall not
+# be used in advertising or otherwise to promote the sale, use or other deal-
+# ings in this Software without prior written authorization from the X Consor-
+# tium.
+#
+#
+# FSF changes to this file are in the public domain.
+#
+# Calling this script install-sh is preferred over install.sh, to prevent
+# `make' implicit rules from creating a file called install from it
+# when there is no Makefile.
+#
+# This script is compatible with the BSD install script, but was written
+# from scratch.
+
+nl='
+'
+IFS=" ""	$nl"
+
+# set DOITPROG to echo to test this script
+
+# Don't use :- since 4.3BSD and earlier shells don't like it.
+doit=${DOITPROG-}
+if test -z "$doit"; then
+  doit_exec=exec
+else
+  doit_exec=$doit
+fi
+
+# Put in absolute file names if you don't have them in your path;
+# or use environment vars.
+
+chgrpprog=${CHGRPPROG-chgrp}
+chmodprog=${CHMODPROG-chmod}
+chownprog=${CHOWNPROG-chown}
+cmpprog=${CMPPROG-cmp}
+cpprog=${CPPROG-cp}
+mkdirprog=${MKDIRPROG-mkdir}
+mvprog=${MVPROG-mv}
+rmprog=${RMPROG-rm}
+stripprog=${STRIPPROG-strip}
+
+posix_glob='?'
+initialize_posix_glob='
+  test "$posix_glob" != "?" || {
+    if (set -f) 2>/dev/null; then
+      posix_glob=
+    else
+      posix_glob=:
+    fi
+  }
+'
+
+posix_mkdir=
+
+# Desired mode of installed file.
+mode=0755
+
+chgrpcmd=
+chmodcmd=$chmodprog
+chowncmd=
+mvcmd=$mvprog
+rmcmd="$rmprog -f"
+stripcmd=
+
+src=
+dst=
+dir_arg=
+dst_arg=
+
+copy_on_change=false
+no_target_directory=
+
+usage="\
+Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE
+   or: $0 [OPTION]... SRCFILES... DIRECTORY
+   or: $0 [OPTION]... -t DIRECTORY SRCFILES...
+   or: $0 [OPTION]... -d DIRECTORIES...
+
+In the 1st form, copy SRCFILE to DSTFILE.
+In the 2nd and 3rd, copy all SRCFILES to DIRECTORY.
+In the 4th, create DIRECTORIES.
+
+Options:
+     --help     display this help and exit.
+     --version  display version info and exit.
+
+  -c            (ignored)
+  -C            install only if different (preserve the last data modification time)
+  -d            create directories instead of installing files.
+  -g GROUP      $chgrpprog installed files to GROUP.
+  -m MODE       $chmodprog installed files to MODE.
+  -o USER       $chownprog installed files to USER.
+  -s            $stripprog installed files.
+  -t DIRECTORY  install into DIRECTORY.
+  -T            report an error if DSTFILE is a directory.
+
+Environment variables override the default commands:
+  CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG
+  RMPROG STRIPPROG
+"
+
+while test $# -ne 0; do
+  case $1 in
+    -c) ;;
+
+    -C) copy_on_change=true;;
+
+    -d) dir_arg=true;;
+
+    -g) chgrpcmd="$chgrpprog $2"
+	shift;;
+
+    --help) echo "$usage"; exit $?;;
+
+    -m) mode=$2
+	case $mode in
+	  *' '* | *'	'* | *'
+'*	  | *'*'* | *'?'* | *'['*)
+	    echo "$0: invalid mode: $mode" >&2
+	    exit 1;;
+	esac
+	shift;;
+
+    -o) chowncmd="$chownprog $2"
+	shift;;
+
+    -s) stripcmd=$stripprog;;
+
+    -t) dst_arg=$2
+	shift;;
+
+    -T) no_target_directory=true;;
+
+    --version) echo "$0 $scriptversion"; exit $?;;
+
+    --)	shift
+	break;;
+
+    -*)	echo "$0: invalid option: $1" >&2
+	exit 1;;
+
+    *)  break;;
+  esac
+  shift
+done
+
+if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then
+  # When -d is used, all remaining arguments are directories to create.
+  # When -t is used, the destination is already specified.
+  # Otherwise, the last argument is the destination.  Remove it from $@.
+  for arg
+  do
+    if test -n "$dst_arg"; then
+      # $@ is not empty: it contains at least $arg.
+      set fnord "$@" "$dst_arg"
+      shift # fnord
+    fi
+    shift # arg
+    dst_arg=$arg
+  done
+fi
+
+if test $# -eq 0; then
+  if test -z "$dir_arg"; then
+    echo "$0: no input file specified." >&2
+    exit 1
+  fi
+  # It's OK to call `install-sh -d' without argument.
+  # This can happen when creating conditional directories.
+  exit 0
+fi
+
+if test -z "$dir_arg"; then
+  trap '(exit $?); exit' 1 2 13 15
+
+  # Set umask so as not to create temps with too-generous modes.
+  # However, 'strip' requires both read and write access to temps.
+  case $mode in
+    # Optimize common cases.
+    *644) cp_umask=133;;
+    *755) cp_umask=22;;
+
+    *[0-7])
+      if test -z "$stripcmd"; then
+	u_plus_rw=
+      else
+	u_plus_rw='% 200'
+      fi
+      cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;;
+    *)
+      if test -z "$stripcmd"; then
+	u_plus_rw=
+      else
+	u_plus_rw=,u+rw
+      fi
+      cp_umask=$mode$u_plus_rw;;
+  esac
+fi
+
+for src
+do
+  # Protect names starting with `-'.
+  case $src in
+    -*) src=./$src;;
+  esac
+
+  if test -n "$dir_arg"; then
+    dst=$src
+    dstdir=$dst
+    test -d "$dstdir"
+    dstdir_status=$?
+  else
+
+    # Waiting for this to be detected by the "$cpprog $src $dsttmp" command
+    # might cause directories to be created, which would be especially bad
+    # if $src (and thus $dsttmp) contains '*'.
+    if test ! -f "$src" && test ! -d "$src"; then
+      echo "$0: $src does not exist." >&2
+      exit 1
+    fi
+
+    if test -z "$dst_arg"; then
+      echo "$0: no destination specified." >&2
+      exit 1
+    fi
+
+    dst=$dst_arg
+    # Protect names starting with `-'.
+    case $dst in
+      -*) dst=./$dst;;
+    esac
+
+    # If destination is a directory, append the input filename; won't work
+    # if double slashes aren't ignored.
+    if test -d "$dst"; then
+      if test -n "$no_target_directory"; then
+	echo "$0: $dst_arg: Is a directory" >&2
+	exit 1
+      fi
+      dstdir=$dst
+      dst=$dstdir/`basename "$src"`
+      dstdir_status=0
+    else
+      # Prefer dirname, but fall back on a substitute if dirname fails.
+      dstdir=`
+	(dirname "$dst") 2>/dev/null ||
+	expr X"$dst" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	     X"$dst" : 'X\(//\)[^/]' \| \
+	     X"$dst" : 'X\(//\)$' \| \
+	     X"$dst" : 'X\(/\)' \| . 2>/dev/null ||
+	echo X"$dst" |
+	    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+		   s//\1/
+		   q
+		 }
+		 /^X\(\/\/\)[^/].*/{
+		   s//\1/
+		   q
+		 }
+		 /^X\(\/\/\)$/{
+		   s//\1/
+		   q
+		 }
+		 /^X\(\/\).*/{
+		   s//\1/
+		   q
+		 }
+		 s/.*/./; q'
+      `
+
+      test -d "$dstdir"
+      dstdir_status=$?
+    fi
+  fi
+
+  obsolete_mkdir_used=false
+
+  if test $dstdir_status != 0; then
+    case $posix_mkdir in
+      '')
+	# Create intermediate dirs using mode 755 as modified by the umask.
+	# This is like FreeBSD 'install' as of 1997-10-28.
+	umask=`umask`
+	case $stripcmd.$umask in
+	  # Optimize common cases.
+	  *[2367][2367]) mkdir_umask=$umask;;
+	  .*0[02][02] | .[02][02] | .[02]) mkdir_umask=22;;
+
+	  *[0-7])
+	    mkdir_umask=`expr $umask + 22 \
+	      - $umask % 100 % 40 + $umask % 20 \
+	      - $umask % 10 % 4 + $umask % 2
+	    `;;
+	  *) mkdir_umask=$umask,go-w;;
+	esac
+
+	# With -d, create the new directory with the user-specified mode.
+	# Otherwise, rely on $mkdir_umask.
+	if test -n "$dir_arg"; then
+	  mkdir_mode=-m$mode
+	else
+	  mkdir_mode=
+	fi
+
+	posix_mkdir=false
+	case $umask in
+	  *[123567][0-7][0-7])
+	    # POSIX mkdir -p sets u+wx bits regardless of umask, which
+	    # is incompatible with FreeBSD 'install' when (umask & 300) != 0.
+	    ;;
+	  *)
+	    tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$
+	    trap 'ret=$?; rmdir "$tmpdir/d" "$tmpdir" 2>/dev/null; exit $ret' 0
+
+	    if (umask $mkdir_umask &&
+		exec $mkdirprog $mkdir_mode -p -- "$tmpdir/d") >/dev/null 2>&1
+	    then
+	      if test -z "$dir_arg" || {
+		   # Check for POSIX incompatibilities with -m.
+		   # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or
+		   # other-writeable bit of parent directory when it shouldn't.
+		   # FreeBSD 6.1 mkdir -m -p sets mode of existing directory.
+		   ls_ld_tmpdir=`ls -ld "$tmpdir"`
+		   case $ls_ld_tmpdir in
+		     d????-?r-*) different_mode=700;;
+		     d????-?--*) different_mode=755;;
+		     *) false;;
+		   esac &&
+		   $mkdirprog -m$different_mode -p -- "$tmpdir" && {
+		     ls_ld_tmpdir_1=`ls -ld "$tmpdir"`
+		     test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1"
+		   }
+		 }
+	      then posix_mkdir=:
+	      fi
+	      rmdir "$tmpdir/d" "$tmpdir"
+	    else
+	      # Remove any dirs left behind by ancient mkdir implementations.
+	      rmdir ./$mkdir_mode ./-p ./-- 2>/dev/null
+	    fi
+	    trap '' 0;;
+	esac;;
+    esac
+
+    if
+      $posix_mkdir && (
+	umask $mkdir_umask &&
+	$doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir"
+      )
+    then :
+    else
+
+      # The umask is ridiculous, or mkdir does not conform to POSIX,
+      # or it failed possibly due to a race condition.  Create the
+      # directory the slow way, step by step, checking for races as we go.
+
+      case $dstdir in
+	/*) prefix='/';;
+	-*) prefix='./';;
+	*)  prefix='';;
+      esac
+
+      eval "$initialize_posix_glob"
+
+      oIFS=$IFS
+      IFS=/
+      $posix_glob set -f
+      set fnord $dstdir
+      shift
+      $posix_glob set +f
+      IFS=$oIFS
+
+      prefixes=
+
+      for d
+      do
+	test -z "$d" && continue
+
+	prefix=$prefix$d
+	if test -d "$prefix"; then
+	  prefixes=
+	else
+	  if $posix_mkdir; then
+	    (umask=$mkdir_umask &&
+	     $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break
+	    # Don't fail if two instances are running concurrently.
+	    test -d "$prefix" || exit 1
+	  else
+	    case $prefix in
+	      *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;;
+	      *) qprefix=$prefix;;
+	    esac
+	    prefixes="$prefixes '$qprefix'"
+	  fi
+	fi
+	prefix=$prefix/
+      done
+
+      if test -n "$prefixes"; then
+	# Don't fail if two instances are running concurrently.
+	(umask $mkdir_umask &&
+	 eval "\$doit_exec \$mkdirprog $prefixes") ||
+	  test -d "$dstdir" || exit 1
+	obsolete_mkdir_used=true
+      fi
+    fi
+  fi
+
+  if test -n "$dir_arg"; then
+    { test -z "$chowncmd" || $doit $chowncmd "$dst"; } &&
+    { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } &&
+    { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false ||
+      test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1
+  else
+
+    # Make a couple of temp file names in the proper directory.
+    dsttmp=$dstdir/_inst.$$_
+    rmtmp=$dstdir/_rm.$$_
+
+    # Trap to clean up those temp files at exit.
+    trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0
+
+    # Copy the file name to the temp name.
+    (umask $cp_umask && $doit_exec $cpprog "$src" "$dsttmp") &&
+
+    # and set any options; do chmod last to preserve setuid bits.
+    #
+    # If any of these fail, we abort the whole thing.  If we want to
+    # ignore errors from any of these, just make sure not to ignore
+    # errors from the above "$doit $cpprog $src $dsttmp" command.
+    #
+    { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } &&
+    { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } &&
+    { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } &&
+    { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } &&
+
+    # If -C, don't bother to copy if it wouldn't change the file.
+    if $copy_on_change &&
+       old=`LC_ALL=C ls -dlL "$dst"	2>/dev/null` &&
+       new=`LC_ALL=C ls -dlL "$dsttmp"	2>/dev/null` &&
+
+       eval "$initialize_posix_glob" &&
+       $posix_glob set -f &&
+       set X $old && old=:$2:$4:$5:$6 &&
+       set X $new && new=:$2:$4:$5:$6 &&
+       $posix_glob set +f &&
+
+       test "$old" = "$new" &&
+       $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1
+    then
+      rm -f "$dsttmp"
+    else
+      # Rename the file to the real destination.
+      $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null ||
+
+      # The rename failed, perhaps because mv can't rename something else
+      # to itself, or perhaps because mv is so ancient that it does not
+      # support -f.
+      {
+	# Now remove or move aside any old file at destination location.
+	# We try this two ways since rm can't unlink itself on some
+	# systems and the destination file might be busy for other
+	# reasons.  In this case, the final cleanup might fail but the new
+	# file should still install successfully.
+	{
+	  test ! -f "$dst" ||
+	  $doit $rmcmd -f "$dst" 2>/dev/null ||
+	  { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null &&
+	    { $doit $rmcmd -f "$rmtmp" 2>/dev/null; :; }
+	  } ||
+	  { echo "$0: cannot unlink or rename $dst" >&2
+	    (exit 1); exit 1
+	  }
+	} &&
+
+	# Now rename the file to the real destination.
+	$doit $mvcmd "$dsttmp" "$dst"
+      }
+    fi || exit 1
+
+    trap '' 0
+  fi
+done
+
+# Local variables:
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "scriptversion="
+# time-stamp-format: "%:y-%02m-%02d.%02H"
+# time-stamp-time-zone: "UTC"
+# time-stamp-end: "; # UTC"
+# End:


Property changes on: trunk/packages/norsnet/trunk/debian/install-sh
___________________________________________________________________
Added: svn:executable
   + *

Added: trunk/packages/norsnet/trunk/debian/missing
===================================================================
--- trunk/packages/norsnet/trunk/debian/missing	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/missing	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,376 @@
+#! /bin/sh
+# Common stub for a few missing GNU programs while installing.
+
+scriptversion=2009-04-28.21; # UTC
+
+# Copyright (C) 1996, 1997, 1999, 2000, 2002, 2003, 2004, 2005, 2006,
+# 2008, 2009 Free Software Foundation, Inc.
+# Originally by Fran,cois Pinard <pinard at iro.umontreal.ca>, 1996.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program.  If not, see <http://www.gnu.org/licenses/>.
+
+# As a special exception to the GNU General Public License, if you
+# distribute this file as part of a program that contains a
+# configuration script generated by Autoconf, you may include it under
+# the same distribution terms that you use for the rest of that program.
+
+if test $# -eq 0; then
+  echo 1>&2 "Try \`$0 --help' for more information"
+  exit 1
+fi
+
+run=:
+sed_output='s/.* --output[ =]\([^ ]*\).*/\1/p'
+sed_minuso='s/.* -o \([^ ]*\).*/\1/p'
+
+# In the cases where this matters, `missing' is being run in the
+# srcdir already.
+if test -f configure.ac; then
+  configure_ac=configure.ac
+else
+  configure_ac=configure.in
+fi
+
+msg="missing on your system"
+
+case $1 in
+--run)
+  # Try to run requested program, and just exit if it succeeds.
+  run=
+  shift
+  "$@" && exit 0
+  # Exit code 63 means version mismatch.  This often happens
+  # when the user try to use an ancient version of a tool on
+  # a file that requires a minimum version.  In this case we
+  # we should proceed has if the program had been absent, or
+  # if --run hadn't been passed.
+  if test $? = 63; then
+    run=:
+    msg="probably too old"
+  fi
+  ;;
+
+  -h|--h|--he|--hel|--help)
+    echo "\
+$0 [OPTION]... PROGRAM [ARGUMENT]...
+
+Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an
+error status if there is no known handling for PROGRAM.
+
+Options:
+  -h, --help      display this help and exit
+  -v, --version   output version information and exit
+  --run           try to run the given command, and emulate it if it fails
+
+Supported PROGRAM values:
+  aclocal      touch file \`aclocal.m4'
+  autoconf     touch file \`configure'
+  autoheader   touch file \`config.h.in'
+  autom4te     touch the output file, or create a stub one
+  automake     touch all \`Makefile.in' files
+  bison        create \`y.tab.[ch]', if possible, from existing .[ch]
+  flex         create \`lex.yy.c', if possible, from existing .c
+  help2man     touch the output file
+  lex          create \`lex.yy.c', if possible, from existing .c
+  makeinfo     touch the output file
+  tar          try tar, gnutar, gtar, then tar without non-portable flags
+  yacc         create \`y.tab.[ch]', if possible, from existing .[ch]
+
+Version suffixes to PROGRAM as well as the prefixes \`gnu-', \`gnu', and
+\`g' are ignored when checking the name.
+
+Send bug reports to <bug-automake at gnu.org>."
+    exit $?
+    ;;
+
+  -v|--v|--ve|--ver|--vers|--versi|--versio|--version)
+    echo "missing $scriptversion (GNU Automake)"
+    exit $?
+    ;;
+
+  -*)
+    echo 1>&2 "$0: Unknown \`$1' option"
+    echo 1>&2 "Try \`$0 --help' for more information"
+    exit 1
+    ;;
+
+esac
+
+# normalize program name to check for.
+program=`echo "$1" | sed '
+  s/^gnu-//; t
+  s/^gnu//; t
+  s/^g//; t'`
+
+# Now exit if we have it, but it failed.  Also exit now if we
+# don't have it and --version was passed (most likely to detect
+# the program).  This is about non-GNU programs, so use $1 not
+# $program.
+case $1 in
+  lex*|yacc*)
+    # Not GNU programs, they don't have --version.
+    ;;
+
+  tar*)
+    if test -n "$run"; then
+       echo 1>&2 "ERROR: \`tar' requires --run"
+       exit 1
+    elif test "x$2" = "x--version" || test "x$2" = "x--help"; then
+       exit 1
+    fi
+    ;;
+
+  *)
+    if test -z "$run" && ($1 --version) > /dev/null 2>&1; then
+       # We have it, but it failed.
+       exit 1
+    elif test "x$2" = "x--version" || test "x$2" = "x--help"; then
+       # Could not run --version or --help.  This is probably someone
+       # running `$TOOL --version' or `$TOOL --help' to check whether
+       # $TOOL exists and not knowing $TOOL uses missing.
+       exit 1
+    fi
+    ;;
+esac
+
+# If it does not exist, or fails to run (possibly an outdated version),
+# try to emulate it.
+case $program in
+  aclocal*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`acinclude.m4' or \`${configure_ac}'.  You might want
+         to install the \`Automake' and \`Perl' packages.  Grab them from
+         any GNU archive site."
+    touch aclocal.m4
+    ;;
+
+  autoconf*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`${configure_ac}'.  You might want to install the
+         \`Autoconf' and \`GNU m4' packages.  Grab them from any GNU
+         archive site."
+    touch configure
+    ;;
+
+  autoheader*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`acconfig.h' or \`${configure_ac}'.  You might want
+         to install the \`Autoconf' and \`GNU m4' packages.  Grab them
+         from any GNU archive site."
+    files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' ${configure_ac}`
+    test -z "$files" && files="config.h"
+    touch_files=
+    for f in $files; do
+      case $f in
+      *:*) touch_files="$touch_files "`echo "$f" |
+				       sed -e 's/^[^:]*://' -e 's/:.*//'`;;
+      *) touch_files="$touch_files $f.in";;
+      esac
+    done
+    touch $touch_files
+    ;;
+
+  automake*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`Makefile.am', \`acinclude.m4' or \`${configure_ac}'.
+         You might want to install the \`Automake' and \`Perl' packages.
+         Grab them from any GNU archive site."
+    find . -type f -name Makefile.am -print |
+	   sed 's/\.am$/.in/' |
+	   while read f; do touch "$f"; done
+    ;;
+
+  autom4te*)
+    echo 1>&2 "\
+WARNING: \`$1' is needed, but is $msg.
+         You might have modified some files without having the
+         proper tools for further handling them.
+         You can get \`$1' as part of \`Autoconf' from any GNU
+         archive site."
+
+    file=`echo "$*" | sed -n "$sed_output"`
+    test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"`
+    if test -f "$file"; then
+	touch $file
+    else
+	test -z "$file" || exec >$file
+	echo "#! /bin/sh"
+	echo "# Created by GNU Automake missing as a replacement of"
+	echo "#  $ $@"
+	echo "exit 0"
+	chmod +x $file
+	exit 1
+    fi
+    ;;
+
+  bison*|yacc*)
+    echo 1>&2 "\
+WARNING: \`$1' $msg.  You should only need it if
+         you modified a \`.y' file.  You may need the \`Bison' package
+         in order for those modifications to take effect.  You can get
+         \`Bison' from any GNU archive site."
+    rm -f y.tab.c y.tab.h
+    if test $# -ne 1; then
+        eval LASTARG="\${$#}"
+	case $LASTARG in
+	*.y)
+	    SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'`
+	    if test -f "$SRCFILE"; then
+	         cp "$SRCFILE" y.tab.c
+	    fi
+	    SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'`
+	    if test -f "$SRCFILE"; then
+	         cp "$SRCFILE" y.tab.h
+	    fi
+	  ;;
+	esac
+    fi
+    if test ! -f y.tab.h; then
+	echo >y.tab.h
+    fi
+    if test ! -f y.tab.c; then
+	echo 'main() { return 0; }' >y.tab.c
+    fi
+    ;;
+
+  lex*|flex*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified a \`.l' file.  You may need the \`Flex' package
+         in order for those modifications to take effect.  You can get
+         \`Flex' from any GNU archive site."
+    rm -f lex.yy.c
+    if test $# -ne 1; then
+        eval LASTARG="\${$#}"
+	case $LASTARG in
+	*.l)
+	    SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'`
+	    if test -f "$SRCFILE"; then
+	         cp "$SRCFILE" lex.yy.c
+	    fi
+	  ;;
+	esac
+    fi
+    if test ! -f lex.yy.c; then
+	echo 'main() { return 0; }' >lex.yy.c
+    fi
+    ;;
+
+  help2man*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+	 you modified a dependency of a manual page.  You may need the
+	 \`Help2man' package in order for those modifications to take
+	 effect.  You can get \`Help2man' from any GNU archive site."
+
+    file=`echo "$*" | sed -n "$sed_output"`
+    test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"`
+    if test -f "$file"; then
+	touch $file
+    else
+	test -z "$file" || exec >$file
+	echo ".ab help2man is required to generate this page"
+	exit $?
+    fi
+    ;;
+
+  makeinfo*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified a \`.texi' or \`.texinfo' file, or any other file
+         indirectly affecting the aspect of the manual.  The spurious
+         call might also be the consequence of using a buggy \`make' (AIX,
+         DU, IRIX).  You might want to install the \`Texinfo' package or
+         the \`GNU make' package.  Grab either from any GNU archive site."
+    # The file to touch is that specified with -o ...
+    file=`echo "$*" | sed -n "$sed_output"`
+    test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"`
+    if test -z "$file"; then
+      # ... or it is the one specified with @setfilename ...
+      infile=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'`
+      file=`sed -n '
+	/^@setfilename/{
+	  s/.* \([^ ]*\) *$/\1/
+	  p
+	  q
+	}' $infile`
+      # ... or it is derived from the source name (dir/f.texi becomes f.info)
+      test -z "$file" && file=`echo "$infile" | sed 's,.*/,,;s,.[^.]*$,,'`.info
+    fi
+    # If the file does not exist, the user really needs makeinfo;
+    # let's fail without touching anything.
+    test -f $file || exit 1
+    touch $file
+    ;;
+
+  tar*)
+    shift
+
+    # We have already tried tar in the generic part.
+    # Look for gnutar/gtar before invocation to avoid ugly error
+    # messages.
+    if (gnutar --version > /dev/null 2>&1); then
+       gnutar "$@" && exit 0
+    fi
+    if (gtar --version > /dev/null 2>&1); then
+       gtar "$@" && exit 0
+    fi
+    firstarg="$1"
+    if shift; then
+	case $firstarg in
+	*o*)
+	    firstarg=`echo "$firstarg" | sed s/o//`
+	    tar "$firstarg" "$@" && exit 0
+	    ;;
+	esac
+	case $firstarg in
+	*h*)
+	    firstarg=`echo "$firstarg" | sed s/h//`
+	    tar "$firstarg" "$@" && exit 0
+	    ;;
+	esac
+    fi
+
+    echo 1>&2 "\
+WARNING: I can't seem to be able to run \`tar' with the given arguments.
+         You may want to install GNU tar or Free paxutils, or check the
+         command line arguments."
+    exit 1
+    ;;
+
+  *)
+    echo 1>&2 "\
+WARNING: \`$1' is needed, and is $msg.
+         You might have modified some files without having the
+         proper tools for further handling them.  Check the \`README' file,
+         it often tells you about the needed prerequisites for installing
+         this package.  You may also peek at any GNU archive site, in case
+         some other package would contain this missing \`$1' program."
+    exit 1
+    ;;
+esac
+
+exit 0
+
+# Local variables:
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "scriptversion="
+# time-stamp-format: "%:y-%02m-%02d.%02H"
+# time-stamp-time-zone: "UTC"
+# time-stamp-end: "; # UTC"
+# End:


Property changes on: trunk/packages/norsnet/trunk/debian/missing
___________________________________________________________________
Added: svn:executable
   + *

Added: trunk/packages/norsnet/trunk/debian/norsnet
===================================================================
--- trunk/packages/norsnet/trunk/debian/norsnet	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/norsnet	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,45 @@
+#!/usr/bin/perl -w
+use File::Temp;
+use Carp qw(cluck croak);
+
+# popularity contest
+if( system('pp_popcon_cnt', '-p', 'norsnet') == -1 ){ warn("The Rost Lab recommends you install the pp-popularity-contest package that provides pp_popcon_cnt:\n\nsudo apt-get install pp-popularity-contest\n"); }
+
+$DEF_MODE=1;
+if (@ARGV<1)  {
+	#                   0       1      2          3          4               5            6      7
+	die "\nUsage: $0 [fasta] [prof] [hssp] [output_file] [target_name] [profbval_file] [mode] [debug]\n";
+}
+$seq_file=$ARGV[0];
+$rdbProf_file=$ARGV[1];
+$hssp_file=$ARGV[2];
+$output_file=$ARGV[3];
+#$target_name=$ARGV[4];
+$profbval_file=$ARGV[5];
+$mode=$ARGV[6]||$DEF_MODE;
+my $dbg = $ARGV[7] || 0;
+
+if( $mode eq '-' ){ $mode = $DEF_MODE; }
+
+if( $mode ne '1' && $mode ne '2' && $mode ne '3' ) { die( "invalid mode, must be one of 1, 2 or 3" ); }
+
+$dir = $ENV{NORSNET_ROOT} ||  "__pkgdatadir__";
+$resultsdir = File::Temp::tempdir( CLEANUP => !$dbg );
+
+$createDataFile_exe = "$dir/scr/createDataFile.pl";
+$norsnet_exe = "$dir/scr/NORSnet.pl";
+
+
+{
+	#                                    0           1              2           3        4
+	my @cmd = ( $createDataFile_exe, $seq_file, $rdbProf_file, $hssp_file, $resultsdir, $dbg );
+	if( $dbg ){ warn( "@cmd" ); }
+	system( @cmd ) && die( "@cmd failed: $!, ".( $? >> 8 ) );
+}
+{
+	#                             0            1          2         3               4        5     6
+	my @cmd = ( $norsnet_exe, $seq_file, $output_file, $mode, $profbval_file, $resultsdir, $dir, $dbg );
+	if( $dbg ){ warn( "@cmd" ); }
+	system( @cmd ) && die( "@cmd failed: $!, ".( $? >> 8 ));
+}
+


Property changes on: trunk/packages/norsnet/trunk/debian/norsnet
___________________________________________________________________
Added: svn:executable
   + *

Added: trunk/packages/norsnet/trunk/debian/norsnet.pod.in
===================================================================
--- trunk/packages/norsnet/trunk/debian/norsnet.pod.in	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/norsnet.pod.in	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,193 @@
+=head1 NAME
+
+norsnet - identifies unstructured loops from sequence
+
+=head1 SYNOPSIS
+
+norsnet <FASTA_FILE> <RDBPROF_FILE> <HSSP_FILE> <OUTPUT_FILE> <PROTEIN_NAME> <PROFBVAL_FILE> <OUTPUT_MODE> <DEBUG>
+
+=head1 DESCRIPTION
+
+NORSnet is a neural network based method that focuses on the identification of unstructured loops.
+
+NORSnet was trained to distinguish between very long contiguous segments with non-regular secondary structure (NORS regions) and well-folded proteins. NORSnet was trained on predicted information rather than on experimental data. Therefore, it was optimized on a large data, which is not biased by today's experimental means of capturing disorder. Thus, NORSnet reached into regions in sequence space that are not covered by the specialized disorder predictors. One disadvantage of this approach is that it is not optimal for the identification of the "average" disordered region.
+
+=head2 Output format
+
+=head3 Output mode 1
+
+Tabular output, columns:
+
+ pos            amino acid number (1..)
+ res            residue 1-letter code
+ node1          output of neural network node 1
+ node2          output of neural network node 2
+ pred           node1 / ( node1 + node2 )
+ n40            pred < 0.40 ? '-' : 'N'
+ n40fil         at least 31 AA long stretches of 'N' in n40
+ n59            pred < 0.59 ? '-' : 'N'
+ n59fil         at least 31 AA long stretches of 'N' in n59
+
+'N' is for non-regular secondary structure.
+
+=head1 REFERENCES
+
+=over
+
+=item Schlessinger, A., Liu, J., and Rost, B. (2007). Natively unstructured loops differ from other loops. PLoS Comput Biol, 3(7), e140.
+
+=back
+
+=head1 OPTIONS
+
+=over
+
+=item FASTA_FILE
+
+file containing protein amino-acid sequence in fasta format.
+
+=item RDBPROF_FILE
+
+Secondary structure and solvent accessibility prediction by PROF in rdb format. 
+
+=item HSSP_FILE
+
+PSI-BLAST alignment profile file converted to HSSP format
+
+=item OUTPUT_FILE
+
+The name of the final NORSnet output file. 
+
+=item PROFBVAL_FILE
+
+Flexibile/rigid residues prediction by profbval(1) in rdb format (mode 5). 
+
+=item OUTPUT_MODE
+
+NORSnet can create output files in different formats for different purposes. Valid modes are `1', `2' or `3'. Default mode: I<1>.
+
+=over
+
+=item -
+
+Default mode. Use this when you do not want to give a value here but you want to specify B<debug>.
+
+=item 1
+
+for metadisorder(1)
+
+=back
+
+=item DEBUG
+
+Set to 1 for debugging messages
+
+=back
+
+=head1 OUTPUT
+
+=over
+
+=item number -
+
+residue number
+
+=item residue -
+
+residue type
+
+=item raw -
+
+raw value of the different between the two output nodes
+
+=back
+
+=head1 EXAMPLES
+
+ norsnet __pkgdatadir__/example/cad23.f __pkgdatadir__/example/cad23-fil.rdbProf __pkgdatadir__/example/cad23-fil.hssp cad23.norsnet cad23 __pkgdatadir__/example/cad23.profbval
+
+=head1 ENVIRONMENT
+
+=over
+
+=item NORSNET_ROOT
+
+Overrides __pkgdatadir__, the path to helper scripts and data files.
+
+=back
+
+=head1 FILES
+
+=over
+
+=item F<*.norsnet>
+
+default output file extension
+
+=item F<__pkgdatadir__/example>
+
+default precomputed input files directory
+
+=back
+
+=head1 NOTES
+
+=over
+
+=item 1. It is recommended to create the profiles using 3 iteration of PSI-BLAST against big database
+
+=item 2. It is also recommended to filter the hssp files using hssp_filter.pl from the Prof package using the following command: perl hssp_filter.pl hssp_file red=80 
+
+=back
+
+=head1 AUTHOR
+
+A. Schlessinger <avnersch at gmail.com>
+
+=head1 COPYRIGHT AND LICENSE
+
+NON COMMERCIAL SOFTWARE LICENSE AGREEMENT
+
+1. GENERAL.
+
+THE TERMS OF THIS LICENSE APPLY TO NON-PROFIT ORGANZIATIONS AND USERS WHO ARE EMPLOYEES OF NON-PROFIT ORGANIZAIONS. FOR PROFIT ORGANIZATION AND INDIVIDIAL USERS SHOULD CONTACT L<info at bio-sof.com> TO OBTAIN A COMMERCIAL LICENSE
+
+2. OWNERSHIP OF LICENSED PRODUCT.
+
+(a) Licensee acknowledges and agrees that the ``Licensed Product'' and all copies thereof are Licensor's exclusive property.  Licensee has no rights with respect to the Licensed Product except as set forth in this Agreement, and, without limiting the generality of the foregoing, may not distribute, resell, sublicense, assign or transfer the ``Licensed Product'' or any portion thereof, or modify, decompile, disassemble or otherwise change the Licensed Software without Licensor's prior written consent.
+
+(b) Upon any termination, cancellation, or expiration hereof, Licensee shall immediately delete the Licensed Software from all of its computer systems and destroy any copies of the Licensed Documentation in its possession.
+
+3. GRANT OF LICENSE.
+
+a. Licensor hereby grants to Licensee, and Licensee hereby accepts, a personal, Non-exclusive and non-transferable license to Use the Licensed Software at the Licensed Site during the term hereof, and to use the Licensed Documentation during such term in support of the Use of the Licensed Software. Additionally individuals who are employees or contractors of Licensee who log into computers at the Licensed Site from their personal home or while traveling, are entitled to Use the Licensed Software at such remote locations, provided that such Use is undertaken for and on behalf of the Licensee and that such employees or contractors report directly to employees of the Licensee whose usual and regular place of work is the Licensed Site.
+
+b. Other than as set forth in paragraph 3(a) above, a separate license shall be required, together with the payment of additional annual license fees and charges, to use the Licensed Software at any location other than the Licensed Site. 
+
+4. REPRODUCTION OF LICENSED PRODUCT. 
+
+Licensee may reproduce the Software for Use in accordance with the terms of the limited License granted to the Licensee in Section 2.   Reproduction of the Licensed Software for any other reason is strictly prohibited.  All copies of the Software, in whole or in part, shall contain the Licensor's restrictive and proprietary notices as they appear on the copies of Software provided by Licensor. 
+
+5. LIMITATION OF LIABILITY.
+
+a. IN NO EVENT SHALL LICENSOR BE LIABLE TO LICENSEE FOR ANY INDIRECT, SPECIAL OR CONSEQUENTIAL DAMAGES OR LOST PROFITS, ARISING OUT OF OR RELATED TO THIS LICENSE AGREEMENT OR THE PERFORMANCE OR BREACH THEREOF, EVEN IF THE LICENSOR HAS BEEN ADVISED OF THE POSSIBILITY THEREOF. 
+
+b. IN NO EVENT SHALL LICENSOR BE LIABLE TO LICENSEE FOR ANY DAMAGES RESULTING FROM OR RELATED TO ANY FAILURE OF THE SOFTWARE PRODUCTS, INCLUDING, BUT NOT LIMITED TO LOSS OF DATA, OR DELAY OF THE LICENSOR IN THE DELIVERY OF THE LICENSED PRODUCT OR IN THE PERFORMANCE OF SERVICES UNDER THIS LICENSE AGREEMENT.
+
+c. IN NO EVENT SHALL LICENSEE BE LIABLE TO LICENSOR FOR ANY LOST PROFITS, LOST OPPORTUNITY COSTS OR ANY SPECIAL, INDIRECT, CONSEQUENTIAL OR INCIDENTAL DAMAGES, HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY. 
+
+=head1 SEE ALSO
+
+=over
+
+=item profbval(1), prof(1).
+
+=item Main website
+
+L<http://www.predictprotein.org/>
+
+=back
+
+=cut
+
+# vim:et:

Added: trunk/packages/norsnet/trunk/debian/scr/Makefile.am
===================================================================
--- trunk/packages/norsnet/trunk/debian/scr/Makefile.am	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/scr/Makefile.am	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,5 @@
+scrdir = $(pkgdatadir)/scr
+dist_scr_DATA = $(srcdir)/createDataFile.pl $(srcdir)/jct50-short $(srcdir)/NORSnet.pl
+
+install-data-hook:
+	chmod +x $(DESTDIR)$(pkgdatadir)/scr/createDataFile.pl $(DESTDIR)$(pkgdatadir)/scr/NORSnet.pl

Added: trunk/packages/norsnet/trunk/debian/scr/Makefile.in
===================================================================
--- trunk/packages/norsnet/trunk/debian/scr/Makefile.in	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/scr/Makefile.in	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,354 @@
+# Makefile.in generated by automake 1.11.1 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004, 2005, 2006, 2007, 2008, 2009  Free Software Foundation,
+# Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkglibexecdir = $(libexecdir)/@PACKAGE@
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+subdir = scr
+DIST_COMMON = $(dist_scr_DATA) $(srcdir)/Makefile.am \
+	$(srcdir)/Makefile.in
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/configure.ac
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+mkinstalldirs = $(install_sh) -d
+CONFIG_CLEAN_FILES =
+CONFIG_CLEAN_VPATH_FILES =
+SOURCES =
+DIST_SOURCES =
+am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`;
+am__vpath_adj = case $$p in \
+    $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \
+    *) f=$$p;; \
+  esac;
+am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`;
+am__install_max = 40
+am__nobase_strip_setup = \
+  srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'`
+am__nobase_strip = \
+  for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||"
+am__nobase_list = $(am__nobase_strip_setup); \
+  for p in $$list; do echo "$$p $$p"; done | \
+  sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \
+  $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \
+    if (++n[$$2] == $(am__install_max)) \
+      { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \
+    END { for (dir in files) print dir, files[dir] }'
+am__base_list = \
+  sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \
+  sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g'
+am__installdirs = "$(DESTDIR)$(scrdir)"
+DATA = $(dist_scr_DATA)
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+ACLOCAL = @ACLOCAL@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+INSTALL = @INSTALL@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+MKDIR_P = @MKDIR_P@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_URL = @PACKAGE_URL@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+VERSION = @VERSION@
+abs_builddir = @abs_builddir@
+abs_srcdir = @abs_srcdir@
+abs_top_builddir = @abs_top_builddir@
+abs_top_srcdir = @abs_top_srcdir@
+am__leading_dot = @am__leading_dot@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build_alias = @build_alias@
+builddir = @builddir@
+datadir = @datadir@
+datarootdir = @datarootdir@
+docdir = @docdir@
+dvidir = @dvidir@
+exec_prefix = @exec_prefix@
+host_alias = @host_alias@
+htmldir = @htmldir@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localedir = @localedir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+pdfdir = @pdfdir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+psdir = @psdir@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+srcdir = @srcdir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+top_build_prefix = @top_build_prefix@
+top_builddir = @top_builddir@
+top_srcdir = @top_srcdir@
+scrdir = $(pkgdatadir)/scr
+dist_scr_DATA = $(srcdir)/createDataFile.pl $(srcdir)/jct50-short $(srcdir)/NORSnet.pl
+all: all-am
+
+.SUFFIXES:
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \
+	        && { if test -f $@; then exit 0; else break; fi; }; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu scr/Makefile'; \
+	$(am__cd) $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu scr/Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(am__aclocal_m4_deps):
+install-dist_scrDATA: $(dist_scr_DATA)
+	@$(NORMAL_INSTALL)
+	test -z "$(scrdir)" || $(MKDIR_P) "$(DESTDIR)$(scrdir)"
+	@list='$(dist_scr_DATA)'; test -n "$(scrdir)" || list=; \
+	for p in $$list; do \
+	  if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \
+	  echo "$$d$$p"; \
+	done | $(am__base_list) | \
+	while read files; do \
+	  echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(scrdir)'"; \
+	  $(INSTALL_DATA) $$files "$(DESTDIR)$(scrdir)" || exit $$?; \
+	done
+
+uninstall-dist_scrDATA:
+	@$(NORMAL_UNINSTALL)
+	@list='$(dist_scr_DATA)'; test -n "$(scrdir)" || list=; \
+	files=`for p in $$list; do echo $$p; done | sed -e 's|^.*/||'`; \
+	test -n "$$files" || exit 0; \
+	echo " ( cd '$(DESTDIR)$(scrdir)' && rm -f" $$files ")"; \
+	cd "$(DESTDIR)$(scrdir)" && rm -f $$files
+tags: TAGS
+TAGS:
+
+ctags: CTAGS
+CTAGS:
+
+
+distdir: $(DISTFILES)
+	@srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+	list='$(DISTFILES)'; \
+	  dist_files=`for file in $$list; do echo $$file; done | \
+	  sed -e "s|^$$srcdirstrip/||;t" \
+	      -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \
+	case $$dist_files in \
+	  */*) $(MKDIR_P) `echo "$$dist_files" | \
+			   sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \
+			   sort -u` ;; \
+	esac; \
+	for file in $$dist_files; do \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  if test -d $$d/$$file; then \
+	    dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \
+	    if test -d "$(distdir)/$$file"; then \
+	      find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+	    fi; \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \
+	      find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+	    fi; \
+	    cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \
+	  else \
+	    test -f "$(distdir)/$$file" \
+	    || cp -p $$d/$$file "$(distdir)/$$file" \
+	    || exit 1; \
+	  fi; \
+	done
+check-am: all-am
+check: check-am
+all-am: Makefile $(DATA)
+installdirs:
+	for dir in "$(DESTDIR)$(scrdir)"; do \
+	  test -z "$$dir" || $(MKDIR_P) "$$dir"; \
+	done
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+	-test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-am
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+html-am:
+
+info: info-am
+
+info-am:
+
+install-data-am: install-dist_scrDATA
+	@$(NORMAL_INSTALL)
+	$(MAKE) $(AM_MAKEFLAGS) install-data-hook
+install-dvi: install-dvi-am
+
+install-dvi-am:
+
+install-exec-am:
+
+install-html: install-html-am
+
+install-html-am:
+
+install-info: install-info-am
+
+install-info-am:
+
+install-man:
+
+install-pdf: install-pdf-am
+
+install-pdf-am:
+
+install-ps: install-ps-am
+
+install-ps-am:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-dist_scrDATA
+
+.MAKE: install-am install-data-am install-strip
+
+.PHONY: all all-am check check-am clean clean-generic distclean \
+	distclean-generic distdir dvi dvi-am html html-am info info-am \
+	install install-am install-data install-data-am \
+	install-data-hook install-dist_scrDATA install-dvi \
+	install-dvi-am install-exec install-exec-am install-html \
+	install-html-am install-info install-info-am install-man \
+	install-pdf install-pdf-am install-ps install-ps-am \
+	install-strip installcheck installcheck-am installdirs \
+	maintainer-clean maintainer-clean-generic mostlyclean \
+	mostlyclean-generic pdf pdf-am ps ps-am uninstall uninstall-am \
+	uninstall-dist_scrDATA
+
+
+install-data-hook:
+	chmod +x $(DESTDIR)$(pkgdatadir)/scr/createDataFile.pl $(DESTDIR)$(pkgdatadir)/scr/NORSnet.pl
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:

Added: trunk/packages/norsnet/trunk/debian/scr/NORSnet.pl
===================================================================
--- trunk/packages/norsnet/trunk/debian/scr/NORSnet.pl	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/scr/NORSnet.pl	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,667 @@
+#!/usr/bin/perl -w
+
+#create the first in_test. the nodes' correspond to the amino acids in the following order:
+#1-A,2-C,3-D,4-E,5-f,6-g,7-h,8-i,9-k,10-l,11-M,12-n,13-p,14-q,15-r,16-s,17-t,18-w,19-y,20-v,21-z
+#the nodes of secondary structure are:
+#1-G,2-H,3-I,4-E,5-B,6-T,7-S,8-L
+
+use Cwd;
+use File::Copy;
+if (@ARGV<5)  {
+	#                   0            1       2             3          4               5           6
+	die "\nUsage: $0 [fasta] [output_file] [mode] [profbval_file] [temp_dir] [norsnet_rootdir] [debug]\n"; ### profbval output should be the one using mode 5
+	}
+$tmp_file=$ARGV[0];
+$outFinal=$ARGV[1];
+$mode=$ARGV[2] || 1;
+$profbval_file=$ARGV[3];
+$temp_dir=$ARGV[4];
+$dir = $ARGV[5]; #program root
+my $dbg = $ARGV[6];
+
+if( $mode ne '1' && $mode ne '2' && $mode ne '3' ) { die( "invalid mode, must be one of 1, 2 or 3" ); }
+
+$win=13;
+
+ at arrTmp= split(/\//, $tmp_file);
+$file= pop @arrTmp;
+#$file=~ s/\.fasta//;
+$id= $file;
+$id=~ s/\.fasta//;
+#$nn=$dir . "/nn_files";
+#$jct="$dir/jct50-5HN-win13-ComLenAcHNexNBba2rel13";
+$jct="$dir/scr/jct50-short";
+$ON= 2;$sampIn=0;
+$IN=416;
+
+$temp=$temp_dir;
+$inTest="$temp/$id-in_test";
+$inOutTest="$temp/$id-in-out-test";
+$NNo_tst_err= $temp . "/NNo_tst_err.dat".$id;
+$NNo_yeah= $temp . "/NNo-yeah$id.tmp";
+$jct_crap=$temp . "/jct_crap$id.tmp";
+#$jctFile="jct$u-samp10states-$sampIn-Balanced-win9";
+if ($id=~/help/)  {
+	$idtemp=$id;
+	$idtemp=~s/help//;
+	$partest="$temp/$idtemp-partest";
+	}
+else {
+	$partest="$temp/$id-partest";
+	}
+$datafile="$temp/$id" . ".data";
+#$testOutFile="$temp/$id-50-5HN-416-NBba2rel13"; ## name is too long for Burkhard network >80 char including path
+$testOutFile="$temp/$id-raw-norsnet";
+undef @res;undef $end;undef at PREL;  undef @otL; undef @otE;
+undef @otH;undef @RI_A;$expCon1=$expCon2=0;undef @RI_S;undef @outPut;
+undef @secC;  $lengthA=$lengthB=$lengthC=0;
+undef @A;undef @C;undef @D;undef @E;undef @F;undef @G;undef @H;undef @I;undef @K;undef @L;
+undef @M;undef @N;undef @P;undef @Q;undef @R;undef @S;undef @T;undef @V;undef @W;undef @Y;undef @GS;
+chomp($id);undef @RI_S;undef $hydroNet;$totalDiff=0;undef @diff1;undef @diffNew;undef @diff11;
+;undef @net2;undef @net3;
+
+if (!open(FINO, '<', $profbval_file)) {
+	die( "can not open profbval file $profbval_file: $!" );
+	#rm_files();
+}
+for ($f=0; $f<43; $f++)  {
+  		 <FINO>;
+       		 }	
+loop1221:while ($line=<FINO>)  {
+       	if ($line=~ /^(.{8})(.{5})(.{4})/)  {
+               	$uno=$1;$duwe=$2; $tre=$3;
+		$uno=~ s/\s//g;$duwe=~ s/\s//g;$tre=~ s/\s//g;
+		push (@net2,$duwe); push (@net3,$tre); 
+		 $diff1=$duwe-$tre;push (@diff1,$diff1);
+		 $diff11=$diff1+100;
+		 use integer;
+		 $diff11=$diff11/2;
+		 no integer;  
+		 push (@diff11,$diff11);
+		$totalDiff=$totalDiff+$diff1;
+		}
+	}
+close (FINO);
+ at diffNew=normDiff($totalDiff,\@diff1);
+ at amino=('A','C','D','E','F','G','H','I','K','L','M','N','P','Q','R','S','T','V','W','Y');
+$compo=0;
+foreach $amino (@amino) {
+	$c{$amino}=0;
+	}
+if (!(open (FILE, "$datafile"))) {
+	#rm_files();
+	 die "can not open $datafile: $!";
+	}
+
+#<FILE>; ## the format of these Datafiles is a bit different. ## May 2008: i erased this line because here I will use the same data files that MD and profbval use
+
+while ($line=<FILE>)  {
+	@stuff=split(' ', $line);
+	$A=$stuff[1];$C=$stuff[2];$D=$stuff[3];$E=$stuff[4];$F=$stuff[5];$G=$stuff[6];$H=$stuff[7];$I=$stuff[8];
+	$K=$stuff[9];$L=$stuff[10];$M=$stuff[11];$N=$stuff[12];$P=$stuff[13];$Q=$stuff[14];$R=$stuff[15];$S=$stuff[16];
+	$T=$stuff[17];$W=$stuff[18];$Y=$stuff[19];$V=$stuff[20];			
+	$otH=$stuff[22];$otE=$stuff[23];$otL=$stuff[24];$PREL=$stuff[25];$RI_A=$stuff[26];
+	$expCon1=$stuff[27];$expCon2=$stuff[28];$lengthA=$stuff[29];$lengthB=$stuff[30];$lengthC=$stuff[31];$outPut=$stuff[32];$res=$stuff[33];
+       	push (@res,$res);
+	push (@A,$A) ;push (@C,$C);push (@D,$D);push (@E,$E);push (@F,$F);push(@G,$G);push(@H,$H);push(@I,$I);push(@K,$K);push(@L,$L);
+	push (@M,$M);push(@N,$N);push(@P,$P);push(@Q,$Q);push(@R,$R);push(@S,$S);push(@T,$T);push(@V,$V);push(@W,$W);push(@Y,$Y);			
+      	push (@otH,$otH);push (@outPut,$outPut);
+       	push (@otE,$otE);
+      	push (@secC,$secC);
+       push (@otL,$otL);
+        push (@RI_A,$RI_A);
+      	push (@Bnew,$Bnew);
+       	push (@PREL,$PREL);;$end=scalar at PREL-1;
+	$c{$res}++;
+	}
+close (FILE);
+$sampIn=scalar at A;
+if ($sampIn==0)  {die( "there is a problem with the sequence: it has only $sampIn residues" );}	 	
+$compo=scalar at res;
+if ($compo==0)  {
+	warn( "\n$file is too short, has only $compo residues" );
+	rm_files();
+	die;
+	}
+foreach $amino (@amino) {
+	$c{$amino}=int($c{$amino}/$compo*100);
+	}
+$hydroNet=hydroNet($end);
+if ($hydroNet>=8) {$hydroNet=0}
+else {$hydroNet=100}
+open (FOUT, ">", $inTest) || die "can not open $inTest: $!";
+printf FOUT "* overall: (A,T25,I8)\nNUMIN                 :      %3d\nNUMSAMFILE            :   %6d\n*",$IN,$sampIn;
+print FOUT "\n* samples: count (A8,I8) NEWLINE 1..NUMIN (25I6)\n";
+$h=1;	
+loop4:for ($i=0;$i<scalar at PREL; $i++)  {		
+	$k=0;undef @info;
+	if ($h==($sampIn + 1))  {
+		last loop4;
+		}
+	$lower=$i-($win-1)/2;
+	$higher=$i+($win-1)/2;
+#profiles information
+#	push (@info,profiles($lower,$higher,$end));
+#secondary structure prediction information
+	push (@info, secondary($lower,$higher,$end));
+#loop for solvent accessibility prediction information		
+	push (@info, acc($lower,$higher,$end));
+# global information
+#	push (@info,$RI_A[$i] );
+	push (@info, $expCon1,$expCon2);	
+#	push (@info, $Helix, $Beta, $Loop);
+	push (@info, $lengthA,$lengthB,$lengthC);
+	foreach $amino (@amino) {			
+		push (@info,$c{$amino});
+		}
+	push (@info,profiles($lower,$higher,$end));
+	push (@info,$hydroNet);
+	push (@info, getDiff($lower,$higher,$end));
+	printf FOUT "ITSAM:%10d\n",$h;
+	presentIt(\@info);
+	$h++;
+#	presentIt(\@info);		
+#	print FOUT "\n" unless $k==25;
+	}
+print FOUT "//"; 
+close(FOUT);
+if( $dbg ){ warn( "number of samples saved in memory:$h" ); } 
+#Mark2:	
+if( $dbg ){ warn( "########creating out-test file ######" ); }
+open (FOUT, ">", $inOutTest) || die "cant open file $inOutTest: $!";
+printf FOUT "* overall: (A,T25,I8)\nNUMOUT                :        $ON\nNUMSAMFILE            :%9d\n*",$sampIn;
+print FOUT "\n* samples: count (I8) SPACE 1..NUMOUT (25I6)\n";
+for ($i=0; $i<scalar at outPut;$i++)  {
+	$ii=$i+1;
+	if ($outPut[$i]==100)  {
+		$GS[$i]='G';
+		}
+	else {
+		$GS[$i]='-';
+		}
+	printf FOUT "%8d",$ii; $m=100- $outPut[$i];
+      		printf FOUT "  %5d%6d\n",$outPut[$i],$m;
+	}
+print FOUT "//"; 
+if( $dbg ){ warn "\t$i"; }
+if( $dbg ){ warn "1"; }
+close (FOUT);
+open (FOUT, ">", $partest)  || die "can't open file $partest: $!";
+print FOUT "* I8\n";
+printf FOUT "NUMIN                 :      %3d\n",$IN;
+print FOUT "NUMHID                :        5\n";
+print FOUT "NUMOUT                :        $ON\n";
+print FOUT "NUMLAYERS             :        2\n";
+printf FOUT "NUMSAM                :%9d\n",$sampIn;
+print FOUT "NUMFILEIN_IN          :        1\n";
+print FOUT "NUMFILEIN_OUT         :        1\n";
+print FOUT "NUMFILEOUT_OUT        :        1\n";
+print FOUT "NUMFILEOUT_JCT        :        1\n";
+print FOUT "STPSWPMAX             :        0\n";
+print FOUT "STPMAX                :        0\n";
+print FOUT "STPINF                :        1\n";
+print FOUT "ERRBINSTOP            :        0\n";
+print FOUT "BITACC                :      100\n";
+print FOUT "DICESEED              :   100025\n";
+print FOUT "DICESEED_ADDJCT       :        0\n";
+print FOUT "LOGI_RDPARWRT         :        1\n";
+print FOUT "LOGI_RDINWRT          :        0\n";
+print FOUT "LOGI_RDOUTWRT         :        0\n";
+print FOUT "LOGI_RDJCTWRT         :        0\n";
+print FOUT "* --------------------\n";
+print FOUT "* F15.6\n";
+print FOUT "EPSILON               :        0.001000\n";
+print FOUT "ALPHA                 :        0.010000\n";
+print FOUT "TEMPERATURE           :        1.000000\n";
+print FOUT "ERRSTOP               :        0.000000\n";
+print FOUT "ERRBIAS               :        0.000000\n";
+print FOUT "ERRBINACC             :        0.200000\n";
+print FOUT "THRESHOUT             :        0.500000\n";
+print FOUT "DICEITRVL             :        0.100000\n";
+print FOUT "* --------------------\n";
+print FOUT "* A132\n";
+print FOUT "TRNTYPE               : ONLINE\n";
+print FOUT "TRGTYPE               : SIG\n";
+print FOUT "ERRTYPE               : DELTASQ\n";
+print FOUT "MODEPRED              : sec\n";
+print FOUT "MODENET               : 1st,unbal\n";
+print FOUT "MODEIN                : win=5,loc=aa\n";
+print FOUT "MODEOUT               : KN\n";
+print FOUT "MODEJOB               : mode_of_job\n";
+print FOUT "FILEIN_IN             : $inTest\n";
+print FOUT "FILEIN_OUT            : $inOutTest\n";
+print FOUT "FILEIN_JCT            : $jct\n";
+print FOUT "FILEOUT_OUT           : $testOutFile\n";
+print FOUT "FILEOUT_JCT           : $jct_crap\n";
+print FOUT "FILEOUT_ERR           : $NNo_tst_err\n";
+print FOUT "FILEOUT_YEAH          : $NNo_yeah\n";
+print FOUT "//\n";
+
+{
+	my $cmd = "profnet_norsnet '$partest'".( !$dbg ? ' >/dev/null' : '' );
+	system( $cmd ) && die( "$cmd failed: $!, ".( $? >> 8 ));
+}
+
+undef @nors40; undef @nors40f;undef @result1;undef @result2;undef @nors59; undef @nors59f;undef @pred;
+#print "cleaning up. removing : $jct_crap $inTest $inOutTest $partest\n";
+open (F, "<", $testOutFile) ||  die "cant open raw results $testOutFile from neural network: $!";
+for ($r=0; $r<43; $r++) { <F>; }
+while ($line=<F>) { 
+	if ($line=~ /^(.{8})(.{5})(.{4})/)  {
+		$result2=$3;
+		$result1=$2;
+		$result2=~ s/\s//g;$result1=~ s/\s//g;
+		push (@result1,$result1);push (@result2,$result2);
+		$w=$result1/($result1+$result2);
+		push (@pred, $w);
+		if ($w<0.40) {
+			push (@nors40,'-');
+			}
+		else {
+			push (@nors40,'N');
+			}
+		if ($w<0.59) {
+			push (@nors59,'-');
+			}
+		else {
+			push (@nors59,'N');
+			}
+                if ($w<0.52) {
+                        push (@nors52,'-');
+                        }
+                else {
+                        push (@nors52,'N');
+                        }
+
+		}
+	}
+		
+close (F);
+if ($mode eq '1') { ### old one!!!!
+	@nors40f=filter_output(\@nors40);
+	@nors59f=filter_output(\@nors59);
+	open (FOUT2, ">", $outFinal) || die "cant open $outFinal: $!";
+	print FOUT2 "pos\tres\tnode1\tnode2\tpred\tn40\tn40fil\tn59\tn59fil\n";
+	for ($r=0;$r<scalar at pred;$r++) {
+		$r1=$r+1;
+		printf FOUT2 "$r1\t$res[$r]\t$result1[$r]\t$result2[$r]\t%1.2f\t$nors40[$r]\t$nors40f[$r]\t$nors59[$r]\t$nors59f[$r]\n",$pred[$r];
+		}
+	}
+if ($mode eq '2') {
+	my $cmd = "cp '$testOutFile' '$outFinal'";
+	system( $cmd ) && die( "$cmd failed: $!, ".( $? >> 8 ) );
+}
+if ($mode eq '3') {
+	@nors52f=filter_output(\@nors52);
+	open (FOUT2, ">", $outFinal) || die "cant open $outFinal: $!";
+        print FOUT2 "pos\tres\tnode1\tnode2\tpred\tnorsnet\tfiltered\n";
+        for ($r=0;$r<scalar at pred;$r++) {
+                $r1=$r+1;
+                printf FOUT2 "$r1\t$res[$r]\t$result1[$r]\t$result2[$r]\t%1.2f\t$nors52[$r]\t$nors52f[$r]\n",$pred[$r];
+                }
+	}
+rm_files();
+
+exit(0);
+
+#function  tha shuffles the array randomly
+sub shuffle  {
+	my($ref) = shift;
+	my(@array) = @{$ref};
+	my @temp;
+	push (@temp,splice(@array,rand(@array),1))
+		while @array;
+	@array=@temp;
+	return @array;
+	}
+sub generate_rand  {
+	my($ref) = shift;
+	my(@array) = @{$ref};
+	my $x;
+	$x= $array[int(rand(scalar(@array)))];
+	return $x;
+	}
+sub presentIt  {
+        my($ref) = shift;
+        my(@residue) = @{$ref};
+	my $l;
+	for ($l=0; $l<scalar(@residue); $l++)  {
+		$residue[$l]=~s/\s//;
+		if (defined($residue[$l])==0)
+		 {
+		 	if( $dbg ){ warn "\n$file\t$i\t$j\t$l"; }
+			}
+#		if ($residue[$l]=~/[a-z]|A-Z]/ )  {
+#			print "\n$residue[$l]\t$file\t$i\t$j\t$l";
+#			}
+		printf FOUT "%6d",$residue[$l];
+		$k++;
+		if ($k==25)  {
+			print FOUT "\n";
+			$k=0;
+			}
+		}
+	print FOUT "\n"; $k=0;
+	return;
+	}
+#functions to obtain properties    
+#profiles
+#functions to obtain properties    
+sub profiles  {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @residue; 
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		if (($j<0) ||($j>$end)) {
+			undef @residue;
+			@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100);
+			push (@array, @residue);
+			}
+		else {
+			undef @residue;
+			@residue=($A[$j],$C[$j],$D[$j],$E[$j],$F[$j],$G[$j],$H[$j],$I[$j],$K[$j],$L[$j],$M[$j],$N[$j],$P[$j],$Q[$j],$R[$j],$S[$j],$T[$j],$W[$j],$Y[$j],$V[$j],0);
+			push (@array, @residue);
+			}
+		}
+		return @array;
+	}
+#secondary structure prediction information
+sub secondary  {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @secon;
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		if (($j<0) ||($j>$end)) {
+			undef @secon;
+			@secon=(100,100,100);
+			push (@array, @secon);
+			}
+		else {
+			undef @secon;
+			@secon=($otL[$j],$otH[$j],$otE[$j]);
+			push (@array, @secon);
+			}
+		}
+	return @array;
+	}
+#function for solvent accessibility prediction information		
+sub acc  {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @PRE;
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		if (($j<0) ||($j>$end)) {
+			undef @PRE;
+			@PRE=(100,100);
+			push (@array, @PRE);
+			}
+		else {
+			undef @PRE;
+			@PRE=($PREL[$j],$RI_A[$j]);
+			push (@array, @PRE);		
+			}
+		}
+	return @array;
+	}
+
+sub max
+{
+   my $number1=shift;
+    my $number2=shift;  
+    my $number3=shift; 
+    my(@numbers);
+    push (@numbers,$number1, $number2,  $number3);
+    my ($max);
+    $max = $numbers[0];
+    foreach my $i (@numbers)
+    {
+        if ($i >=$max)
+        {
+            $max = $i;
+        }
+    }
+    return ($max);
+}				
+sub gaa {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @residue; 
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		if (($j<0) ||($j>$end)) {
+			undef @residue;
+			@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100);
+			push (@array, @residue);
+			}
+		else {
+			undef @residue;
+			if ($res[$j] eq 'C') {
+				@residue=(100,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'F') {
+				@residue=(0,100,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'M') {
+				@residue=(0,0,100,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'I') {
+				@residue=(0,0,0,100,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'G') {
+				@residue=(0,0,0,0,100,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'P') {
+				@residue=(0,0,0,0,0,100,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}				
+			elsif ($res[$j] eq 'A') {
+				@residue=(0,0,0,0,0,0,100,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}				
+			elsif  ($res[$j] eq 'H'){
+				@residue=(0,0,0,0,0,0,0,100,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'Q') {
+				@residue=(0,0,0,0,0,0,0,0,100,0,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'R') {
+				@residue=(0,0,0,0,0,0,0,0,0,100,0,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'W') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,100,0,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'L') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,100,0,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'Y') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,100,0,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'T') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,100,0,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'K') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,100,0,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'S') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100,0,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'N') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100,0,0,0,0);
+				}
+			elsif ($res[$j] eq 'V') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100,0,0,0);
+				}
+				
+			elsif ($res[$j] eq 'D') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100,0,0);
+				}
+				
+			elsif ($res[$j] eq 'E') {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100,0);
+				}
+			else {
+				@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0);
+				}				
+			push (@array, @residue);
+			}
+		}
+		return @array;
+	}
+sub hydroNet  {
+	my $end= shift;
+	my $i; my @res_ww;my $count=0; my $sum=0; my $avg; my $hydroNet; my $charge=0;
+	my $window; my $length=scalar at res; my $hydro=0;
+loop1001:for ($i=0;$i<scalar at res;$i++) {
+		$window=5; ## because in loop1010 whenever there is an 'X' i deduct 1 from the $window
+		$sum=0;
+		if (($res[$i] eq 'E') || ($res[$i] eq 'D') )  {
+			$charge--;
+			}
+		elsif (($res[$i] eq 'K') || ($res[$i] eq 'R') ) {
+			$charge++;
+			}
+		elsif ($res[$i] eq 'X') {
+			$length--;
+			}			
+		my $lower=$i-2;
+		my $higher=$i+2;
+loop1010:	for ($j=$lower; $j<=$higher; $j++)  { # the hydrophobicity per residue is calculated in window=5
+			if (($j<0) ||($j>(scalar at res-1))) {
+				next loop1001;
+				}
+			if ($res[$j] eq "A") {$res_ww[$j] = -1.8;} 
+ 			elsif ($res[$j] eq "L") {$res_ww[$j] = -3.8;}
+ 		 	elsif ($res[$j] eq "R") {$res_ww[$j] = 4.5;}
+ 		 	elsif ($res[$j] eq "K") {$res_ww[$j] = 3.9;}
+ 		 	elsif ($res[$j] eq "N") {$res_ww[$j] = 3.5;}
+ 		 	elsif ($res[$j] eq "M") {$res_ww[$j] = -1.9;}
+ 		 	elsif ($res[$j] eq "D") {$res_ww[$j] = 3.5;}
+ 			 elsif ($res[$j] eq "F") {$res_ww[$j] = -2.8;}
+ 			 elsif ($res[$j] eq "C") {$res_ww[$j] = -2.5;}
+ 			 elsif ($res[$j] eq "P") {$res_ww[$j] = 1.6;}
+ 			 elsif ($res[$j] eq "Q") {$res_ww[$j] = 3.5;}
+			  elsif ($res[$j] eq "S") {$res_ww[$j] = 0.8;}
+			  elsif ($res[$j] eq "E") {$res_ww[$j] = 3.5;}
+			  elsif ($res[$j] eq "T") {$res_ww[$j] = 0.7;}
+			  elsif ($res[$j] eq "G") {$res_ww[$j] = 0.4;}
+			  elsif ($res[$j] eq "W") {$res_ww[$j] = 0.9;}
+			  elsif ($res[$j] eq "H") {$res_ww[$j] = 3.2;}
+			  elsif ($res[$j] eq "Y") {$res_ww[$j] = 1.3;}
+			  elsif ($res[$j] eq "I") {$res_ww[$j] = -4.5;}
+			  elsif ($res[$j] eq "V") {$res_ww[$j] = -4.2;}
+			  else{
+			  	$window--; ##not to count X,
+				next loop1010;
+				}
+			  $sum=$sum+($res_ww[$j]+4.5)/9; ## addition 0f 4.5 to make it 0-9 and then dividing by 9 to make it a fraction
+			}
+		if ($window==0)  {
+				next loop1001;
+				}
+		$hydro=$hydro + $sum/$window; # $hydro is the hydrophobicity of the whole protein
+		}
+		$netCharge=$charge;
+		if ($netCharge<0)  {
+			$netCharge=-$netCharge;
+			}
+		elsif ($netCharge==0)  {
+			return 100;
+			}
+		$hydroNet=$hydro/$netCharge*100/$length;;
+		use integer;
+		$hydroNet=$hydroNet*1;
+		no integer;
+		return $hydroNet;
+	}
+sub normDiff {
+	my $totalDiff=shift;
+        my($ref) = shift;
+        my(@diff) = @{$ref};
+	my $l=scalar at diff;
+	my $k;my $sum=0;my $sigma;my @diffNew;
+	my $avg=$totalDiff/$l;
+	for ($k=0;$k<scalar at diff;$k++)  {
+		$sum= $sum + ($diff[$k]- $avg)*($diff[$k]- $avg);
+		}
+	$sigma= sqrt($sum/($l-1));
+	for ($k=0;$k<scalar at diff;$k++)  {
+		$diffNew[$k]=($diff[$k]-$avg)/$sigma;
+		}	
+	return (@diffNew);
+	}
+sub getDiff  {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @diff100;
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		undef @diff100;
+		if (($j<0) ||($j>$end)) {
+			@diff100=(0,0,0,100);
+			}
+		else {	
+			if ($diffNew[$i]>1.2) {
+				@diff100=(100,0,$diff11[$j],0);
+				}
+			elsif (($diffNew[$i]<1.2) && ($diffNew[$i]>-1.3)) {
+				@diff100=(50,50,$diff11[$j],0);
+				}
+			else {
+				@diff100=(0,100,$diff11[$j],0);
+				}
+				
+			}
+		push (@array, at diff100);
+		}
+	return @array;
+	}
+sub rm_files {
+	my @files;my $f;
+	opendir(DIR, $temp) || die( "failed to open dir $temp: $!" );
+	@files= (grep /$id/, readdir(DIR));
+	closedir(DIR);
+	foreach $f (@files) {
+		#print "\n$temp/$f\n";
+		#system ("cat $temp/$f");
+		unlink( "$temp/$f" );
+	}
+}
+
+sub filter_output {
+	my($ref) = shift;
+        my @unfil = @$ref;
+        my @filter;
+	my $count; my $v; my $u; my $start; my $end;my $r;
+	$v=$count=0;
+        for ($r=0;$r<scalar at unfil;$r++) {
+        	$filter[$r]='-';
+                if ($unfil[$r] eq '-') {
+                     	$count=0;$v=0;
+                        next;
+                        }
+                else {
+                        $count++;
+                        if ($count>30){
+                                if ($v==0)  {
+                                        $v++;
+                                        #$nors=1;
+                                        $start=$r-30;
+                                        $end=$r;
+                                        for ($u=$start;$u<=$end;$u++) {
+                                                $filter[$u]='N';
+                                                }
+                                        }
+                                else {
+                                        $filter[$r]='N';
+                                        }
+                                }
+                          }
+                }
+	return(@filter);
+	}


Property changes on: trunk/packages/norsnet/trunk/debian/scr/NORSnet.pl
___________________________________________________________________
Added: svn:executable
   + *

Added: trunk/packages/norsnet/trunk/debian/scr/createDataFile.pl
===================================================================
--- trunk/packages/norsnet/trunk/debian/scr/createDataFile.pl	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/scr/createDataFile.pl	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,279 @@
+#!/usr/bin/perl -w
+use Cwd;
+use File::Copy;
+use Carp;
+if (@ARGV<3)  {
+	#                   0         1       2      3          4
+	die "\nUsage: $0 [fasta] [rdbProf] [hssp] [workdir] [debug]\n";
+}
+$file=$ARGV[0]; #fasta
+$file1 = $ARGV[1]; #rdbProf
+$hsspfil=$ARGV[2];  #hssp
+$bvaldir=$ARGV[3];
+my $dbg = $ARGV[4];
+
+if( $dbg ){ warn( "file=$file\tfile1=$file1\thsspfil=$hsspfil" ); }
+
+ at arrTmp= split(/\//, $file);
+
+$fileroot= pop @arrTmp;
+$fileroot=~ s/\.fasta//;
+#print "fileroot=$fileroot\n";
+#$dir = $ENV{PP_NORSNET} || $ENV{PP_PUB}."/norsnet" || "/home/hlrb2/pr23xi/lu64git/Programs/predictprotein/pub/norsnet/";
+
+#$fasta=$file;
+#$blastpgp="$fileroot" . ".blastpgp";
+#$hssp= "$fileroot" . ".hssp";
+#$saf=  "$fileroot" . ".saf";
+#$hsspfil="$fileroot-fil.hssp";
+#$file1= "$fileroot-fil.rdbProf";
+#print "### Blasting\n";
+#system ("/home2/pub/molbio/blast/blastpgp -i $fasta -j 3 -d /data/blast/big -o $blastpgp ");
+#print "### Converting to SAF format\n";
+#system ("perl /home2/pub/molbio/perl/blast2saf.pl $blastpgp maxAli=3000 eSaf=1");
+#system ("mv *.saf saf/");
+#print "### Converting to HSSP format\n";
+#system ("/home2/rost/pub/prof/scr/copf.pl $saf hssp");
+#system ("mv *.hssp hssp/");
+#print "### Filtering HSSP file\n";
+#system ("/home2/rost/pub/prof/scr/hssp_filter.pl $hssp red=80");
+#system ("mv *.hssp hssp/");
+#print "### Running PROF\n";
+#system ("/home2/rost/pub/prof/prof $hsspfil");
+
+#warn( "### DONE work on $fileroot?!" );
+$dataFile= $fileroot . ".data";
+
+open (FOUT, ">", "$bvaldir/$dataFile") || die( "can't open file $bvaldir/$dataFile: $!" );
+undef @res;undef @res;undef $end;undef at PREL; undef @PACC, undef @otL; undef @otE;
+undef @otH;undef @RI_A;$exp=0;$s=0;$v=0;$expCont=0;undef @RI_A2;undef @RI_S;
+undef @secC; $secC=$Helix=$Beta=$Loop=0; $lengthA=$lengthB=$lengthC=0;undef @resNum;
+undef @A;undef @C;undef @D;undef @E;undef @F;undef @G;undef @H;undef @I;undef @K;undef @L;
+undef @M;undef @N;undef @P;undef @Q;undef @R;undef @S;undef @T;undef @V;undef @W;undef @Y;undef @meida;
+if( $dbg ){ warn( "dir=$bvaldir/$dataFile" ); }
+if (!open(FILE, "$file1"))  {
+	die "cant open $file1";
+}
+while ($line=<FILE>) {####################change this loop see file arath_fr13110##############
+	if ($line=~/^No\tAA/o){ last; }
+}
+#find the right columns
+	@meida= split(/\t/o,$line);
+	for ($o=0; $o<scalar(@meida); $o++)  {
+		if ($meida[$o] eq 'No')  {
+			$NoM=$o;
+			}
+		elsif ($meida[$o] eq 'AA')  {
+			$AAM=$o;
+			}			
+		elsif ($meida[$o] eq 'PHEL')  {
+			$PHELM=$o;
+			}				
+		elsif ($meida[$o] eq 'RI_S')  {
+			$RI_SM=$o;
+			}
+		elsif ($meida[$o] eq 'PACC')  {
+			$PACCM=$o;
+			}				
+		elsif ($meida[$o] eq 'PREL')  {
+			$PRELM=$o;
+			}				
+		elsif ($meida[$o] eq 'RI_A')  {
+			$RI_AM=$o;
+			}
+		elsif ($meida[$o] eq 'OtH')  {
+			$otHM=$o;
+			}									
+		elsif ($meida[$o] eq 'OtE')  {
+			$otEM=$o;
+			}				
+		elsif ($meida[$o] eq 'OtL')  {
+			$otLM=$o;
+			last;
+			}
+		}
+loop3:while ($line=<FILE>)  {
+	undef @info;
+	$line=~ s/\n//;
+	@info=split (/\t/,$line);
+	$resNum=$info[$NoM]; $res=$info[$AAM];$secC=$info[$PHELM];$otH=$info[$otHM]; $otE=$info[$otEM]; $otL=$info[$otLM]; $RI_S=$info[$RI_SM]; $PACC=$info[$PACCM];$RI_A=$info[$RI_AM];
+	$PREL=$info[$PRELM];
+	if ($secC eq 'E')  { $Beta++;}
+	elsif ($secC eq 'H')  {$Helix++;}
+	else {$Loop++;}
+	if ($PREL>=5) {$exp++;}
+	if (($resNum=~/[a-z]|A-Z]/ ) ||($otH=~/[a-z]|A-Z]/ )||($otE=~/[a-z]|A-Z]/ )||($otL=~/[a-z]|A-Z]/ )||($RI_S=~/[a-z]|A-Z]/ )||($PACC=~/[a-z]|A-Z]/ )||($RI_A=~/[a-z]|A-Z]/ )||($PREL=~/[a-z]|A-Z]/ )){
+		if( $dbg ){ warn( "\n*******@info\t$file*******" ); }
+		}
+	push (@res,$res); push (@otH,$otH); push (@otE,$otE); push (@secC,$secC); push (@otL,$otL); push (@PACC,$PACC/3);push (@RI_S,$RI_S);
+	push (@PREL,$PREL);$RI_A2=$RI_A; push (@RI_A2,$RI_A2); $RI_A=$RI_A/9*100;push (@resNum,$resNum);
+	use integer;
+	$RI_A=$RI_A*1;
+	push (@RI_A,$RI_A);
+	no integer;
+	}
+close (FILE);
+
+if( $dbg ){ for (@res) { warn( "line ".__LINE__.": $_\n" ); } }
+
+
+if (scalar at res<11) {
+	die "sequence is too short";
+	}
+$exp=$exp/(scalar at PREL)*100;
+use integer;
+$expCont=$exp*1;
+no integer;
+$win=1;
+if (scalar at res<60)  {$lengthA=100;$lengthB=0;$lengthC=0;}
+elsif ((scalar at res>=60) &&(scalar at res<90)) {$lengthA=50;$lengthB=50;$lengthC=0;}
+elsif ((scalar at res>=90) &&(scalar at res<180)) {$lengthA=0;$lengthB=100;$lengthC=0;}
+elsif ((scalar at res>=180) &&(scalar at res<240)) {$lengthA=0;$lengthB=50;$lengthC=50;}
+else {$lengthA=0;$lengthB=0;$lengthC=100;}
+$end=(scalar at res)-($win-1)/2;
+close (FILE);
+if (!open(FILE, "$hsspfil"))  {
+	die "nein lustig, cant open $hsspfil $!";
+	}
+loop155:while ($line=<FILE>)  {
+	if ($line=~ /^## SEQUENCE PROFILE AND ENTROPY/)  {
+		last loop155;
+		}
+	}
+<FILE>;
+while ($line=<FILE>)  {
+	if ($line=~ /^\/\/\n/)  {last;}
+	$V[$s]=substr($line, 12,4);$V[$s]=~ s/\s//g;
+	$L[$s]=substr($line, 16,4);$L[$s]=~ s/\s//g;
+	$I[$s]=substr($line, 20,4);$I[$s]=~ s/\s//g;
+	$M[$s]=substr($line, 24,4);$M[$s]=~ s/\s//g;		
+	$F[$s]=substr($line, 28,4);$F[$s]=~ s/\s//g;
+	$W[$s]=substr($line, 32,4);$W[$s]=~ s/\s//g;		
+	$Y[$s]=substr($line, 36,4);$Y[$s]=~ s/\s//g;
+	$G[$s]=substr($line, 40,4);$G[$s]=~ s/\s//g;		
+	$A[$s]=substr($line, 44,4);$A[$s]=~ s/\s//g;
+	$P[$s]=substr($line, 48,4);$P[$s]=~ s/\s//g;		
+	$S[$s]=substr($line, 52,4);$S[$s]=~ s/\s//g;
+	$T[$s]=substr($line, 56,4);$T[$s]=~ s/\s//g;
+	$C[$s]=substr($line, 60,4);$C[$s]=~ s/\s//g;		
+	$H[$s]=substr($line, 64,4);$H[$s]=~ s/\s//g;
+	$R[$s]=substr($line, 68,4);$R[$s]=~ s/\s//g;		
+	$K[$s]=substr($line, 72,4);$K[$s]=~ s/\s//g;
+	$Q[$s]=substr($line, 76,4);$Q[$s]=~ s/\s//g;
+	$E[$s]=substr($line, 80,4);$E[$s]=~ s/\s//g;		
+	$N[$s]=substr($line, 84,4);$N[$s]=~ s/\s//g;
+	$D[$s]=substr($line, 88,4);$D[$s]=~ s/\s//g;
+	$s++;
+	}
+close (FILE); $v=scalar at V; $r=scalar at res;
+if (scalar(@V)!=scalar at res) { 
+	die  "\n$file *************** $v $r\n";
+	}	
+for ($i=0;$i<scalar at res; $i++)  {
+	$DISO=0;
+	undef @info;
+#	$sample++; if ($sample==($sampNumber + 1))  {last loop2;}
+	undef @info;
+	$lower=$i-($win-1)/2;
+	$higher=$i+($win-1)/2;;
+#profiles information
+	push (@info,profiles($lower,$higher,$end));
+#secondary structure prediction information
+	push (@info, secondary($lower,$higher,$end));
+#loop for solvent accessibility prediction information		
+	push (@info, acc($lower,$higher,$end));
+# global information
+	push (@info, $expCont,(100-$expCont));	
+#	push (@info, $Helix, $Beta, $Loop);
+	push (@info, $lengthA,$lengthB,$lengthC);
+	push (@info,$DISO);push (@info,$res[$i]);
+	print FOUT "$resNum[$i] ";		
+	presentIt(\@info);
+	}
+close (FOUT);
+
+sub presentIt  {
+        my($ref) = shift;
+        my(@residue) = @{$ref};
+	my $l;
+	for ($l=0; $l<scalar(@residue); $l++)  {
+		$residue[$l]=~s/\s//;
+		if (defined($residue[$l])==0)
+		 {
+		 	if( $dbg ){ warn( "\n$file\t$i\t$j\t$l" ); }
+			}
+		if ($residue[$l]=~/[a-z]|A-Z]/ )  {
+			if( $dbg ){ warn( "\n$residue[$l]\t$file\t$i\t$j\t$l" ); }
+			}
+		print FOUT "$residue[$l] ";
+#		print "$residue[$l] ";
+		}
+	print FOUT "\n";
+	return;
+	}
+#system ("rm $blastpgp $hssp $saf $hsspfil $file1");
+#functions to obtain properties    
+#profiles
+sub profiles  {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @residue; 
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		if (($j<0) ||($j>$end)) {
+			undef @residue;
+			@residue=(0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,100);
+			push (@array, @residue);
+			}
+		else {
+			undef @residue;
+			@residue=($A[$j],$C[$j],$D[$j],$E[$j],$F[$j],$G[$j],$H[$j],$I[$j],$K[$j],$L[$j],$M[$j],$N[$j],$P[$j],$Q[$j],$R[$j],$S[$j],$T[$j],$W[$j],$Y[$j],$V[$j],0);
+			push (@array, @residue);
+			}
+		}
+		return @array;
+	}
+#secondary structure prediction information
+sub secondary  {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @secon;
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		if (($j<0) ||($j>$end)) {
+			undef @secon;
+			@secon=(100,100,100);
+			push (@array, @secon);
+			}
+		else {
+			undef @secon;
+			@secon=($otH[$j],$otE[$j],$otL[$j],);
+			push (@array, @secon);
+			}
+		}
+	return @array;
+	}
+#function for solvent accessibility prediction information		
+sub acc  {
+	my $lower=shift;
+	my $higher=shift;
+	my $end= shift;
+	my @PRE;
+	my @array;
+	for ($j=$lower; $j<=$higher; $j++)  {
+		if (($j<0) ||($j>$end)) {
+			undef @PRE;
+			@PRE=(100,100);
+			push (@array, @PRE);
+			}
+		else {
+			undef @PRE;
+			@PRE=($PREL[$j],$RI_A[$j]);
+			push (@array, @PRE);		
+			}
+		}
+	return @array;
+	}
+


Property changes on: trunk/packages/norsnet/trunk/debian/scr/createDataFile.pl
___________________________________________________________________
Added: svn:executable
   + *

Added: trunk/packages/norsnet/trunk/debian/scr/jct50-short
===================================================================
--- trunk/packages/norsnet/trunk/debian/scr/jct50-short	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/scr/jct50-short	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,258 @@
+* NNout_jct           file from FORTRAN NN.f (junctions)
+*    
+*    -------------------------------
+*    Output from neural network (NN)
+*    -------------------------------
+*     
+*    author: Burkhard Rost, Columbia Univ NYC / LION Heidelberg
+*    fax:    +1-212-305-7932
+*    email:  rost at columbia.edu
+*    www:    http://cubic.bioc.columbia.edu/
+*     
+*    All rights reserved.
+*     
+*    date:   
+*    
+*    
+*    MODEPRED                     sec
+*    MODENET                      1st,unbal
+*    MODEIN                       win=5,loc=aa
+*    MODEJOB                      mode_of_job
+*    TRN-, TRG-, ERRTYPE              ONLINE,       SIG,   DELTASQ 
+*    NUMIN, -HID, -OUT                 416,       5,       2 
+*    NUMSAM                         218544
+*    STPSWPMAX, -MAX, -INF             200,   30000,   30000 
+*    ERRBINSTOP, -STOP                   0,  0.0000
+*    EPSILON, ALPHA, TEMP           0.0010,  0.0100,  1.0000 
+*    
+* --------------------
+* overall: (A,T25,I8)
+NUMIN:                       416
+NUMHID:                        5
+NUMOUT:                        2
+MODEPRED:               sec
+MODENET:                1st,unbal
+MODEJOB:                mode_of_job
+MODEIN:                 win=5,loc=aa
+MODEOUT:                KN
+* --------------------
+* jct 1st layer: row=numhid (10F10.4), col=(numin+1)
+    0.0958   -0.0342   -0.1017   -0.2069    0.0901    0.0495   -0.0345   -0.0143    0.0600   -0.0990
+    0.0579    0.1332   -0.0084    0.0417   -0.0364    0.0159    0.0486   -0.0321   -0.0582    0.0355
+   -0.0174   -0.0430    0.0683   -0.0428   -0.0031    0.0434   -0.0386   -0.0148    0.0900   -0.0432
+   -0.0049   -0.0750    0.0335   -0.1091    0.0804   -0.0038    0.0097    0.0662    0.1558   -0.0141
+   -0.0159   -0.0671    0.1078   -0.0451    0.0325   -0.1167    0.0808   -0.0528    0.0843   -0.1151
+    0.0851   -0.0538    0.0086   -0.0498    0.0852   -0.0972   -0.0300   -0.0859    0.0794   -0.1090
+    0.0808   -0.0889    0.0498   -0.0864    0.0120    0.0792   -0.0525   -0.1154    0.1155    0.0866
+   -0.3252   -0.0118   -0.0154    0.1644   -0.3388   -0.1341   -0.0304   -0.5890    0.0132   -0.3336
+   -0.0805   -0.1437    0.9685    0.1895    0.1898    1.3200   -0.0862   -0.5453   -0.2758   -0.4315
+   -0.0169    0.0779    0.0570    0.0099    0.0338   -0.0340    0.0150    0.0207    0.0242    0.0236
+   -0.0094   -0.0772    0.0726    0.0028    0.0671    0.0424    0.0009    0.0258   -0.0840    0.0874
+    0.0691   -0.0104   -0.0257   -0.0035    0.0698   -0.0812   -0.0240   -0.0036   -0.0216   -0.0848
+    0.0741    0.0240    0.1100   -0.0293   -0.0440   -0.0026    0.0305    0.0462   -0.0601   -0.0984
+    0.0491    0.1196    0.0317   -0.0408   -0.0095   -0.0173   -0.0633    0.0581   -0.0760   -0.0762
+   -0.0084   -0.0935   -0.0299    0.0683   -0.0063    0.1019   -0.0212    0.0803   -0.0579   -0.0730
+   -0.0083   -0.0452   -0.0388    0.0249    0.0509    0.0646   -0.0013   -0.0402   -0.0031    0.0938
+   -0.0817   -0.0342   -0.0122   -0.0979    0.0029    0.0346    0.0485    0.0269   -0.0035    0.0423
+   -0.0023   -0.1089   -0.0465    0.0381    0.0294    0.0691   -0.0067    0.0668    0.0646    0.0858
+    0.0202   -0.0809    0.0505    0.0561   -0.0480   -0.0537   -0.0146    0.0243   -0.0277    0.0822
+   -0.0111   -0.0092    0.0386    0.0153   -0.0335    0.5480   -0.1725   -0.4077    0.0052   -0.0149
+    0.0622    0.0931   -0.0960   -0.1593   -0.0334   -0.0462   -0.0886   -0.0149    0.0112   -0.0775
+    0.0249    0.0377   -0.1395    0.0707   -0.0856   -0.1581    0.0384    0.0668   -0.1823   -0.0042
+   -0.0077   -0.2128    0.1593    0.0252   -0.2480    0.1137   -0.0776   -0.0944    0.0854   -0.0582
+   -0.1328    0.2956   -0.2038   -0.1764    0.2131   -0.1643   -0.1151    0.0082    0.0346   -0.0562
+   -0.0829   -0.0800   -0.0355   -0.0609   -0.0457   -0.0671   -0.0146   -0.0598    0.1408   -0.1041
+   -0.0129   -0.0100    0.0588   -0.0553    0.0441   -0.0082    0.1233   -0.0889    0.1226   -0.1260
+   -0.0213   -0.0436   -0.3253    0.0209   -0.0227   -0.6314   -0.2974   -0.2025    0.4282   -0.5880
+   -0.2830    0.1031   -1.0311    0.0475   -0.5603   -0.0497   -0.0774    1.8718    0.4981    0.4581
+    2.4816   -0.0665   -0.9416   -0.3371   -0.7863    0.0338    0.0896   -0.0360    0.1619   -0.0357
+   -0.1416   -0.0034   -0.1008    0.1329   -0.0203   -0.0500   -0.1240    0.0889    0.1302    0.0323
+    0.2818    0.0624   -0.1940   -0.0140   -0.0048    0.0072   -0.0543   -0.1007   -0.0108    0.0821
+   -0.0237    0.0460    0.0095   -0.1058    0.0030    0.0241   -0.0257   -0.0614   -0.0361    0.0143
+    0.0492    0.1181    0.0085   -0.0479   -0.0667   -0.1297    0.0663    0.0369   -0.1459    0.1197
+    0.0845   -0.0839    0.0181    0.0573   -0.2424    0.0758   -0.1496    0.0795   -0.0016    0.1050
+    0.1834    0.0633    0.1309    0.0214   -0.0671   -0.0347   -0.0577    0.0077   -0.0242   -0.0971
+   -0.0279    0.0415   -0.0821   -0.0451   -0.0642   -0.0400    0.0833   -0.0191   -0.0933   -0.0700
+    0.0105    0.0648    0.0049    0.1751   -0.0154   -0.0326   -0.2018    0.0100    0.2068   -0.0325
+   -0.0698    0.0618    0.0430   -0.0879   -0.1127   -0.0648   -0.2049    0.0350   -0.1017    0.0876
+    0.0922   -0.0581    0.0176    0.0219    0.0645    0.0387   -0.1876   -0.2011   -0.0529    0.0379
+    0.0207   -0.1639    0.0042    0.0534    0.0372   -0.0195    0.0825    0.0611   -0.0749    0.0050
+   -0.0207    0.0141    0.1223   -0.0689    0.0275    0.1271    0.0289   -0.0301    0.1592   -0.0134
+    0.0149    0.0269   -0.1471    0.0260    0.0315   -0.0146   -0.1079
+    0.5480   -0.1725   -0.4077    0.0052   -0.0149    0.0622    0.0931   -0.0960   -0.1593   -0.0334
+   -0.0462   -0.0886   -0.0149    0.0112   -0.0775    0.0249    0.0377   -0.1395    0.0707   -0.0856
+   -0.1581    0.0384    0.0668   -0.1823   -0.0042   -0.0077   -0.2128    0.1593    0.0252   -0.2480
+    0.1137   -0.0776   -0.0944    0.0854   -0.0582   -0.1328    0.2956   -0.2038   -0.1764    0.2131
+   -0.1643   -0.1151    0.0082    0.0346   -0.0562   -0.0829   -0.0800   -0.0355   -0.0609   -0.0457
+   -0.0671   -0.0146   -0.0598    0.1408   -0.1041   -0.0129   -0.0100    0.0588   -0.0553    0.0441
+   -0.0082    0.1233   -0.0889    0.1226   -0.1260   -0.0213   -0.0436   -0.3253    0.0209   -0.0227
+   -0.6314   -0.2974   -0.2025    0.4282   -0.5880   -0.2830    0.1031   -1.0311    0.0475   -0.5603
+   -0.0497   -0.0774    1.8718    0.4981    0.4581    2.4816   -0.0665   -0.9416   -0.3371   -0.7863
+    0.0338    0.0896   -0.0360    0.1619   -0.0357   -0.1416   -0.0034   -0.1008    0.1329   -0.0203
+   -0.0500   -0.1240    0.0889    0.1302    0.0323    0.2818    0.0624   -0.1940   -0.0140   -0.0048
+    0.0072   -0.0543   -0.1007   -0.0108    0.0821   -0.0237    0.0460    0.0095   -0.1058    0.0030
+    0.0241   -0.0257   -0.0614   -0.0361    0.0143    0.0492    0.1181    0.0085   -0.0479   -0.0667
+   -0.1297    0.0663    0.0369   -0.1459    0.1197    0.0845   -0.0839    0.0181    0.0573   -0.2424
+    0.0758   -0.1496    0.0795   -0.0016    0.1050    0.1834    0.0633    0.1309    0.0214   -0.0671
+   -0.0347   -0.0577    0.0077   -0.0242   -0.0971   -0.0279    0.0415   -0.0821   -0.0451   -0.0642
+   -0.0400    0.0833   -0.0191   -0.0933   -0.0700    0.0105    0.0648    0.0049    0.1751   -0.0154
+   -0.0326   -0.2018    0.0100    0.2068   -0.0325   -0.0698    0.0618    0.0430   -0.0879   -0.1127
+   -0.0648   -0.2049    0.0350   -0.1017    0.0876    0.0922   -0.0581    0.0176    0.0219    0.0645
+    0.0387   -0.1876   -0.2011   -0.0529    0.0379    0.0207   -0.1639    0.0042    0.0534    0.0372
+   -0.0195    0.0825    0.0611   -0.0749    0.0050   -0.0207    0.0141    0.1223   -0.0689    0.0275
+    0.1271    0.0289   -0.0301    0.1592   -0.0134    0.0149    0.0269   -0.1471    0.0260    0.0315
+   -0.0146   -0.1079   -0.0271   -0.0101    0.0077   -0.0291    0.0687    0.0045   -0.0157    0.0014
+   -0.0264    0.0954   -0.1037   -0.0887    0.1102   -0.0940   -0.0511   -0.0702    0.0526   -0.0095
+    0.0726   -0.0446    0.0692    0.0073    0.0469   -0.0095   -0.0874   -0.0355    0.0549    0.0472
+   -0.0285    0.0243   -0.0528    0.0571   -0.0699    0.0507   -0.0265   -0.0083    0.0247   -0.1115
+    0.0038   -0.0648    0.0084   -0.0246   -0.0319    0.0866   -0.0530    0.0335   -0.0399    0.1842
+   -0.0123    0.0627    0.2229    0.0594    0.0305   -0.0616    0.0151   -0.2185   -0.1249   -0.1172
+   -0.3986    0.0590    0.1765    0.1134    0.1746    0.0369    0.0653    0.0584   -0.0307   -0.0545
+    0.0131    0.0400    0.0042    0.0842   -0.0692    0.0396    0.0344    0.0446    0.0961    0.0777
+    0.0579   -0.0838    0.0979    0.0726    0.0067    0.0599   -0.0723    0.0514   -0.1080    0.0403
+    0.0623   -0.0309   -0.0618    0.0668    0.0529    0.0037    0.0464    0.0416    0.0003   -0.0313
+    0.0708    0.1067    0.0804   -0.0144   -0.0715    0.0032    0.0185    0.0792   -0.0981   -0.0353
+   -0.0184   -0.0068    0.0944   -0.1009    0.0138    0.0148    0.0696   -0.0323   -0.0199    0.0312
+    0.0179   -0.0759   -0.0715   -0.0729   -0.0587    0.0781   -0.0512    0.0489   -0.0833    0.0751
+   -0.0146   -0.0329   -0.0020    0.0266    0.0865   -0.0255   -0.0337   -0.0664   -0.0374   -0.0560
+    0.0309    0.0588    0.0015    0.0669   -0.0493   -0.0332    0.0556    0.0623   -0.0033    0.0588
+    0.0173    0.0746   -0.0403   -0.0880   -0.0317   -0.0912   -0.0263    0.0071   -0.0235   -0.0077
+    0.0307   -0.0417    0.0971   -0.0766    0.1092    0.0763    0.1055    0.0534   -0.0047   -0.0613
+   -0.2163    0.0417    0.3814    0.5048   -0.2373   -0.3929    0.0870    0.0260   -0.0791   -0.0010
+    0.0050    0.0240   -0.0074   -0.0477    0.0810    0.0633   -0.0560   -0.0353    0.0162   -0.1477
+   -0.0386    0.1950   -0.1504   -0.1257   -0.0380   -0.0070    0.0580
+    0.0207   -0.1639    0.0042    0.0534    0.0372   -0.0195    0.0825    0.0611   -0.0749    0.0050
+   -0.0207    0.0141    0.1223   -0.0689    0.0275    0.1271    0.0289   -0.0301    0.1592   -0.0134
+    0.0149    0.0269   -0.1471    0.0260    0.0315   -0.0146   -0.1079   -0.0271   -0.0101    0.0077
+   -0.0291    0.0687    0.0045   -0.0157    0.0014   -0.0264    0.0954   -0.1037   -0.0887    0.1102
+   -0.0940   -0.0511   -0.0702    0.0526   -0.0095    0.0726   -0.0446    0.0692    0.0073    0.0469
+   -0.0095   -0.0874   -0.0355    0.0549    0.0472   -0.0285    0.0243   -0.0528    0.0571   -0.0699
+    0.0507   -0.0265   -0.0083    0.0247   -0.1115    0.0038   -0.0648    0.0084   -0.0246   -0.0319
+    0.0866   -0.0530    0.0335   -0.0399    0.1842   -0.0123    0.0627    0.2229    0.0594    0.0305
+   -0.0616    0.0151   -0.2185   -0.1249   -0.1172   -0.3986    0.0590    0.1765    0.1134    0.1746
+    0.0369    0.0653    0.0584   -0.0307   -0.0545    0.0131    0.0400    0.0042    0.0842   -0.0692
+    0.0396    0.0344    0.0446    0.0961    0.0777    0.0579   -0.0838    0.0979    0.0726    0.0067
+    0.0599   -0.0723    0.0514   -0.1080    0.0403    0.0623   -0.0309   -0.0618    0.0668    0.0529
+    0.0037    0.0464    0.0416    0.0003   -0.0313    0.0708    0.1067    0.0804   -0.0144   -0.0715
+    0.0032    0.0185    0.0792   -0.0981   -0.0353   -0.0184   -0.0068    0.0944   -0.1009    0.0138
+    0.0148    0.0696   -0.0323   -0.0199    0.0312    0.0179   -0.0759   -0.0715   -0.0729   -0.0587
+    0.0781   -0.0512    0.0489   -0.0833    0.0751   -0.0146   -0.0329   -0.0020    0.0266    0.0865
+   -0.0255   -0.0337   -0.0664   -0.0374   -0.0560    0.0309    0.0588    0.0015    0.0669   -0.0493
+   -0.0332    0.0556    0.0623   -0.0033    0.0588    0.0173    0.0746   -0.0403   -0.0880   -0.0317
+   -0.0912   -0.0263    0.0071   -0.0235   -0.0077    0.0307   -0.0417    0.0971   -0.0766    0.1092
+    0.0763    0.1055    0.0534   -0.0047   -0.0613   -0.2163    0.0417    0.3814    0.5048   -0.2373
+   -0.3929    0.0870    0.0260   -0.0791   -0.0010    0.0050    0.0240   -0.0074   -0.0477    0.0810
+    0.0633   -0.0560   -0.0353    0.0162   -0.1477   -0.0386    0.1950   -0.1504   -0.1257   -0.0380
+   -0.0070    0.0580    0.0471    0.0465   -0.1034   -0.0157    0.0810   -0.0077   -0.1212    0.0697
+    0.0082   -0.1495    0.1521   -0.0223   -0.0310    0.0035    0.1240   -0.0002   -0.0505   -0.0741
+    0.0819   -0.0795    0.0553   -0.0606    0.0078    0.0605   -0.0214   -0.0542    0.0127   -0.0005
+    0.0035   -0.0183   -0.0657   -0.0035   -0.0037    0.0239   -0.1103    0.0570   -0.0964    0.0294
+    0.0080   -0.0215    0.2166   -0.1489   -0.1920    0.5639    0.2450    0.2688   -0.5151    0.8164
+    0.1738    0.0719    1.2642   -0.0279    0.7454    0.0066    0.2007   -2.0877   -0.4514   -0.6292
+   -2.7691    0.0431    1.0250    0.3424    0.9788    0.0576   -0.0394    0.0560   -0.1119    0.0259
+    0.1365    0.0352    0.0926   -0.0737   -0.0358    0.1020    0.1001   -0.0143   -0.1874   -0.0381
+   -0.1819    0.0517    0.1710    0.0818   -0.0148   -0.0497   -0.0018   -0.0792    0.0119   -0.0052
+   -0.0455   -0.0688    0.0703    0.1045   -0.0061    0.0078   -0.0647   -0.0187   -0.0212    0.0679
+    0.0100    0.0201    0.0069    0.1408    0.0257    0.1249   -0.0080    0.0318   -0.0072   -0.0772
+   -0.0739    0.0945    0.0388   -0.0629    0.2145   -0.0369    0.0273    0.0654    0.0131   -0.0338
+   -0.1267    0.0856   -0.0159    0.0375    0.0782    0.0547    0.0530    0.1075    0.1030   -0.0197
+   -0.0177   -0.0533   -0.0169   -0.0551    0.0406    0.1133   -0.0467   -0.0070    0.0483   -0.0645
+    0.0109    0.0109    0.0103   -0.0680    0.0627    0.1340    0.0886    0.0427    0.0003   -0.1052
+    0.0819   -0.0509   -0.1030    0.0215   -0.1035   -0.0656    0.0398   -0.0349    0.0244    0.0820
+   -0.0566   -0.0162   -0.0482   -0.0660   -0.0115   -0.0277    0.0706    0.0548    0.0869   -0.1673
+   -0.6091    0.2524    0.4766    0.1800    0.0403   -0.2653   -0.0848    0.2566    0.1076   -0.1942
+    0.2663   -0.1273   -0.3109    0.1641    0.0873   -0.2884    0.1706    0.1063   -0.0245    0.1468
+    0.0430    0.1245    0.0151    0.0110   -0.0037    0.0107    0.2699
+   -0.2163    0.0417    0.3814    0.5048   -0.2373   -0.3929    0.0870    0.0260   -0.0791   -0.0010
+    0.0050    0.0240   -0.0074   -0.0477    0.0810    0.0633   -0.0560   -0.0353    0.0162   -0.1477
+   -0.0386    0.1950   -0.1504   -0.1257   -0.0380   -0.0070    0.0580    0.0471    0.0465   -0.1034
+   -0.0157    0.0810   -0.0077   -0.1212    0.0697    0.0082   -0.1495    0.1521   -0.0223   -0.0310
+    0.0035    0.1240   -0.0002   -0.0505   -0.0741    0.0819   -0.0795    0.0553   -0.0606    0.0078
+    0.0605   -0.0214   -0.0542    0.0127   -0.0005    0.0035   -0.0183   -0.0657   -0.0035   -0.0037
+    0.0239   -0.1103    0.0570   -0.0964    0.0294    0.0080   -0.0215    0.2166   -0.1489   -0.1920
+    0.5639    0.2450    0.2688   -0.5151    0.8164    0.1738    0.0719    1.2642   -0.0279    0.7454
+    0.0066    0.2007   -2.0877   -0.4514   -0.6292   -2.7691    0.0431    1.0250    0.3424    0.9788
+    0.0576   -0.0394    0.0560   -0.1119    0.0259    0.1365    0.0352    0.0926   -0.0737   -0.0358
+    0.1020    0.1001   -0.0143   -0.1874   -0.0381   -0.1819    0.0517    0.1710    0.0818   -0.0148
+   -0.0497   -0.0018   -0.0792    0.0119   -0.0052   -0.0455   -0.0688    0.0703    0.1045   -0.0061
+    0.0078   -0.0647   -0.0187   -0.0212    0.0679    0.0100    0.0201    0.0069    0.1408    0.0257
+    0.1249   -0.0080    0.0318   -0.0072   -0.0772   -0.0739    0.0945    0.0388   -0.0629    0.2145
+   -0.0369    0.0273    0.0654    0.0131   -0.0338   -0.1267    0.0856   -0.0159    0.0375    0.0782
+    0.0547    0.0530    0.1075    0.1030   -0.0197   -0.0177   -0.0533   -0.0169   -0.0551    0.0406
+    0.1133   -0.0467   -0.0070    0.0483   -0.0645    0.0109    0.0109    0.0103   -0.0680    0.0627
+    0.1340    0.0886    0.0427    0.0003   -0.1052    0.0819   -0.0509   -0.1030    0.0215   -0.1035
+   -0.0656    0.0398   -0.0349    0.0244    0.0820   -0.0566   -0.0162   -0.0482   -0.0660   -0.0115
+   -0.0277    0.0706    0.0548    0.0869   -0.1673   -0.6091    0.2524    0.4766    0.1800    0.0403
+   -0.2653   -0.0848    0.2566    0.1076   -0.1942    0.2663   -0.1273   -0.3109    0.1641    0.0873
+   -0.2884    0.1706    0.1063   -0.0245    0.1468    0.0430    0.1245    0.0151    0.0110   -0.0037
+    0.0107    0.2699    0.0630   -0.1464   -0.0627    0.0278   -0.1651    0.0309    0.1770   -0.0806
+   -0.0005    0.1530   -0.0865   -0.0205    0.0120    0.0425    0.1199    0.0347   -0.1000    0.0733
+    0.0922   -0.0087   -0.0216   -0.0396    0.0018    0.0074   -0.0398   -0.0771   -0.0725    0.0131
+    0.0508   -0.0023   -0.0199   -0.0480    0.1492   -0.0483   -0.0062   -0.0206    0.1555   -0.0487
+   -0.0154   -0.0314    0.3998   -0.1283   -0.2127    0.6987    0.2415    0.1749   -0.6180    0.9529
+    0.2779   -0.0979    1.5152   -0.0421    0.9399    0.0243    0.1022   -2.4833   -0.5543   -0.5825
+   -3.3385   -0.0350    1.3514    0.5718    1.0593    0.0013   -0.0089    0.0058   -0.2351    0.1105
+    0.0944   -0.0270    0.1383   -0.0404    0.0622    0.1222    0.0291   -0.0179   -0.1932   -0.0648
+   -0.1367   -0.0180    0.1481    0.1465   -0.1238    0.0725   -0.0131    0.0303   -0.0377    0.0596
+    0.1333   -0.1207    0.0244    0.0538    0.0168    0.0064   -0.0137   -0.1531   -0.0959   -0.0108
+   -0.0396   -0.1527    0.0319    0.1946    0.2331    0.1398   -0.1593    0.0004    0.0130   -0.0783
+   -0.0509    0.1896    0.0089   -0.0983    0.1497    0.0370    0.0606   -0.0666    0.0060   -0.0919
+   -0.0591   -0.0655   -0.1545   -0.0602    0.2730    0.1010    0.0229   -0.0171    0.1335    0.1518
+    0.0252   -0.0889    0.0780   -0.0118    0.0487    0.2046   -0.0065    0.0822   -0.0364    0.0238
+   -0.0894   -0.0977   -0.0920   -0.1131   -0.0025    0.2166    0.1357    0.1481   -0.0297    0.0453
+   -0.0085    0.0136   -0.1491    0.1615    0.0151   -0.0003    0.1436   -0.0681    0.0820   -0.0809
+   -0.1125   -0.0537   -0.0722   -0.0053   -0.0502   -0.1344    0.2306    0.1026    0.0982   -0.1354
+    0.3696   -0.2714   -0.0780    0.1606    0.0273    0.1108    0.1450   -0.0795   -0.0705    0.2213
+    0.0025   -0.0891    0.1043   -0.0758    0.1255    0.0280   -0.0281    0.1187    0.0314    0.0807
+    0.0203   -0.1278    0.0457    0.0177   -0.1513   -0.1306    0.1235
+   -0.6091    0.2524    0.4766    0.1800    0.0403   -0.2653   -0.0848    0.2566    0.1076   -0.1942
+    0.2663   -0.1273   -0.3109    0.1641    0.0873   -0.2884    0.1706    0.1063   -0.0245    0.1468
+    0.0430    0.1245    0.0151    0.0110   -0.0037    0.0107    0.2699    0.0630   -0.1464   -0.0627
+    0.0278   -0.1651    0.0309    0.1770   -0.0806   -0.0005    0.1530   -0.0865   -0.0205    0.0120
+    0.0425    0.1199    0.0347   -0.1000    0.0733    0.0922   -0.0087   -0.0216   -0.0396    0.0018
+    0.0074   -0.0398   -0.0771   -0.0725    0.0131    0.0508   -0.0023   -0.0199   -0.0480    0.1492
+   -0.0483   -0.0062   -0.0206    0.1555   -0.0487   -0.0154   -0.0314    0.3998   -0.1283   -0.2127
+    0.6987    0.2415    0.1749   -0.6180    0.9529    0.2779   -0.0979    1.5152   -0.0421    0.9399
+    0.0243    0.1022   -2.4833   -0.5543   -0.5825   -3.3385   -0.0350    1.3514    0.5718    1.0593
+    0.0013   -0.0089    0.0058   -0.2351    0.1105    0.0944   -0.0270    0.1383   -0.0404    0.0622
+    0.1222    0.0291   -0.0179   -0.1932   -0.0648   -0.1367   -0.0180    0.1481    0.1465   -0.1238
+    0.0725   -0.0131    0.0303   -0.0377    0.0596    0.1333   -0.1207    0.0244    0.0538    0.0168
+    0.0064   -0.0137   -0.1531   -0.0959   -0.0108   -0.0396   -0.1527    0.0319    0.1946    0.2331
+    0.1398   -0.1593    0.0004    0.0130   -0.0783   -0.0509    0.1896    0.0089   -0.0983    0.1497
+    0.0370    0.0606   -0.0666    0.0060   -0.0919   -0.0591   -0.0655   -0.1545   -0.0602    0.2730
+    0.1010    0.0229   -0.0171    0.1335    0.1518    0.0252   -0.0889    0.0780   -0.0118    0.0487
+    0.2046   -0.0065    0.0822   -0.0364    0.0238   -0.0894   -0.0977   -0.0920   -0.1131   -0.0025
+    0.2166    0.1357    0.1481   -0.0297    0.0453   -0.0085    0.0136   -0.1491    0.1615    0.0151
+   -0.0003    0.1436   -0.0681    0.0820   -0.0809   -0.1125   -0.0537   -0.0722   -0.0053   -0.0502
+   -0.1344    0.2306    0.1026    0.0982   -0.1354    0.3696   -0.2714   -0.0780    0.1606    0.0273
+    0.1108    0.1450   -0.0795   -0.0705    0.2213    0.0025   -0.0891    0.1043   -0.0758    0.1255
+    0.0280   -0.0281    0.1187    0.0314    0.0807    0.0203   -0.1278    0.0457    0.0177   -0.1513
+   -0.1306    0.1235    0.0526    0.0424    0.0116    0.1039   -0.0439   -0.0725    0.0635    0.0878
+   -0.0667   -0.7116    0.4697    0.4675    0.1423   -0.1312   -0.0084   -0.0881    0.0707   -0.0685
+    0.0834   -0.1035    0.1061   -0.0609   -0.0163    0.0835   -0.0159    0.0292   -0.0165   -0.0797
+    0.0485    0.0392   -0.0469    0.0663    0.0264    0.0339   -0.0277   -0.0317   -0.2625    0.0451
+   -0.0728    0.0195    0.1446   -0.1366   -0.0985    0.4090    0.1691    0.0574   -0.3431    0.3473
+    0.1523    0.0509    0.7454    0.0425    0.5062    0.0527    0.1518   -1.3050   -0.2292   -0.3888
+   -1.5888   -0.0951    0.6847    0.2011    0.5760    0.0269    0.1010   -0.1060   -0.0161   -0.0466
+   -0.0156   -0.0138   -0.0142   -0.0521    0.0605   -0.0810    0.0421    0.0778   -0.0691    0.0525
+    0.0759   -0.0682    0.0728   -0.0174   -0.0521   -0.1099   -0.0853    0.0635   -0.0175   -0.0646
+    0.0015   -0.0324    0.0662    0.0594   -0.0814   -0.0182    0.0600   -0.0561    0.0124   -0.0138
+    0.0257   -0.0180   -0.0260    0.1915    0.0815    0.0220    0.1060   -0.0337    0.0094    0.0461
+    0.0240    0.0323   -0.0392   -0.0250    0.0087   -0.0144    0.0707    0.0179   -0.0922    0.0687
+    0.0194   -0.0136   -0.0453   -0.0509    0.1179    0.1090    0.0375   -0.0008   -0.1058    0.0640
+   -0.0372    0.0226    0.1149   -0.0776    0.0007    0.0999    0.0034    0.0209   -0.0302   -0.0437
+    0.0007   -0.1152    0.0353   -0.0944    0.0280    0.0820    0.0112    0.0123   -0.0513    0.0393
+    0.1190    0.1001   -0.2089    0.1008   -0.1262   -0.0238    0.2048   -0.0971    0.0484   -0.0110
+    0.1022   -0.0429   -0.2067   -0.1679   -0.3956    0.0893    0.2022    0.1023   -0.0090   -0.0677
+    0.0513   -0.1181    0.0713    0.0708   -0.2163    0.0178    0.0717   -0.0903    0.0167    0.1520
+   -0.1040   -0.0576    0.0160   -0.0057   -0.0588    0.0787   -0.0364    0.0373   -0.0127    0.0874
+    0.1025   -0.1264    0.0435    0.1687   -0.2198    0.1809    0.0477
+* --------------------
+* jct 2nd layer: row=numhid+1 (10F10.4), col=numout
+    2.8517   -2.8789
+    2.4543   -2.4550
+   -0.7808    0.8912
+   -3.2008    3.2314
+   -3.5086    3.3945
+    0.6741   -0.6690
+//

Added: trunk/packages/norsnet/trunk/debian/source/format
===================================================================
--- trunk/packages/norsnet/trunk/debian/source/format	                        (rev 0)
+++ trunk/packages/norsnet/trunk/debian/source/format	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1 @@
+3.0 (quilt)

Modified: trunk/packages/norsnet/trunk/debian/watch
===================================================================
--- trunk/packages/norsnet/trunk/debian/watch	2012-07-10 14:45:53 UTC (rev 11704)
+++ trunk/packages/norsnet/trunk/debian/watch	2012-07-10 15:05:06 UTC (rev 11705)
@@ -0,0 +1,2 @@
+version=3
+ftp://rostlab.org/norsnet/norsnet-(.+).tar.gz




More information about the debian-med-commit mailing list