[med-svn] r11778 - in trunk/packages/norsp/trunk: . debian example
Eva Reisinger
reisinger-guest at alioth.debian.org
Fri Jul 13 12:02:06 UTC 2012
Author: reisinger-guest
Date: 2012-07-13 12:02:04 +0000 (Fri, 13 Jul 2012)
New Revision: 11778
Added:
trunk/packages/norsp/trunk/AUTHORS
trunk/packages/norsp/trunk/COPYING
trunk/packages/norsp/trunk/ChangeLog
trunk/packages/norsp/trunk/INSTALL
trunk/packages/norsp/trunk/Makefile.am
trunk/packages/norsp/trunk/Makefile.in
trunk/packages/norsp/trunk/NEWS
trunk/packages/norsp/trunk/README
trunk/packages/norsp/trunk/aclocal.m4
trunk/packages/norsp/trunk/configure
trunk/packages/norsp/trunk/configure.ac
trunk/packages/norsp/trunk/example/
trunk/packages/norsp/trunk/example/query.coils
trunk/packages/norsp/trunk/example/query.coils_raw
trunk/packages/norsp/trunk/example/query.fasta
trunk/packages/norsp/trunk/example/query.hssp
trunk/packages/norsp/trunk/example/query.nors
trunk/packages/norsp/trunk/example/query.phdHtm
trunk/packages/norsp/trunk/example/query.prof
trunk/packages/norsp/trunk/example/query.sumNors
trunk/packages/norsp/trunk/install-sh
trunk/packages/norsp/trunk/missing
trunk/packages/norsp/trunk/norsp
trunk/packages/norsp/trunk/norsp.spec
Modified:
trunk/packages/norsp/trunk/debian/changelog
trunk/packages/norsp/trunk/debian/control
Log:
newer upload 13072012
Added: trunk/packages/norsp/trunk/AUTHORS
===================================================================
--- trunk/packages/norsp/trunk/AUTHORS (rev 0)
+++ trunk/packages/norsp/trunk/AUTHORS 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,3 @@
+Jinfeng Liu <jinfeng.liu at gmail.com>
+Guy Yachdav <gyachdav at rostlab.org>
+Laszlo Kajan <lkajan at rostlab.org>
Added: trunk/packages/norsp/trunk/COPYING
===================================================================
--- trunk/packages/norsp/trunk/COPYING (rev 0)
+++ trunk/packages/norsp/trunk/COPYING 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,674 @@
+ GNU GENERAL PUBLIC LICENSE
+ Version 3, 29 June 2007
+
+ Copyright (C) 2007 Free Software Foundation, Inc. <http://fsf.org/>
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+
+ Preamble
+
+ The GNU General Public License is a free, copyleft license for
+software and other kinds of works.
+
+ The licenses for most software and other practical works are designed
+to take away your freedom to share and change the works. By contrast,
+the GNU General Public License is intended to guarantee your freedom to
+share and change all versions of a program--to make sure it remains free
+software for all its users. We, the Free Software Foundation, use the
+GNU General Public License for most of our software; it applies also to
+any other work released this way by its authors. You can apply it to
+your programs, too.
+
+ When we speak of free software, we are referring to freedom, not
+price. Our General Public Licenses are designed to make sure that you
+have the freedom to distribute copies of free software (and charge for
+them if you wish), that you receive source code or can get it if you
+want it, that you can change the software or use pieces of it in new
+free programs, and that you know you can do these things.
+
+ To protect your rights, we need to prevent others from denying you
+these rights or asking you to surrender the rights. Therefore, you have
+certain responsibilities if you distribute copies of the software, or if
+you modify it: responsibilities to respect the freedom of others.
+
+ For example, if you distribute copies of such a program, whether
+gratis or for a fee, you must pass on to the recipients the same
+freedoms that you received. You must make sure that they, too, receive
+or can get the source code. And you must show them these terms so they
+know their rights.
+
+ Developers that use the GNU GPL protect your rights with two steps:
+(1) assert copyright on the software, and (2) offer you this License
+giving you legal permission to copy, distribute and/or modify it.
+
+ For the developers' and authors' protection, the GPL clearly explains
+that there is no warranty for this free software. For both users' and
+authors' sake, the GPL requires that modified versions be marked as
+changed, so that their problems will not be attributed erroneously to
+authors of previous versions.
+
+ Some devices are designed to deny users access to install or run
+modified versions of the software inside them, although the manufacturer
+can do so. This is fundamentally incompatible with the aim of
+protecting users' freedom to change the software. The systematic
+pattern of such abuse occurs in the area of products for individuals to
+use, which is precisely where it is most unacceptable. Therefore, we
+have designed this version of the GPL to prohibit the practice for those
+products. If such problems arise substantially in other domains, we
+stand ready to extend this provision to those domains in future versions
+of the GPL, as needed to protect the freedom of users.
+
+ Finally, every program is threatened constantly by software patents.
+States should not allow patents to restrict development and use of
+software on general-purpose computers, but in those that do, we wish to
+avoid the special danger that patents applied to a free program could
+make it effectively proprietary. To prevent this, the GPL assures that
+patents cannot be used to render the program non-free.
+
+ The precise terms and conditions for copying, distribution and
+modification follow.
+
+ TERMS AND CONDITIONS
+
+ 0. Definitions.
+
+ "This License" refers to version 3 of the GNU General Public License.
+
+ "Copyright" also means copyright-like laws that apply to other kinds of
+works, such as semiconductor masks.
+
+ "The Program" refers to any copyrightable work licensed under this
+License. Each licensee is addressed as "you". "Licensees" and
+"recipients" may be individuals or organizations.
+
+ To "modify" a work means to copy from or adapt all or part of the work
+in a fashion requiring copyright permission, other than the making of an
+exact copy. The resulting work is called a "modified version" of the
+earlier work or a work "based on" the earlier work.
+
+ A "covered work" means either the unmodified Program or a work based
+on the Program.
+
+ To "propagate" a work means to do anything with it that, without
+permission, would make you directly or secondarily liable for
+infringement under applicable copyright law, except executing it on a
+computer or modifying a private copy. Propagation includes copying,
+distribution (with or without modification), making available to the
+public, and in some countries other activities as well.
+
+ To "convey" a work means any kind of propagation that enables other
+parties to make or receive copies. Mere interaction with a user through
+a computer network, with no transfer of a copy, is not conveying.
+
+ An interactive user interface displays "Appropriate Legal Notices"
+to the extent that it includes a convenient and prominently visible
+feature that (1) displays an appropriate copyright notice, and (2)
+tells the user that there is no warranty for the work (except to the
+extent that warranties are provided), that licensees may convey the
+work under this License, and how to view a copy of this License. If
+the interface presents a list of user commands or options, such as a
+menu, a prominent item in the list meets this criterion.
+
+ 1. Source Code.
+
+ The "source code" for a work means the preferred form of the work
+for making modifications to it. "Object code" means any non-source
+form of a work.
+
+ A "Standard Interface" means an interface that either is an official
+standard defined by a recognized standards body, or, in the case of
+interfaces specified for a particular programming language, one that
+is widely used among developers working in that language.
+
+ The "System Libraries" of an executable work include anything, other
+than the work as a whole, that (a) is included in the normal form of
+packaging a Major Component, but which is not part of that Major
+Component, and (b) serves only to enable use of the work with that
+Major Component, or to implement a Standard Interface for which an
+implementation is available to the public in source code form. A
+"Major Component", in this context, means a major essential component
+(kernel, window system, and so on) of the specific operating system
+(if any) on which the executable work runs, or a compiler used to
+produce the work, or an object code interpreter used to run it.
+
+ The "Corresponding Source" for a work in object code form means all
+the source code needed to generate, install, and (for an executable
+work) run the object code and to modify the work, including scripts to
+control those activities. However, it does not include the work's
+System Libraries, or general-purpose tools or generally available free
+programs which are used unmodified in performing those activities but
+which are not part of the work. For example, Corresponding Source
+includes interface definition files associated with source files for
+the work, and the source code for shared libraries and dynamically
+linked subprograms that the work is specifically designed to require,
+such as by intimate data communication or control flow between those
+subprograms and other parts of the work.
+
+ The Corresponding Source need not include anything that users
+can regenerate automatically from other parts of the Corresponding
+Source.
+
+ The Corresponding Source for a work in source code form is that
+same work.
+
+ 2. Basic Permissions.
+
+ All rights granted under this License are granted for the term of
+copyright on the Program, and are irrevocable provided the stated
+conditions are met. This License explicitly affirms your unlimited
+permission to run the unmodified Program. The output from running a
+covered work is covered by this License only if the output, given its
+content, constitutes a covered work. This License acknowledges your
+rights of fair use or other equivalent, as provided by copyright law.
+
+ You may make, run and propagate covered works that you do not
+convey, without conditions so long as your license otherwise remains
+in force. You may convey covered works to others for the sole purpose
+of having them make modifications exclusively for you, or provide you
+with facilities for running those works, provided that you comply with
+the terms of this License in conveying all material for which you do
+not control copyright. Those thus making or running the covered works
+for you must do so exclusively on your behalf, under your direction
+and control, on terms that prohibit them from making any copies of
+your copyrighted material outside their relationship with you.
+
+ Conveying under any other circumstances is permitted solely under
+the conditions stated below. Sublicensing is not allowed; section 10
+makes it unnecessary.
+
+ 3. Protecting Users' Legal Rights From Anti-Circumvention Law.
+
+ No covered work shall be deemed part of an effective technological
+measure under any applicable law fulfilling obligations under article
+11 of the WIPO copyright treaty adopted on 20 December 1996, or
+similar laws prohibiting or restricting circumvention of such
+measures.
+
+ When you convey a covered work, you waive any legal power to forbid
+circumvention of technological measures to the extent such circumvention
+is effected by exercising rights under this License with respect to
+the covered work, and you disclaim any intention to limit operation or
+modification of the work as a means of enforcing, against the work's
+users, your or third parties' legal rights to forbid circumvention of
+technological measures.
+
+ 4. Conveying Verbatim Copies.
+
+ You may convey verbatim copies of the Program's source code as you
+receive it, in any medium, provided that you conspicuously and
+appropriately publish on each copy an appropriate copyright notice;
+keep intact all notices stating that this License and any
+non-permissive terms added in accord with section 7 apply to the code;
+keep intact all notices of the absence of any warranty; and give all
+recipients a copy of this License along with the Program.
+
+ You may charge any price or no price for each copy that you convey,
+and you may offer support or warranty protection for a fee.
+
+ 5. Conveying Modified Source Versions.
+
+ You may convey a work based on the Program, or the modifications to
+produce it from the Program, in the form of source code under the
+terms of section 4, provided that you also meet all of these conditions:
+
+ a) The work must carry prominent notices stating that you modified
+ it, and giving a relevant date.
+
+ b) The work must carry prominent notices stating that it is
+ released under this License and any conditions added under section
+ 7. This requirement modifies the requirement in section 4 to
+ "keep intact all notices".
+
+ c) You must license the entire work, as a whole, under this
+ License to anyone who comes into possession of a copy. This
+ License will therefore apply, along with any applicable section 7
+ additional terms, to the whole of the work, and all its parts,
+ regardless of how they are packaged. This License gives no
+ permission to license the work in any other way, but it does not
+ invalidate such permission if you have separately received it.
+
+ d) If the work has interactive user interfaces, each must display
+ Appropriate Legal Notices; however, if the Program has interactive
+ interfaces that do not display Appropriate Legal Notices, your
+ work need not make them do so.
+
+ A compilation of a covered work with other separate and independent
+works, which are not by their nature extensions of the covered work,
+and which are not combined with it such as to form a larger program,
+in or on a volume of a storage or distribution medium, is called an
+"aggregate" if the compilation and its resulting copyright are not
+used to limit the access or legal rights of the compilation's users
+beyond what the individual works permit. Inclusion of a covered work
+in an aggregate does not cause this License to apply to the other
+parts of the aggregate.
+
+ 6. Conveying Non-Source Forms.
+
+ You may convey a covered work in object code form under the terms
+of sections 4 and 5, provided that you also convey the
+machine-readable Corresponding Source under the terms of this License,
+in one of these ways:
+
+ a) Convey the object code in, or embodied in, a physical product
+ (including a physical distribution medium), accompanied by the
+ Corresponding Source fixed on a durable physical medium
+ customarily used for software interchange.
+
+ b) Convey the object code in, or embodied in, a physical product
+ (including a physical distribution medium), accompanied by a
+ written offer, valid for at least three years and valid for as
+ long as you offer spare parts or customer support for that product
+ model, to give anyone who possesses the object code either (1) a
+ copy of the Corresponding Source for all the software in the
+ product that is covered by this License, on a durable physical
+ medium customarily used for software interchange, for a price no
+ more than your reasonable cost of physically performing this
+ conveying of source, or (2) access to copy the
+ Corresponding Source from a network server at no charge.
+
+ c) Convey individual copies of the object code with a copy of the
+ written offer to provide the Corresponding Source. This
+ alternative is allowed only occasionally and noncommercially, and
+ only if you received the object code with such an offer, in accord
+ with subsection 6b.
+
+ d) Convey the object code by offering access from a designated
+ place (gratis or for a charge), and offer equivalent access to the
+ Corresponding Source in the same way through the same place at no
+ further charge. You need not require recipients to copy the
+ Corresponding Source along with the object code. If the place to
+ copy the object code is a network server, the Corresponding Source
+ may be on a different server (operated by you or a third party)
+ that supports equivalent copying facilities, provided you maintain
+ clear directions next to the object code saying where to find the
+ Corresponding Source. Regardless of what server hosts the
+ Corresponding Source, you remain obligated to ensure that it is
+ available for as long as needed to satisfy these requirements.
+
+ e) Convey the object code using peer-to-peer transmission, provided
+ you inform other peers where the object code and Corresponding
+ Source of the work are being offered to the general public at no
+ charge under subsection 6d.
+
+ A separable portion of the object code, whose source code is excluded
+from the Corresponding Source as a System Library, need not be
+included in conveying the object code work.
+
+ A "User Product" is either (1) a "consumer product", which means any
+tangible personal property which is normally used for personal, family,
+or household purposes, or (2) anything designed or sold for incorporation
+into a dwelling. In determining whether a product is a consumer product,
+doubtful cases shall be resolved in favor of coverage. For a particular
+product received by a particular user, "normally used" refers to a
+typical or common use of that class of product, regardless of the status
+of the particular user or of the way in which the particular user
+actually uses, or expects or is expected to use, the product. A product
+is a consumer product regardless of whether the product has substantial
+commercial, industrial or non-consumer uses, unless such uses represent
+the only significant mode of use of the product.
+
+ "Installation Information" for a User Product means any methods,
+procedures, authorization keys, or other information required to install
+and execute modified versions of a covered work in that User Product from
+a modified version of its Corresponding Source. The information must
+suffice to ensure that the continued functioning of the modified object
+code is in no case prevented or interfered with solely because
+modification has been made.
+
+ If you convey an object code work under this section in, or with, or
+specifically for use in, a User Product, and the conveying occurs as
+part of a transaction in which the right of possession and use of the
+User Product is transferred to the recipient in perpetuity or for a
+fixed term (regardless of how the transaction is characterized), the
+Corresponding Source conveyed under this section must be accompanied
+by the Installation Information. But this requirement does not apply
+if neither you nor any third party retains the ability to install
+modified object code on the User Product (for example, the work has
+been installed in ROM).
+
+ The requirement to provide Installation Information does not include a
+requirement to continue to provide support service, warranty, or updates
+for a work that has been modified or installed by the recipient, or for
+the User Product in which it has been modified or installed. Access to a
+network may be denied when the modification itself materially and
+adversely affects the operation of the network or violates the rules and
+protocols for communication across the network.
+
+ Corresponding Source conveyed, and Installation Information provided,
+in accord with this section must be in a format that is publicly
+documented (and with an implementation available to the public in
+source code form), and must require no special password or key for
+unpacking, reading or copying.
+
+ 7. Additional Terms.
+
+ "Additional permissions" are terms that supplement the terms of this
+License by making exceptions from one or more of its conditions.
+Additional permissions that are applicable to the entire Program shall
+be treated as though they were included in this License, to the extent
+that they are valid under applicable law. If additional permissions
+apply only to part of the Program, that part may be used separately
+under those permissions, but the entire Program remains governed by
+this License without regard to the additional permissions.
+
+ When you convey a copy of a covered work, you may at your option
+remove any additional permissions from that copy, or from any part of
+it. (Additional permissions may be written to require their own
+removal in certain cases when you modify the work.) You may place
+additional permissions on material, added by you to a covered work,
+for which you have or can give appropriate copyright permission.
+
+ Notwithstanding any other provision of this License, for material you
+add to a covered work, you may (if authorized by the copyright holders of
+that material) supplement the terms of this License with terms:
+
+ a) Disclaiming warranty or limiting liability differently from the
+ terms of sections 15 and 16 of this License; or
+
+ b) Requiring preservation of specified reasonable legal notices or
+ author attributions in that material or in the Appropriate Legal
+ Notices displayed by works containing it; or
+
+ c) Prohibiting misrepresentation of the origin of that material, or
+ requiring that modified versions of such material be marked in
+ reasonable ways as different from the original version; or
+
+ d) Limiting the use for publicity purposes of names of licensors or
+ authors of the material; or
+
+ e) Declining to grant rights under trademark law for use of some
+ trade names, trademarks, or service marks; or
+
+ f) Requiring indemnification of licensors and authors of that
+ material by anyone who conveys the material (or modified versions of
+ it) with contractual assumptions of liability to the recipient, for
+ any liability that these contractual assumptions directly impose on
+ those licensors and authors.
+
+ All other non-permissive additional terms are considered "further
+restrictions" within the meaning of section 10. If the Program as you
+received it, or any part of it, contains a notice stating that it is
+governed by this License along with a term that is a further
+restriction, you may remove that term. If a license document contains
+a further restriction but permits relicensing or conveying under this
+License, you may add to a covered work material governed by the terms
+of that license document, provided that the further restriction does
+not survive such relicensing or conveying.
+
+ If you add terms to a covered work in accord with this section, you
+must place, in the relevant source files, a statement of the
+additional terms that apply to those files, or a notice indicating
+where to find the applicable terms.
+
+ Additional terms, permissive or non-permissive, may be stated in the
+form of a separately written license, or stated as exceptions;
+the above requirements apply either way.
+
+ 8. Termination.
+
+ You may not propagate or modify a covered work except as expressly
+provided under this License. Any attempt otherwise to propagate or
+modify it is void, and will automatically terminate your rights under
+this License (including any patent licenses granted under the third
+paragraph of section 11).
+
+ However, if you cease all violation of this License, then your
+license from a particular copyright holder is reinstated (a)
+provisionally, unless and until the copyright holder explicitly and
+finally terminates your license, and (b) permanently, if the copyright
+holder fails to notify you of the violation by some reasonable means
+prior to 60 days after the cessation.
+
+ Moreover, your license from a particular copyright holder is
+reinstated permanently if the copyright holder notifies you of the
+violation by some reasonable means, this is the first time you have
+received notice of violation of this License (for any work) from that
+copyright holder, and you cure the violation prior to 30 days after
+your receipt of the notice.
+
+ Termination of your rights under this section does not terminate the
+licenses of parties who have received copies or rights from you under
+this License. If your rights have been terminated and not permanently
+reinstated, you do not qualify to receive new licenses for the same
+material under section 10.
+
+ 9. Acceptance Not Required for Having Copies.
+
+ You are not required to accept this License in order to receive or
+run a copy of the Program. Ancillary propagation of a covered work
+occurring solely as a consequence of using peer-to-peer transmission
+to receive a copy likewise does not require acceptance. However,
+nothing other than this License grants you permission to propagate or
+modify any covered work. These actions infringe copyright if you do
+not accept this License. Therefore, by modifying or propagating a
+covered work, you indicate your acceptance of this License to do so.
+
+ 10. Automatic Licensing of Downstream Recipients.
+
+ Each time you convey a covered work, the recipient automatically
+receives a license from the original licensors, to run, modify and
+propagate that work, subject to this License. You are not responsible
+for enforcing compliance by third parties with this License.
+
+ An "entity transaction" is a transaction transferring control of an
+organization, or substantially all assets of one, or subdividing an
+organization, or merging organizations. If propagation of a covered
+work results from an entity transaction, each party to that
+transaction who receives a copy of the work also receives whatever
+licenses to the work the party's predecessor in interest had or could
+give under the previous paragraph, plus a right to possession of the
+Corresponding Source of the work from the predecessor in interest, if
+the predecessor has it or can get it with reasonable efforts.
+
+ You may not impose any further restrictions on the exercise of the
+rights granted or affirmed under this License. For example, you may
+not impose a license fee, royalty, or other charge for exercise of
+rights granted under this License, and you may not initiate litigation
+(including a cross-claim or counterclaim in a lawsuit) alleging that
+any patent claim is infringed by making, using, selling, offering for
+sale, or importing the Program or any portion of it.
+
+ 11. Patents.
+
+ A "contributor" is a copyright holder who authorizes use under this
+License of the Program or a work on which the Program is based. The
+work thus licensed is called the contributor's "contributor version".
+
+ A contributor's "essential patent claims" are all patent claims
+owned or controlled by the contributor, whether already acquired or
+hereafter acquired, that would be infringed by some manner, permitted
+by this License, of making, using, or selling its contributor version,
+but do not include claims that would be infringed only as a
+consequence of further modification of the contributor version. For
+purposes of this definition, "control" includes the right to grant
+patent sublicenses in a manner consistent with the requirements of
+this License.
+
+ Each contributor grants you a non-exclusive, worldwide, royalty-free
+patent license under the contributor's essential patent claims, to
+make, use, sell, offer for sale, import and otherwise run, modify and
+propagate the contents of its contributor version.
+
+ In the following three paragraphs, a "patent license" is any express
+agreement or commitment, however denominated, not to enforce a patent
+(such as an express permission to practice a patent or covenant not to
+sue for patent infringement). To "grant" such a patent license to a
+party means to make such an agreement or commitment not to enforce a
+patent against the party.
+
+ If you convey a covered work, knowingly relying on a patent license,
+and the Corresponding Source of the work is not available for anyone
+to copy, free of charge and under the terms of this License, through a
+publicly available network server or other readily accessible means,
+then you must either (1) cause the Corresponding Source to be so
+available, or (2) arrange to deprive yourself of the benefit of the
+patent license for this particular work, or (3) arrange, in a manner
+consistent with the requirements of this License, to extend the patent
+license to downstream recipients. "Knowingly relying" means you have
+actual knowledge that, but for the patent license, your conveying the
+covered work in a country, or your recipient's use of the covered work
+in a country, would infringe one or more identifiable patents in that
+country that you have reason to believe are valid.
+
+ If, pursuant to or in connection with a single transaction or
+arrangement, you convey, or propagate by procuring conveyance of, a
+covered work, and grant a patent license to some of the parties
+receiving the covered work authorizing them to use, propagate, modify
+or convey a specific copy of the covered work, then the patent license
+you grant is automatically extended to all recipients of the covered
+work and works based on it.
+
+ A patent license is "discriminatory" if it does not include within
+the scope of its coverage, prohibits the exercise of, or is
+conditioned on the non-exercise of one or more of the rights that are
+specifically granted under this License. You may not convey a covered
+work if you are a party to an arrangement with a third party that is
+in the business of distributing software, under which you make payment
+to the third party based on the extent of your activity of conveying
+the work, and under which the third party grants, to any of the
+parties who would receive the covered work from you, a discriminatory
+patent license (a) in connection with copies of the covered work
+conveyed by you (or copies made from those copies), or (b) primarily
+for and in connection with specific products or compilations that
+contain the covered work, unless you entered into that arrangement,
+or that patent license was granted, prior to 28 March 2007.
+
+ Nothing in this License shall be construed as excluding or limiting
+any implied license or other defenses to infringement that may
+otherwise be available to you under applicable patent law.
+
+ 12. No Surrender of Others' Freedom.
+
+ If conditions are imposed on you (whether by court order, agreement or
+otherwise) that contradict the conditions of this License, they do not
+excuse you from the conditions of this License. If you cannot convey a
+covered work so as to satisfy simultaneously your obligations under this
+License and any other pertinent obligations, then as a consequence you may
+not convey it at all. For example, if you agree to terms that obligate you
+to collect a royalty for further conveying from those to whom you convey
+the Program, the only way you could satisfy both those terms and this
+License would be to refrain entirely from conveying the Program.
+
+ 13. Use with the GNU Affero General Public License.
+
+ Notwithstanding any other provision of this License, you have
+permission to link or combine any covered work with a work licensed
+under version 3 of the GNU Affero General Public License into a single
+combined work, and to convey the resulting work. The terms of this
+License will continue to apply to the part which is the covered work,
+but the special requirements of the GNU Affero General Public License,
+section 13, concerning interaction through a network will apply to the
+combination as such.
+
+ 14. Revised Versions of this License.
+
+ The Free Software Foundation may publish revised and/or new versions of
+the GNU General Public License from time to time. Such new versions will
+be similar in spirit to the present version, but may differ in detail to
+address new problems or concerns.
+
+ Each version is given a distinguishing version number. If the
+Program specifies that a certain numbered version of the GNU General
+Public License "or any later version" applies to it, you have the
+option of following the terms and conditions either of that numbered
+version or of any later version published by the Free Software
+Foundation. If the Program does not specify a version number of the
+GNU General Public License, you may choose any version ever published
+by the Free Software Foundation.
+
+ If the Program specifies that a proxy can decide which future
+versions of the GNU General Public License can be used, that proxy's
+public statement of acceptance of a version permanently authorizes you
+to choose that version for the Program.
+
+ Later license versions may give you additional or different
+permissions. However, no additional obligations are imposed on any
+author or copyright holder as a result of your choosing to follow a
+later version.
+
+ 15. Disclaimer of Warranty.
+
+ THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY
+APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
+HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY
+OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO,
+THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
+PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM
+IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF
+ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
+
+ 16. Limitation of Liability.
+
+ IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
+WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS
+THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY
+GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE
+USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF
+DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD
+PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS),
+EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF
+SUCH DAMAGES.
+
+ 17. Interpretation of Sections 15 and 16.
+
+ If the disclaimer of warranty and limitation of liability provided
+above cannot be given local legal effect according to their terms,
+reviewing courts shall apply local law that most closely approximates
+an absolute waiver of all civil liability in connection with the
+Program, unless a warranty or assumption of liability accompanies a
+copy of the Program in return for a fee.
+
+ END OF TERMS AND CONDITIONS
+
+ How to Apply These Terms to Your New Programs
+
+ If you develop a new program, and you want it to be of the greatest
+possible use to the public, the best way to achieve this is to make it
+free software which everyone can redistribute and change under these terms.
+
+ To do so, attach the following notices to the program. It is safest
+to attach them to the start of each source file to most effectively
+state the exclusion of warranty; and each file should have at least
+the "copyright" line and a pointer to where the full notice is found.
+
+ <one line to give the program's name and a brief idea of what it does.>
+ Copyright (C) <year> <name of author>
+
+ This program is free software: you can redistribute it and/or modify
+ it under the terms of the GNU General Public License as published by
+ the Free Software Foundation, either version 3 of the License, or
+ (at your option) any later version.
+
+ This program is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ GNU General Public License for more details.
+
+ You should have received a copy of the GNU General Public License
+ along with this program. If not, see <http://www.gnu.org/licenses/>.
+
+Also add information on how to contact you by electronic and paper mail.
+
+ If the program does terminal interaction, make it output a short
+notice like this when it starts in an interactive mode:
+
+ <program> Copyright (C) <year> <name of author>
+ This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'.
+ This is free software, and you are welcome to redistribute it
+ under certain conditions; type `show c' for details.
+
+The hypothetical commands `show w' and `show c' should show the appropriate
+parts of the General Public License. Of course, your program's commands
+might be different; for a GUI interface, you would use an "about box".
+
+ You should also get your employer (if you work as a programmer) or school,
+if any, to sign a "copyright disclaimer" for the program, if necessary.
+For more information on this, and how to apply and follow the GNU GPL, see
+<http://www.gnu.org/licenses/>.
+
+ The GNU General Public License does not permit incorporating your program
+into proprietary programs. If your program is a subroutine library, you
+may consider it more useful to permit linking proprietary applications with
+the library. If this is what you want to do, use the GNU Lesser General
+Public License instead of this License. But first, please read
+<http://www.gnu.org/philosophy/why-not-lgpl.html>.
Added: trunk/packages/norsp/trunk/ChangeLog
===================================================================
--- trunk/packages/norsp/trunk/ChangeLog (rev 0)
+++ trunk/packages/norsp/trunk/ChangeLog 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,30 @@
+norsp (1.0.4) unstable; urgency=low
+
+ * Removed Debianization.
+
+ -- Laszlo Kajan <lkajan at rostlab.org> Thu, 27 Oct 2011 20:24:55 +0200
+
+norsp (1.0.3) unstable; urgency=low
+
+ * recommends now on ncoils (>= 2002-3)
+
+ -- Laszlo Kajan <lkajan at rostlab.org> Thu, 27 Oct 2011 20:22:02 +0200
+
+norsp (1.0.2) unstable; urgency=low
+
+ * warning when popcon not installed
+
+ -- Laszlo Kajan <lkajan at rostlab.org> Mon, 28 Feb 2011 18:02:41 +0100
+
+norsp (1.0.1) unstable; urgency=low
+
+ * popularity contest
+ * bugzilla new url
+
+ -- Laszlo Kajan <lkajan at rostlab.org> Fri, 18 Feb 2011 17:09:24 +0100
+
+norsp (1.0.0) unstable; urgency=low
+
+ * Initial Release.
+
+ -- Guy Yachdav <gyachdav at rostlab.org> Thu, 23 Dec 2010 10:21:12 +0100
Added: trunk/packages/norsp/trunk/INSTALL
===================================================================
--- trunk/packages/norsp/trunk/INSTALL (rev 0)
+++ trunk/packages/norsp/trunk/INSTALL 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,370 @@
+Installation Instructions
+*************************
+
+Copyright (C) 1994-1996, 1999-2002, 2004-2011 Free Software Foundation,
+Inc.
+
+ Copying and distribution of this file, with or without modification,
+are permitted in any medium without royalty provided the copyright
+notice and this notice are preserved. This file is offered as-is,
+without warranty of any kind.
+
+Basic Installation
+==================
+
+ Briefly, the shell commands `./configure; make; make install' should
+configure, build, and install this package. The following
+more-detailed instructions are generic; see the `README' file for
+instructions specific to this package. Some packages provide this
+`INSTALL' file but do not implement all of the features documented
+below. The lack of an optional feature in a given package is not
+necessarily a bug. More recommendations for GNU packages can be found
+in *note Makefile Conventions: (standards)Makefile Conventions.
+
+ The `configure' shell script attempts to guess correct values for
+various system-dependent variables used during compilation. It uses
+those values to create a `Makefile' in each directory of the package.
+It may also create one or more `.h' files containing system-dependent
+definitions. Finally, it creates a shell script `config.status' that
+you can run in the future to recreate the current configuration, and a
+file `config.log' containing compiler output (useful mainly for
+debugging `configure').
+
+ It can also use an optional file (typically called `config.cache'
+and enabled with `--cache-file=config.cache' or simply `-C') that saves
+the results of its tests to speed up reconfiguring. Caching is
+disabled by default to prevent problems with accidental use of stale
+cache files.
+
+ If you need to do unusual things to compile the package, please try
+to figure out how `configure' could check whether to do them, and mail
+diffs or instructions to the address given in the `README' so they can
+be considered for the next release. If you are using the cache, and at
+some point `config.cache' contains results you don't want to keep, you
+may remove or edit it.
+
+ The file `configure.ac' (or `configure.in') is used to create
+`configure' by a program called `autoconf'. You need `configure.ac' if
+you want to change it or regenerate `configure' using a newer version
+of `autoconf'.
+
+ The simplest way to compile this package is:
+
+ 1. `cd' to the directory containing the package's source code and type
+ `./configure' to configure the package for your system.
+
+ Running `configure' might take a while. While running, it prints
+ some messages telling which features it is checking for.
+
+ 2. Type `make' to compile the package.
+
+ 3. Optionally, type `make check' to run any self-tests that come with
+ the package, generally using the just-built uninstalled binaries.
+
+ 4. Type `make install' to install the programs and any data files and
+ documentation. When installing into a prefix owned by root, it is
+ recommended that the package be configured and built as a regular
+ user, and only the `make install' phase executed with root
+ privileges.
+
+ 5. Optionally, type `make installcheck' to repeat any self-tests, but
+ this time using the binaries in their final installed location.
+ This target does not install anything. Running this target as a
+ regular user, particularly if the prior `make install' required
+ root privileges, verifies that the installation completed
+ correctly.
+
+ 6. You can remove the program binaries and object files from the
+ source code directory by typing `make clean'. To also remove the
+ files that `configure' created (so you can compile the package for
+ a different kind of computer), type `make distclean'. There is
+ also a `make maintainer-clean' target, but that is intended mainly
+ for the package's developers. If you use it, you may have to get
+ all sorts of other programs in order to regenerate files that came
+ with the distribution.
+
+ 7. Often, you can also type `make uninstall' to remove the installed
+ files again. In practice, not all packages have tested that
+ uninstallation works correctly, even though it is required by the
+ GNU Coding Standards.
+
+ 8. Some packages, particularly those that use Automake, provide `make
+ distcheck', which can by used by developers to test that all other
+ targets like `make install' and `make uninstall' work correctly.
+ This target is generally not run by end users.
+
+Compilers and Options
+=====================
+
+ Some systems require unusual options for compilation or linking that
+the `configure' script does not know about. Run `./configure --help'
+for details on some of the pertinent environment variables.
+
+ You can give `configure' initial values for configuration parameters
+by setting variables in the command line or in the environment. Here
+is an example:
+
+ ./configure CC=c99 CFLAGS=-g LIBS=-lposix
+
+ *Note Defining Variables::, for more details.
+
+Compiling For Multiple Architectures
+====================================
+
+ You can compile the package for more than one kind of computer at the
+same time, by placing the object files for each architecture in their
+own directory. To do this, you can use GNU `make'. `cd' to the
+directory where you want the object files and executables to go and run
+the `configure' script. `configure' automatically checks for the
+source code in the directory that `configure' is in and in `..'. This
+is known as a "VPATH" build.
+
+ With a non-GNU `make', it is safer to compile the package for one
+architecture at a time in the source code directory. After you have
+installed the package for one architecture, use `make distclean' before
+reconfiguring for another architecture.
+
+ On MacOS X 10.5 and later systems, you can create libraries and
+executables that work on multiple system types--known as "fat" or
+"universal" binaries--by specifying multiple `-arch' options to the
+compiler but only a single `-arch' option to the preprocessor. Like
+this:
+
+ ./configure CC="gcc -arch i386 -arch x86_64 -arch ppc -arch ppc64" \
+ CXX="g++ -arch i386 -arch x86_64 -arch ppc -arch ppc64" \
+ CPP="gcc -E" CXXCPP="g++ -E"
+
+ This is not guaranteed to produce working output in all cases, you
+may have to build one architecture at a time and combine the results
+using the `lipo' tool if you have problems.
+
+Installation Names
+==================
+
+ By default, `make install' installs the package's commands under
+`/usr/local/bin', include files under `/usr/local/include', etc. You
+can specify an installation prefix other than `/usr/local' by giving
+`configure' the option `--prefix=PREFIX', where PREFIX must be an
+absolute file name.
+
+ You can specify separate installation prefixes for
+architecture-specific files and architecture-independent files. If you
+pass the option `--exec-prefix=PREFIX' to `configure', the package uses
+PREFIX as the prefix for installing programs and libraries.
+Documentation and other data files still use the regular prefix.
+
+ In addition, if you use an unusual directory layout you can give
+options like `--bindir=DIR' to specify different values for particular
+kinds of files. Run `configure --help' for a list of the directories
+you can set and what kinds of files go in them. In general, the
+default for these options is expressed in terms of `${prefix}', so that
+specifying just `--prefix' will affect all of the other directory
+specifications that were not explicitly provided.
+
+ The most portable way to affect installation locations is to pass the
+correct locations to `configure'; however, many packages provide one or
+both of the following shortcuts of passing variable assignments to the
+`make install' command line to change installation locations without
+having to reconfigure or recompile.
+
+ The first method involves providing an override variable for each
+affected directory. For example, `make install
+prefix=/alternate/directory' will choose an alternate location for all
+directory configuration variables that were expressed in terms of
+`${prefix}'. Any directories that were specified during `configure',
+but not in terms of `${prefix}', must each be overridden at install
+time for the entire installation to be relocated. The approach of
+makefile variable overrides for each directory variable is required by
+the GNU Coding Standards, and ideally causes no recompilation.
+However, some platforms have known limitations with the semantics of
+shared libraries that end up requiring recompilation when using this
+method, particularly noticeable in packages that use GNU Libtool.
+
+ The second method involves providing the `DESTDIR' variable. For
+example, `make install DESTDIR=/alternate/directory' will prepend
+`/alternate/directory' before all installation names. The approach of
+`DESTDIR' overrides is not required by the GNU Coding Standards, and
+does not work on platforms that have drive letters. On the other hand,
+it does better at avoiding recompilation issues, and works well even
+when some directory options were not specified in terms of `${prefix}'
+at `configure' time.
+
+Optional Features
+=================
+
+ If the package supports it, you can cause programs to be installed
+with an extra prefix or suffix on their names by giving `configure' the
+option `--program-prefix=PREFIX' or `--program-suffix=SUFFIX'.
+
+ Some packages pay attention to `--enable-FEATURE' options to
+`configure', where FEATURE indicates an optional part of the package.
+They may also pay attention to `--with-PACKAGE' options, where PACKAGE
+is something like `gnu-as' or `x' (for the X Window System). The
+`README' should mention any `--enable-' and `--with-' options that the
+package recognizes.
+
+ For packages that use the X Window System, `configure' can usually
+find the X include and library files automatically, but if it doesn't,
+you can use the `configure' options `--x-includes=DIR' and
+`--x-libraries=DIR' to specify their locations.
+
+ Some packages offer the ability to configure how verbose the
+execution of `make' will be. For these packages, running `./configure
+--enable-silent-rules' sets the default to minimal output, which can be
+overridden with `make V=1'; while running `./configure
+--disable-silent-rules' sets the default to verbose, which can be
+overridden with `make V=0'.
+
+Particular systems
+==================
+
+ On HP-UX, the default C compiler is not ANSI C compatible. If GNU
+CC is not installed, it is recommended to use the following options in
+order to use an ANSI C compiler:
+
+ ./configure CC="cc -Ae -D_XOPEN_SOURCE=500"
+
+and if that doesn't work, install pre-built binaries of GCC for HP-UX.
+
+ HP-UX `make' updates targets which have the same time stamps as
+their prerequisites, which makes it generally unusable when shipped
+generated files such as `configure' are involved. Use GNU `make'
+instead.
+
+ On OSF/1 a.k.a. Tru64, some versions of the default C compiler cannot
+parse its `<wchar.h>' header file. The option `-nodtk' can be used as
+a workaround. If GNU CC is not installed, it is therefore recommended
+to try
+
+ ./configure CC="cc"
+
+and if that doesn't work, try
+
+ ./configure CC="cc -nodtk"
+
+ On Solaris, don't put `/usr/ucb' early in your `PATH'. This
+directory contains several dysfunctional programs; working variants of
+these programs are available in `/usr/bin'. So, if you need `/usr/ucb'
+in your `PATH', put it _after_ `/usr/bin'.
+
+ On Haiku, software installed for all users goes in `/boot/common',
+not `/usr/local'. It is recommended to use the following options:
+
+ ./configure --prefix=/boot/common
+
+Specifying the System Type
+==========================
+
+ There may be some features `configure' cannot figure out
+automatically, but needs to determine by the type of machine the package
+will run on. Usually, assuming the package is built to be run on the
+_same_ architectures, `configure' can figure that out, but if it prints
+a message saying it cannot guess the machine type, give it the
+`--build=TYPE' option. TYPE can either be a short name for the system
+type, such as `sun4', or a canonical name which has the form:
+
+ CPU-COMPANY-SYSTEM
+
+where SYSTEM can have one of these forms:
+
+ OS
+ KERNEL-OS
+
+ See the file `config.sub' for the possible values of each field. If
+`config.sub' isn't included in this package, then this package doesn't
+need to know the machine type.
+
+ If you are _building_ compiler tools for cross-compiling, you should
+use the option `--target=TYPE' to select the type of system they will
+produce code for.
+
+ If you want to _use_ a cross compiler, that generates code for a
+platform different from the build platform, you should specify the
+"host" platform (i.e., that on which the generated programs will
+eventually be run) with `--host=TYPE'.
+
+Sharing Defaults
+================
+
+ If you want to set default values for `configure' scripts to share,
+you can create a site shell script called `config.site' that gives
+default values for variables like `CC', `cache_file', and `prefix'.
+`configure' looks for `PREFIX/share/config.site' if it exists, then
+`PREFIX/etc/config.site' if it exists. Or, you can set the
+`CONFIG_SITE' environment variable to the location of the site script.
+A warning: not all `configure' scripts look for a site script.
+
+Defining Variables
+==================
+
+ Variables not defined in a site shell script can be set in the
+environment passed to `configure'. However, some packages may run
+configure again during the build, and the customized values of these
+variables may be lost. In order to avoid this problem, you should set
+them in the `configure' command line, using `VAR=value'. For example:
+
+ ./configure CC=/usr/local2/bin/gcc
+
+causes the specified `gcc' to be used as the C compiler (unless it is
+overridden in the site shell script).
+
+Unfortunately, this technique does not work for `CONFIG_SHELL' due to
+an Autoconf bug. Until the bug is fixed you can use this workaround:
+
+ CONFIG_SHELL=/bin/bash /bin/bash ./configure CONFIG_SHELL=/bin/bash
+
+`configure' Invocation
+======================
+
+ `configure' recognizes the following options to control how it
+operates.
+
+`--help'
+`-h'
+ Print a summary of all of the options to `configure', and exit.
+
+`--help=short'
+`--help=recursive'
+ Print a summary of the options unique to this package's
+ `configure', and exit. The `short' variant lists options used
+ only in the top level, while the `recursive' variant lists options
+ also present in any nested packages.
+
+`--version'
+`-V'
+ Print the version of Autoconf used to generate the `configure'
+ script, and exit.
+
+`--cache-file=FILE'
+ Enable the cache: use and save the results of the tests in FILE,
+ traditionally `config.cache'. FILE defaults to `/dev/null' to
+ disable caching.
+
+`--config-cache'
+`-C'
+ Alias for `--cache-file=config.cache'.
+
+`--quiet'
+`--silent'
+`-q'
+ Do not print messages saying which checks are being made. To
+ suppress all normal output, redirect it to `/dev/null' (any error
+ messages will still be shown).
+
+`--srcdir=DIR'
+ Look for the package's source code in directory DIR. Usually
+ `configure' can determine that directory automatically.
+
+`--prefix=DIR'
+ Use DIR as the installation prefix. *note Installation Names::
+ for more details, including other options available for fine-tuning
+ the installation locations.
+
+`--no-create'
+`-n'
+ Run the configure checks, but stop before creating any output
+ files.
+
+`configure' also accepts some other, not widely useful, options. Run
+`configure --help' for more details.
+
Added: trunk/packages/norsp/trunk/Makefile.am
===================================================================
--- trunk/packages/norsp/trunk/Makefile.am (rev 0)
+++ trunk/packages/norsp/trunk/Makefile.am 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,31 @@
+dist_noinst_DATA = debian/changelog debian/compat debian/control debian/copyright $(PACKAGE).spec
+dist_noinst_SCRIPTS = debian/rules
+
+dist_bin_SCRIPTS = norsp
+
+EXTRA_DIST = example
+
+man_MANS = norsp.1
+
+%.1: %
+ sed -e 's|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$<" | \
+ pod2man -c 'User Commands' -r "$(VERSION)" -name $(shell tr '[:lower:]' '[:upper:]' <<< "$(basename $@)") > "$@"
+
+clean-local:
+ rm -f norsp.1
+
+dist-hook:
+ rm -rf `find '$(distdir)' -name .svn`
+
+install-data-local:
+ mkdir -p '$(DESTDIR)$(pkgdatadir)'
+ cp -r '$(srcdir)'/example '$(DESTDIR)$(pkgdatadir)/'
+ rm -rf `find '$(DESTDIR)$(pkgdatadir)' -name .svn`
+ chmod -R u+w '$(DESTDIR)$(pkgdatadir)'
+
+install-exec-hook:
+ sed -i -e 's|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__VERSION__|$(VERSION)|g;' "$(DESTDIR)$(bindir)/norsp"
+
+uninstall-local:
+ rm -rf "$(DESTDIR)$(pkgdatadir)"
+
Added: trunk/packages/norsp/trunk/Makefile.in
===================================================================
--- trunk/packages/norsp/trunk/Makefile.in (rev 0)
+++ trunk/packages/norsp/trunk/Makefile.in 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,652 @@
+# Makefile.in generated by automake 1.11.5 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software
+# Foundation, Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+
+
+VPATH = @srcdir@
+am__make_dryrun = \
+ { \
+ am__dry=no; \
+ case $$MAKEFLAGS in \
+ *\\[\ \ ]*) \
+ echo 'am--echo: ; @echo "AM" OK' | $(MAKE) -f - 2>/dev/null \
+ | grep '^AM OK$$' >/dev/null || am__dry=yes;; \
+ *) \
+ for am__flg in $$MAKEFLAGS; do \
+ case $$am__flg in \
+ *=*|--*) ;; \
+ *n*) am__dry=yes; break;; \
+ esac; \
+ done;; \
+ esac; \
+ test $$am__dry = yes; \
+ }
+pkgdatadir = $(datadir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkglibexecdir = $(libexecdir)/@PACKAGE@
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+subdir = .
+DIST_COMMON = README $(am__configure_deps) $(dist_bin_SCRIPTS) \
+ $(dist_noinst_DATA) $(dist_noinst_SCRIPTS) \
+ $(srcdir)/Makefile.am $(srcdir)/Makefile.in \
+ $(top_srcdir)/configure AUTHORS COPYING ChangeLog INSTALL NEWS \
+ install-sh missing
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/configure.ac
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+ $(ACLOCAL_M4)
+am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \
+ configure.lineno config.status.lineno
+mkinstalldirs = $(install_sh) -d
+CONFIG_CLEAN_FILES =
+CONFIG_CLEAN_VPATH_FILES =
+am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`;
+am__vpath_adj = case $$p in \
+ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \
+ *) f=$$p;; \
+ esac;
+am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`;
+am__install_max = 40
+am__nobase_strip_setup = \
+ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'`
+am__nobase_strip = \
+ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||"
+am__nobase_list = $(am__nobase_strip_setup); \
+ for p in $$list; do echo "$$p $$p"; done | \
+ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \
+ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \
+ if (++n[$$2] == $(am__install_max)) \
+ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \
+ END { for (dir in files) print dir, files[dir] }'
+am__base_list = \
+ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \
+ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g'
+am__uninstall_files_from_dir = { \
+ test -z "$$files" \
+ || { test ! -d "$$dir" && test ! -f "$$dir" && test ! -r "$$dir"; } \
+ || { echo " ( cd '$$dir' && rm -f" $$files ")"; \
+ $(am__cd) "$$dir" && rm -f $$files; }; \
+ }
+am__installdirs = "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)"
+SCRIPTS = $(dist_bin_SCRIPTS) $(dist_noinst_SCRIPTS)
+SOURCES =
+DIST_SOURCES =
+am__can_run_installinfo = \
+ case $$AM_UPDATE_INFO_DIR in \
+ n|no|NO) false;; \
+ *) (install-info --version) >/dev/null 2>&1;; \
+ esac
+man1dir = $(mandir)/man1
+NROFF = nroff
+MANS = $(man_MANS)
+DATA = $(dist_noinst_DATA)
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+distdir = $(PACKAGE)-$(VERSION)
+top_distdir = $(distdir)
+am__remove_distdir = \
+ if test -d "$(distdir)"; then \
+ find "$(distdir)" -type d ! -perm -200 -exec chmod u+w {} ';' \
+ && rm -rf "$(distdir)" \
+ || { sleep 5 && rm -rf "$(distdir)"; }; \
+ else :; fi
+DIST_ARCHIVES = $(distdir).tar.gz
+GZIP_ENV = --best
+distuninstallcheck_listfiles = find . -type f -print
+am__distuninstallcheck_listfiles = $(distuninstallcheck_listfiles) \
+ | sed 's|^\./|$(prefix)/|' | grep -v '$(infodir)/dir$$'
+distcleancheck_listfiles = find . -type f -print
+ACLOCAL = @ACLOCAL@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+INSTALL = @INSTALL@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+MKDIR_P = @MKDIR_P@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_URL = @PACKAGE_URL@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+VERSION = @VERSION@
+abs_builddir = @abs_builddir@
+abs_srcdir = @abs_srcdir@
+abs_top_builddir = @abs_top_builddir@
+abs_top_srcdir = @abs_top_srcdir@
+am__leading_dot = @am__leading_dot@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build_alias = @build_alias@
+builddir = @builddir@
+datadir = @datadir@
+datarootdir = @datarootdir@
+docdir = @docdir@
+dvidir = @dvidir@
+exec_prefix = @exec_prefix@
+host_alias = @host_alias@
+htmldir = @htmldir@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localedir = @localedir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+pdfdir = @pdfdir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+psdir = @psdir@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+srcdir = @srcdir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+top_build_prefix = @top_build_prefix@
+top_builddir = @top_builddir@
+top_srcdir = @top_srcdir@
+dist_noinst_DATA = debian/changelog debian/compat debian/control debian/copyright $(PACKAGE).spec
+dist_noinst_SCRIPTS = debian/rules
+dist_bin_SCRIPTS = norsp
+EXTRA_DIST = example
+man_MANS = norsp.1
+all: all-am
+
+.SUFFIXES:
+am--refresh: Makefile
+ @:
+$(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps)
+ @for dep in $?; do \
+ case '$(am__configure_deps)' in \
+ *$$dep*) \
+ echo ' cd $(srcdir) && $(AUTOMAKE) --gnu'; \
+ $(am__cd) $(srcdir) && $(AUTOMAKE) --gnu \
+ && exit 0; \
+ exit 1;; \
+ esac; \
+ done; \
+ echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu Makefile'; \
+ $(am__cd) $(top_srcdir) && \
+ $(AUTOMAKE) --gnu Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+ @case '$?' in \
+ *config.status*) \
+ echo ' $(SHELL) ./config.status'; \
+ $(SHELL) ./config.status;; \
+ *) \
+ echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \
+ cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \
+ esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+ $(SHELL) ./config.status --recheck
+
+$(top_srcdir)/configure: $(am__configure_deps)
+ $(am__cd) $(srcdir) && $(AUTOCONF)
+$(ACLOCAL_M4): $(am__aclocal_m4_deps)
+ $(am__cd) $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS)
+$(am__aclocal_m4_deps):
+install-dist_binSCRIPTS: $(dist_bin_SCRIPTS)
+ @$(NORMAL_INSTALL)
+ @list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || list=; \
+ if test -n "$$list"; then \
+ echo " $(MKDIR_P) '$(DESTDIR)$(bindir)'"; \
+ $(MKDIR_P) "$(DESTDIR)$(bindir)" || exit 1; \
+ fi; \
+ for p in $$list; do \
+ if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \
+ if test -f "$$d$$p"; then echo "$$d$$p"; echo "$$p"; else :; fi; \
+ done | \
+ sed -e 'p;s,.*/,,;n' \
+ -e 'h;s|.*|.|' \
+ -e 'p;x;s,.*/,,;$(transform)' | sed 'N;N;N;s,\n, ,g' | \
+ $(AWK) 'BEGIN { files["."] = ""; dirs["."] = 1; } \
+ { d=$$3; if (dirs[d] != 1) { print "d", d; dirs[d] = 1 } \
+ if ($$2 == $$4) { files[d] = files[d] " " $$1; \
+ if (++n[d] == $(am__install_max)) { \
+ print "f", d, files[d]; n[d] = 0; files[d] = "" } } \
+ else { print "f", d "/" $$4, $$1 } } \
+ END { for (d in files) print "f", d, files[d] }' | \
+ while read type dir files; do \
+ if test "$$dir" = .; then dir=; else dir=/$$dir; fi; \
+ test -z "$$files" || { \
+ echo " $(INSTALL_SCRIPT) $$files '$(DESTDIR)$(bindir)$$dir'"; \
+ $(INSTALL_SCRIPT) $$files "$(DESTDIR)$(bindir)$$dir" || exit $$?; \
+ } \
+ ; done
+
+uninstall-dist_binSCRIPTS:
+ @$(NORMAL_UNINSTALL)
+ @list='$(dist_bin_SCRIPTS)'; test -n "$(bindir)" || exit 0; \
+ files=`for p in $$list; do echo "$$p"; done | \
+ sed -e 's,.*/,,;$(transform)'`; \
+ dir='$(DESTDIR)$(bindir)'; $(am__uninstall_files_from_dir)
+install-man1: $(man_MANS)
+ @$(NORMAL_INSTALL)
+ @list1=''; \
+ list2='$(man_MANS)'; \
+ test -n "$(man1dir)" \
+ && test -n "`echo $$list1$$list2`" \
+ || exit 0; \
+ echo " $(MKDIR_P) '$(DESTDIR)$(man1dir)'"; \
+ $(MKDIR_P) "$(DESTDIR)$(man1dir)" || exit 1; \
+ { for i in $$list1; do echo "$$i"; done; \
+ if test -n "$$list2"; then \
+ for i in $$list2; do echo "$$i"; done \
+ | sed -n '/\.1[a-z]*$$/p'; \
+ fi; \
+ } | while read p; do \
+ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \
+ echo "$$d$$p"; echo "$$p"; \
+ done | \
+ sed -e 'n;s,.*/,,;p;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \
+ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,' | \
+ sed 'N;N;s,\n, ,g' | { \
+ list=; while read file base inst; do \
+ if test "$$base" = "$$inst"; then list="$$list $$file"; else \
+ echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man1dir)/$$inst'"; \
+ $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man1dir)/$$inst" || exit $$?; \
+ fi; \
+ done; \
+ for i in $$list; do echo "$$i"; done | $(am__base_list) | \
+ while read files; do \
+ test -z "$$files" || { \
+ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(man1dir)'"; \
+ $(INSTALL_DATA) $$files "$(DESTDIR)$(man1dir)" || exit $$?; }; \
+ done; }
+
+uninstall-man1:
+ @$(NORMAL_UNINSTALL)
+ @list=''; test -n "$(man1dir)" || exit 0; \
+ files=`{ for i in $$list; do echo "$$i"; done; \
+ l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \
+ sed -n '/\.1[a-z]*$$/p'; \
+ } | sed -e 's,.*/,,;h;s,.*\.,,;s,^[^1][0-9a-z]*$$,1,;x' \
+ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,'`; \
+ dir='$(DESTDIR)$(man1dir)'; $(am__uninstall_files_from_dir)
+tags: TAGS
+TAGS:
+
+ctags: CTAGS
+CTAGS:
+
+
+distdir: $(DISTFILES)
+ @list='$(MANS)'; if test -n "$$list"; then \
+ list=`for p in $$list; do \
+ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \
+ if test -f "$$d$$p"; then echo "$$d$$p"; else :; fi; done`; \
+ if test -n "$$list" && \
+ grep 'ab help2man is required to generate this page' $$list >/dev/null; then \
+ echo "error: found man pages containing the \`missing help2man' replacement text:" >&2; \
+ grep -l 'ab help2man is required to generate this page' $$list | sed 's/^/ /' >&2; \
+ echo " to fix them, install help2man, remove and regenerate the man pages;" >&2; \
+ echo " typically \`make maintainer-clean' will remove them" >&2; \
+ exit 1; \
+ else :; fi; \
+ else :; fi
+ $(am__remove_distdir)
+ test -d "$(distdir)" || mkdir "$(distdir)"
+ @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \
+ list='$(DISTFILES)'; \
+ dist_files=`for file in $$list; do echo $$file; done | \
+ sed -e "s|^$$srcdirstrip/||;t" \
+ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \
+ case $$dist_files in \
+ */*) $(MKDIR_P) `echo "$$dist_files" | \
+ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \
+ sort -u` ;; \
+ esac; \
+ for file in $$dist_files; do \
+ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+ if test -d $$d/$$file; then \
+ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \
+ if test -d "$(distdir)/$$file"; then \
+ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+ fi; \
+ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \
+ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \
+ fi; \
+ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \
+ else \
+ test -f "$(distdir)/$$file" \
+ || cp -p $$d/$$file "$(distdir)/$$file" \
+ || exit 1; \
+ fi; \
+ done
+ $(MAKE) $(AM_MAKEFLAGS) \
+ top_distdir="$(top_distdir)" distdir="$(distdir)" \
+ dist-hook
+ -test -n "$(am__skip_mode_fix)" \
+ || find "$(distdir)" -type d ! -perm -755 \
+ -exec chmod u+rwx,go+rx {} \; -o \
+ ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \
+ ! -type d ! -perm -400 -exec chmod a+r {} \; -o \
+ ! -type d ! -perm -444 -exec $(install_sh) -c -m a+r {} {} \; \
+ || chmod -R a+r "$(distdir)"
+dist-gzip: distdir
+ tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz
+ $(am__remove_distdir)
+
+dist-bzip2: distdir
+ tardir=$(distdir) && $(am__tar) | BZIP2=$${BZIP2--9} bzip2 -c >$(distdir).tar.bz2
+ $(am__remove_distdir)
+
+dist-lzip: distdir
+ tardir=$(distdir) && $(am__tar) | lzip -c $${LZIP_OPT--9} >$(distdir).tar.lz
+ $(am__remove_distdir)
+
+dist-lzma: distdir
+ tardir=$(distdir) && $(am__tar) | lzma -9 -c >$(distdir).tar.lzma
+ $(am__remove_distdir)
+
+dist-xz: distdir
+ tardir=$(distdir) && $(am__tar) | XZ_OPT=$${XZ_OPT--e} xz -c >$(distdir).tar.xz
+ $(am__remove_distdir)
+
+dist-tarZ: distdir
+ tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z
+ $(am__remove_distdir)
+
+dist-shar: distdir
+ shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz
+ $(am__remove_distdir)
+
+dist-zip: distdir
+ -rm -f $(distdir).zip
+ zip -rq $(distdir).zip $(distdir)
+ $(am__remove_distdir)
+
+dist dist-all: distdir
+ tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz
+ $(am__remove_distdir)
+
+# This target untars the dist file and tries a VPATH configuration. Then
+# it guarantees that the distribution is self-contained by making another
+# tarfile.
+distcheck: dist
+ case '$(DIST_ARCHIVES)' in \
+ *.tar.gz*) \
+ GZIP=$(GZIP_ENV) gzip -dc $(distdir).tar.gz | $(am__untar) ;;\
+ *.tar.bz2*) \
+ bzip2 -dc $(distdir).tar.bz2 | $(am__untar) ;;\
+ *.tar.lzma*) \
+ lzma -dc $(distdir).tar.lzma | $(am__untar) ;;\
+ *.tar.lz*) \
+ lzip -dc $(distdir).tar.lz | $(am__untar) ;;\
+ *.tar.xz*) \
+ xz -dc $(distdir).tar.xz | $(am__untar) ;;\
+ *.tar.Z*) \
+ uncompress -c $(distdir).tar.Z | $(am__untar) ;;\
+ *.shar.gz*) \
+ GZIP=$(GZIP_ENV) gzip -dc $(distdir).shar.gz | unshar ;;\
+ *.zip*) \
+ unzip $(distdir).zip ;;\
+ esac
+ chmod -R a-w $(distdir); chmod a+w $(distdir)
+ mkdir $(distdir)/_build
+ mkdir $(distdir)/_inst
+ chmod a-w $(distdir)
+ test -d $(distdir)/_build || exit 0; \
+ dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \
+ && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \
+ && am__cwd=`pwd` \
+ && $(am__cd) $(distdir)/_build \
+ && ../configure --srcdir=.. --prefix="$$dc_install_base" \
+ $(AM_DISTCHECK_CONFIGURE_FLAGS) \
+ $(DISTCHECK_CONFIGURE_FLAGS) \
+ && $(MAKE) $(AM_MAKEFLAGS) \
+ && $(MAKE) $(AM_MAKEFLAGS) dvi \
+ && $(MAKE) $(AM_MAKEFLAGS) check \
+ && $(MAKE) $(AM_MAKEFLAGS) install \
+ && $(MAKE) $(AM_MAKEFLAGS) installcheck \
+ && $(MAKE) $(AM_MAKEFLAGS) uninstall \
+ && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \
+ distuninstallcheck \
+ && chmod -R a-w "$$dc_install_base" \
+ && ({ \
+ (cd ../.. && umask 077 && mkdir "$$dc_destdir") \
+ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \
+ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \
+ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \
+ distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \
+ } || { rm -rf "$$dc_destdir"; exit 1; }) \
+ && rm -rf "$$dc_destdir" \
+ && $(MAKE) $(AM_MAKEFLAGS) dist \
+ && rm -rf $(DIST_ARCHIVES) \
+ && $(MAKE) $(AM_MAKEFLAGS) distcleancheck \
+ && cd "$$am__cwd" \
+ || exit 1
+ $(am__remove_distdir)
+ @(echo "$(distdir) archives ready for distribution: "; \
+ list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \
+ sed -e 1h -e 1s/./=/g -e 1p -e 1x -e '$$p' -e '$$x'
+distuninstallcheck:
+ @test -n '$(distuninstallcheck_dir)' || { \
+ echo 'ERROR: trying to run $@ with an empty' \
+ '$$(distuninstallcheck_dir)' >&2; \
+ exit 1; \
+ }; \
+ $(am__cd) '$(distuninstallcheck_dir)' || { \
+ echo 'ERROR: cannot chdir into $(distuninstallcheck_dir)' >&2; \
+ exit 1; \
+ }; \
+ test `$(am__distuninstallcheck_listfiles) | wc -l` -eq 0 \
+ || { echo "ERROR: files left after uninstall:" ; \
+ if test -n "$(DESTDIR)"; then \
+ echo " (check DESTDIR support)"; \
+ fi ; \
+ $(distuninstallcheck_listfiles) ; \
+ exit 1; } >&2
+distcleancheck: distclean
+ @if test '$(srcdir)' = . ; then \
+ echo "ERROR: distcleancheck can only run from a VPATH build" ; \
+ exit 1 ; \
+ fi
+ @test `$(distcleancheck_listfiles) | wc -l` -eq 0 \
+ || { echo "ERROR: files left in build directory after distclean:" ; \
+ $(distcleancheck_listfiles) ; \
+ exit 1; } >&2
+check-am: all-am
+check: check-am
+all-am: Makefile $(SCRIPTS) $(MANS) $(DATA)
+installdirs:
+ for dir in "$(DESTDIR)$(bindir)" "$(DESTDIR)$(man1dir)"; do \
+ test -z "$$dir" || $(MKDIR_P) "$$dir"; \
+ done
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+ @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+ if test -z '$(STRIP)'; then \
+ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+ install; \
+ else \
+ $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+ "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'" install; \
+ fi
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+ -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+ -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES)
+
+maintainer-clean-generic:
+ @echo "This command is intended for maintainers to use"
+ @echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-generic clean-local mostlyclean-am
+
+distclean: distclean-am
+ -rm -f $(am__CONFIG_DISTCLEAN_FILES)
+ -rm -f Makefile
+distclean-am: clean-am distclean-generic
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+html-am:
+
+info: info-am
+
+info-am:
+
+install-data-am: install-data-local install-man
+
+install-dvi: install-dvi-am
+
+install-dvi-am:
+
+install-exec-am: install-dist_binSCRIPTS
+ @$(NORMAL_INSTALL)
+ $(MAKE) $(AM_MAKEFLAGS) install-exec-hook
+install-html: install-html-am
+
+install-html-am:
+
+install-info: install-info-am
+
+install-info-am:
+
+install-man: install-man1
+
+install-pdf: install-pdf-am
+
+install-pdf-am:
+
+install-ps: install-ps-am
+
+install-ps-am:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+ -rm -f $(am__CONFIG_DISTCLEAN_FILES)
+ -rm -rf $(top_srcdir)/autom4te.cache
+ -rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-dist_binSCRIPTS uninstall-local uninstall-man
+
+uninstall-man: uninstall-man1
+
+.MAKE: install-am install-exec-am install-strip
+
+.PHONY: all all-am am--refresh check check-am clean clean-generic \
+ clean-local dist dist-all dist-bzip2 dist-gzip dist-hook \
+ dist-lzip dist-lzma dist-shar dist-tarZ dist-xz dist-zip \
+ distcheck distclean distclean-generic distcleancheck distdir \
+ distuninstallcheck dvi dvi-am html html-am info info-am \
+ install install-am install-data install-data-am \
+ install-data-local install-dist_binSCRIPTS install-dvi \
+ install-dvi-am install-exec install-exec-am install-exec-hook \
+ install-html install-html-am install-info install-info-am \
+ install-man install-man1 install-pdf install-pdf-am install-ps \
+ install-ps-am install-strip installcheck installcheck-am \
+ installdirs maintainer-clean maintainer-clean-generic \
+ mostlyclean mostlyclean-generic pdf pdf-am ps ps-am uninstall \
+ uninstall-am uninstall-dist_binSCRIPTS uninstall-local \
+ uninstall-man uninstall-man1
+
+
+%.1: %
+ sed -e 's|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__bindir__|$(bindir)|g;s|__VERSION__|$(VERSION)|g' "$<" | \
+ pod2man -c 'User Commands' -r "$(VERSION)" -name $(shell tr '[:lower:]' '[:upper:]' <<< "$(basename $@)") > "$@"
+
+clean-local:
+ rm -f norsp.1
+
+dist-hook:
+ rm -rf `find '$(distdir)' -name .svn`
+
+install-data-local:
+ mkdir -p '$(DESTDIR)$(pkgdatadir)'
+ cp -r '$(srcdir)'/example '$(DESTDIR)$(pkgdatadir)/'
+ rm -rf `find '$(DESTDIR)$(pkgdatadir)' -name .svn`
+ chmod -R u+w '$(DESTDIR)$(pkgdatadir)'
+
+install-exec-hook:
+ sed -i -e 's|__pkgdatadir__|$(pkgdatadir)|g;s|__sysconfdir__|$(sysconfdir)|g;s|__VERSION__|$(VERSION)|g;' "$(DESTDIR)$(bindir)/norsp"
+
+uninstall-local:
+ rm -rf "$(DESTDIR)$(pkgdatadir)"
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:
Added: trunk/packages/norsp/trunk/NEWS
===================================================================
Added: trunk/packages/norsp/trunk/README
===================================================================
Added: trunk/packages/norsp/trunk/aclocal.m4
===================================================================
--- trunk/packages/norsp/trunk/aclocal.m4 (rev 0)
+++ trunk/packages/norsp/trunk/aclocal.m4 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,617 @@
+# generated automatically by aclocal 1.11.5 -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004,
+# 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software Foundation,
+# Inc.
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+m4_ifndef([AC_AUTOCONF_VERSION],
+ [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl
+m4_if(m4_defn([AC_AUTOCONF_VERSION]), [2.69],,
+[m4_warning([this file was generated for autoconf 2.69.
+You have another version of autoconf. It may work, but is not guaranteed to.
+If you have problems, you may need to regenerate the build system entirely.
+To do so, use the procedure documented by the package, typically `autoreconf'.])])
+
+# Copyright (C) 2002, 2003, 2005, 2006, 2007, 2008, 2011 Free Software
+# Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 1
+
+# AM_AUTOMAKE_VERSION(VERSION)
+# ----------------------------
+# Automake X.Y traces this macro to ensure aclocal.m4 has been
+# generated from the m4 files accompanying Automake X.Y.
+# (This private macro should not be called outside this file.)
+AC_DEFUN([AM_AUTOMAKE_VERSION],
+[am__api_version='1.11'
+dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to
+dnl require some minimum version. Point them to the right macro.
+m4_if([$1], [1.11.5], [],
+ [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl
+])
+
+# _AM_AUTOCONF_VERSION(VERSION)
+# -----------------------------
+# aclocal traces this macro to find the Autoconf version.
+# This is a private macro too. Using m4_define simplifies
+# the logic in aclocal, which can simply ignore this definition.
+m4_define([_AM_AUTOCONF_VERSION], [])
+
+# AM_SET_CURRENT_AUTOMAKE_VERSION
+# -------------------------------
+# Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced.
+# This function is AC_REQUIREd by AM_INIT_AUTOMAKE.
+AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION],
+[AM_AUTOMAKE_VERSION([1.11.5])dnl
+m4_ifndef([AC_AUTOCONF_VERSION],
+ [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl
+_AM_AUTOCONF_VERSION(m4_defn([AC_AUTOCONF_VERSION]))])
+
+# AM_AUX_DIR_EXPAND -*- Autoconf -*-
+
+# Copyright (C) 2001, 2003, 2005, 2011 Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 1
+
+# For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets
+# $ac_aux_dir to `$srcdir/foo'. In other projects, it is set to
+# `$srcdir', `$srcdir/..', or `$srcdir/../..'.
+#
+# Of course, Automake must honor this variable whenever it calls a
+# tool from the auxiliary directory. The problem is that $srcdir (and
+# therefore $ac_aux_dir as well) can be either absolute or relative,
+# depending on how configure is run. This is pretty annoying, since
+# it makes $ac_aux_dir quite unusable in subdirectories: in the top
+# source directory, any form will work fine, but in subdirectories a
+# relative path needs to be adjusted first.
+#
+# $ac_aux_dir/missing
+# fails when called from a subdirectory if $ac_aux_dir is relative
+# $top_srcdir/$ac_aux_dir/missing
+# fails if $ac_aux_dir is absolute,
+# fails when called from a subdirectory in a VPATH build with
+# a relative $ac_aux_dir
+#
+# The reason of the latter failure is that $top_srcdir and $ac_aux_dir
+# are both prefixed by $srcdir. In an in-source build this is usually
+# harmless because $srcdir is `.', but things will broke when you
+# start a VPATH build or use an absolute $srcdir.
+#
+# So we could use something similar to $top_srcdir/$ac_aux_dir/missing,
+# iff we strip the leading $srcdir from $ac_aux_dir. That would be:
+# am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"`
+# and then we would define $MISSING as
+# MISSING="\${SHELL} $am_aux_dir/missing"
+# This will work as long as MISSING is not called from configure, because
+# unfortunately $(top_srcdir) has no meaning in configure.
+# However there are other variables, like CC, which are often used in
+# configure, and could therefore not use this "fixed" $ac_aux_dir.
+#
+# Another solution, used here, is to always expand $ac_aux_dir to an
+# absolute PATH. The drawback is that using absolute paths prevent a
+# configured tree to be moved without reconfiguration.
+
+AC_DEFUN([AM_AUX_DIR_EXPAND],
+[dnl Rely on autoconf to set up CDPATH properly.
+AC_PREREQ([2.50])dnl
+# expand $ac_aux_dir to an absolute path
+am_aux_dir=`cd $ac_aux_dir && pwd`
+])
+
+# Do all the work for Automake. -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004,
+# 2005, 2006, 2008, 2009 Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 16
+
+# This macro actually does too much. Some checks are only needed if
+# your package does certain things. But this isn't really a big deal.
+
+# AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE])
+# AM_INIT_AUTOMAKE([OPTIONS])
+# -----------------------------------------------
+# The call with PACKAGE and VERSION arguments is the old style
+# call (pre autoconf-2.50), which is being phased out. PACKAGE
+# and VERSION should now be passed to AC_INIT and removed from
+# the call to AM_INIT_AUTOMAKE.
+# We support both call styles for the transition. After
+# the next Automake release, Autoconf can make the AC_INIT
+# arguments mandatory, and then we can depend on a new Autoconf
+# release and drop the old call support.
+AC_DEFUN([AM_INIT_AUTOMAKE],
+[AC_PREREQ([2.62])dnl
+dnl Autoconf wants to disallow AM_ names. We explicitly allow
+dnl the ones we care about.
+m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl
+AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl
+AC_REQUIRE([AC_PROG_INSTALL])dnl
+if test "`cd $srcdir && pwd`" != "`pwd`"; then
+ # Use -I$(srcdir) only when $(srcdir) != ., so that make's output
+ # is not polluted with repeated "-I."
+ AC_SUBST([am__isrc], [' -I$(srcdir)'])_AM_SUBST_NOTMAKE([am__isrc])dnl
+ # test to see if srcdir already configured
+ if test -f $srcdir/config.status; then
+ AC_MSG_ERROR([source directory already configured; run "make distclean" there first])
+ fi
+fi
+
+# test whether we have cygpath
+if test -z "$CYGPATH_W"; then
+ if (cygpath --version) >/dev/null 2>/dev/null; then
+ CYGPATH_W='cygpath -w'
+ else
+ CYGPATH_W=echo
+ fi
+fi
+AC_SUBST([CYGPATH_W])
+
+# Define the identity of the package.
+dnl Distinguish between old-style and new-style calls.
+m4_ifval([$2],
+[m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl
+ AC_SUBST([PACKAGE], [$1])dnl
+ AC_SUBST([VERSION], [$2])],
+[_AM_SET_OPTIONS([$1])dnl
+dnl Diagnose old-style AC_INIT with new-style AM_AUTOMAKE_INIT.
+m4_if(m4_ifdef([AC_PACKAGE_NAME], 1)m4_ifdef([AC_PACKAGE_VERSION], 1), 11,,
+ [m4_fatal([AC_INIT should be called with package and version arguments])])dnl
+ AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl
+ AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl
+
+_AM_IF_OPTION([no-define],,
+[AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package])
+ AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl
+
+# Some tools Automake needs.
+AC_REQUIRE([AM_SANITY_CHECK])dnl
+AC_REQUIRE([AC_ARG_PROGRAM])dnl
+AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version})
+AM_MISSING_PROG(AUTOCONF, autoconf)
+AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version})
+AM_MISSING_PROG(AUTOHEADER, autoheader)
+AM_MISSING_PROG(MAKEINFO, makeinfo)
+AC_REQUIRE([AM_PROG_INSTALL_SH])dnl
+AC_REQUIRE([AM_PROG_INSTALL_STRIP])dnl
+AC_REQUIRE([AM_PROG_MKDIR_P])dnl
+# We need awk for the "check" target. The system "awk" is bad on
+# some platforms.
+AC_REQUIRE([AC_PROG_AWK])dnl
+AC_REQUIRE([AC_PROG_MAKE_SET])dnl
+AC_REQUIRE([AM_SET_LEADING_DOT])dnl
+_AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])],
+ [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])],
+ [_AM_PROG_TAR([v7])])])
+_AM_IF_OPTION([no-dependencies],,
+[AC_PROVIDE_IFELSE([AC_PROG_CC],
+ [_AM_DEPENDENCIES(CC)],
+ [define([AC_PROG_CC],
+ defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl
+AC_PROVIDE_IFELSE([AC_PROG_CXX],
+ [_AM_DEPENDENCIES(CXX)],
+ [define([AC_PROG_CXX],
+ defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl
+AC_PROVIDE_IFELSE([AC_PROG_OBJC],
+ [_AM_DEPENDENCIES(OBJC)],
+ [define([AC_PROG_OBJC],
+ defn([AC_PROG_OBJC])[_AM_DEPENDENCIES(OBJC)])])dnl
+])
+_AM_IF_OPTION([silent-rules], [AC_REQUIRE([AM_SILENT_RULES])])dnl
+dnl The `parallel-tests' driver may need to know about EXEEXT, so add the
+dnl `am__EXEEXT' conditional if _AM_COMPILER_EXEEXT was seen. This macro
+dnl is hooked onto _AC_COMPILER_EXEEXT early, see below.
+AC_CONFIG_COMMANDS_PRE(dnl
+[m4_provide_if([_AM_COMPILER_EXEEXT],
+ [AM_CONDITIONAL([am__EXEEXT], [test -n "$EXEEXT"])])])dnl
+])
+
+dnl Hook into `_AC_COMPILER_EXEEXT' early to learn its expansion. Do not
+dnl add the conditional right here, as _AC_COMPILER_EXEEXT may be further
+dnl mangled by Autoconf and run in a shell conditional statement.
+m4_define([_AC_COMPILER_EXEEXT],
+m4_defn([_AC_COMPILER_EXEEXT])[m4_provide([_AM_COMPILER_EXEEXT])])
+
+
+# When config.status generates a header, we must update the stamp-h file.
+# This file resides in the same directory as the config header
+# that is generated. The stamp files are numbered to have different names.
+
+# Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the
+# loop where config.status creates the headers, so we can generate
+# our stamp files there.
+AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK],
+[# Compute $1's index in $config_headers.
+_am_arg=$1
+_am_stamp_count=1
+for _am_header in $config_headers :; do
+ case $_am_header in
+ $_am_arg | $_am_arg:* )
+ break ;;
+ * )
+ _am_stamp_count=`expr $_am_stamp_count + 1` ;;
+ esac
+done
+echo "timestamp for $_am_arg" >`AS_DIRNAME(["$_am_arg"])`/stamp-h[]$_am_stamp_count])
+
+# Copyright (C) 2001, 2003, 2005, 2008, 2011 Free Software Foundation,
+# Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 1
+
+# AM_PROG_INSTALL_SH
+# ------------------
+# Define $install_sh.
+AC_DEFUN([AM_PROG_INSTALL_SH],
+[AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl
+if test x"${install_sh}" != xset; then
+ case $am_aux_dir in
+ *\ * | *\ *)
+ install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;;
+ *)
+ install_sh="\${SHELL} $am_aux_dir/install-sh"
+ esac
+fi
+AC_SUBST(install_sh)])
+
+# Copyright (C) 2003, 2005 Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 2
+
+# Check whether the underlying file-system supports filenames
+# with a leading dot. For instance MS-DOS doesn't.
+AC_DEFUN([AM_SET_LEADING_DOT],
+[rm -rf .tst 2>/dev/null
+mkdir .tst 2>/dev/null
+if test -d .tst; then
+ am__leading_dot=.
+else
+ am__leading_dot=_
+fi
+rmdir .tst 2>/dev/null
+AC_SUBST([am__leading_dot])])
+
+# Fake the existence of programs that GNU maintainers use. -*- Autoconf -*-
+
+# Copyright (C) 1997, 1999, 2000, 2001, 2003, 2004, 2005, 2008
+# Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 6
+
+# AM_MISSING_PROG(NAME, PROGRAM)
+# ------------------------------
+AC_DEFUN([AM_MISSING_PROG],
+[AC_REQUIRE([AM_MISSING_HAS_RUN])
+$1=${$1-"${am_missing_run}$2"}
+AC_SUBST($1)])
+
+
+# AM_MISSING_HAS_RUN
+# ------------------
+# Define MISSING if not defined so far and test if it supports --run.
+# If it does, set am_missing_run to use it, otherwise, to nothing.
+AC_DEFUN([AM_MISSING_HAS_RUN],
+[AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl
+AC_REQUIRE_AUX_FILE([missing])dnl
+if test x"${MISSING+set}" != xset; then
+ case $am_aux_dir in
+ *\ * | *\ *)
+ MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;;
+ *)
+ MISSING="\${SHELL} $am_aux_dir/missing" ;;
+ esac
+fi
+# Use eval to expand $SHELL
+if eval "$MISSING --run true"; then
+ am_missing_run="$MISSING --run "
+else
+ am_missing_run=
+ AC_MSG_WARN([`missing' script is too old or missing])
+fi
+])
+
+# Copyright (C) 2003, 2004, 2005, 2006, 2011 Free Software Foundation,
+# Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 1
+
+# AM_PROG_MKDIR_P
+# ---------------
+# Check for `mkdir -p'.
+AC_DEFUN([AM_PROG_MKDIR_P],
+[AC_PREREQ([2.60])dnl
+AC_REQUIRE([AC_PROG_MKDIR_P])dnl
+dnl Automake 1.8 to 1.9.6 used to define mkdir_p. We now use MKDIR_P,
+dnl while keeping a definition of mkdir_p for backward compatibility.
+dnl @MKDIR_P@ is magic: AC_OUTPUT adjusts its value for each Makefile.
+dnl However we cannot define mkdir_p as $(MKDIR_P) for the sake of
+dnl Makefile.ins that do not define MKDIR_P, so we do our own
+dnl adjustment using top_builddir (which is defined more often than
+dnl MKDIR_P).
+AC_SUBST([mkdir_p], ["$MKDIR_P"])dnl
+case $mkdir_p in
+ [[\\/$]]* | ?:[[\\/]]*) ;;
+ */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;;
+esac
+])
+
+# Helper functions for option handling. -*- Autoconf -*-
+
+# Copyright (C) 2001, 2002, 2003, 2005, 2008, 2010 Free Software
+# Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 5
+
+# _AM_MANGLE_OPTION(NAME)
+# -----------------------
+AC_DEFUN([_AM_MANGLE_OPTION],
+[[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])])
+
+# _AM_SET_OPTION(NAME)
+# --------------------
+# Set option NAME. Presently that only means defining a flag for this option.
+AC_DEFUN([_AM_SET_OPTION],
+[m4_define(_AM_MANGLE_OPTION([$1]), 1)])
+
+# _AM_SET_OPTIONS(OPTIONS)
+# ------------------------
+# OPTIONS is a space-separated list of Automake options.
+AC_DEFUN([_AM_SET_OPTIONS],
+[m4_foreach_w([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])])
+
+# _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET])
+# -------------------------------------------
+# Execute IF-SET if OPTION is set, IF-NOT-SET otherwise.
+AC_DEFUN([_AM_IF_OPTION],
+[m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])])
+
+# Check to make sure that the build environment is sane. -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 2000, 2001, 2003, 2005, 2008
+# Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 5
+
+# AM_SANITY_CHECK
+# ---------------
+AC_DEFUN([AM_SANITY_CHECK],
+[AC_MSG_CHECKING([whether build environment is sane])
+# Just in case
+sleep 1
+echo timestamp > conftest.file
+# Reject unsafe characters in $srcdir or the absolute working directory
+# name. Accept space and tab only in the latter.
+am_lf='
+'
+case `pwd` in
+ *[[\\\"\#\$\&\'\`$am_lf]]*)
+ AC_MSG_ERROR([unsafe absolute working directory name]);;
+esac
+case $srcdir in
+ *[[\\\"\#\$\&\'\`$am_lf\ \ ]]*)
+ AC_MSG_ERROR([unsafe srcdir value: `$srcdir']);;
+esac
+
+# Do `set' in a subshell so we don't clobber the current shell's
+# arguments. Must try -L first in case configure is actually a
+# symlink; some systems play weird games with the mod time of symlinks
+# (eg FreeBSD returns the mod time of the symlink's containing
+# directory).
+if (
+ set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null`
+ if test "$[*]" = "X"; then
+ # -L didn't work.
+ set X `ls -t "$srcdir/configure" conftest.file`
+ fi
+ rm -f conftest.file
+ if test "$[*]" != "X $srcdir/configure conftest.file" \
+ && test "$[*]" != "X conftest.file $srcdir/configure"; then
+
+ # If neither matched, then we have a broken ls. This can happen
+ # if, for instance, CONFIG_SHELL is bash and it inherits a
+ # broken ls alias from the environment. This has actually
+ # happened. Such a system could not be considered "sane".
+ AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken
+alias in your environment])
+ fi
+
+ test "$[2]" = conftest.file
+ )
+then
+ # Ok.
+ :
+else
+ AC_MSG_ERROR([newly created file is older than distributed files!
+Check your system clock])
+fi
+AC_MSG_RESULT(yes)])
+
+# Copyright (C) 2001, 2003, 2005, 2011 Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 1
+
+# AM_PROG_INSTALL_STRIP
+# ---------------------
+# One issue with vendor `install' (even GNU) is that you can't
+# specify the program used to strip binaries. This is especially
+# annoying in cross-compiling environments, where the build's strip
+# is unlikely to handle the host's binaries.
+# Fortunately install-sh will honor a STRIPPROG variable, so we
+# always use install-sh in `make install-strip', and initialize
+# STRIPPROG with the value of the STRIP variable (set by the user).
+AC_DEFUN([AM_PROG_INSTALL_STRIP],
+[AC_REQUIRE([AM_PROG_INSTALL_SH])dnl
+# Installed binaries are usually stripped using `strip' when the user
+# run `make install-strip'. However `strip' might not be the right
+# tool to use in cross-compilation environments, therefore Automake
+# will honor the `STRIP' environment variable to overrule this program.
+dnl Don't test for $cross_compiling = yes, because it might be `maybe'.
+if test "$cross_compiling" != no; then
+ AC_CHECK_TOOL([STRIP], [strip], :)
+fi
+INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s"
+AC_SUBST([INSTALL_STRIP_PROGRAM])])
+
+# Copyright (C) 2006, 2008, 2010 Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 3
+
+# _AM_SUBST_NOTMAKE(VARIABLE)
+# ---------------------------
+# Prevent Automake from outputting VARIABLE = @VARIABLE@ in Makefile.in.
+# This macro is traced by Automake.
+AC_DEFUN([_AM_SUBST_NOTMAKE])
+
+# AM_SUBST_NOTMAKE(VARIABLE)
+# --------------------------
+# Public sister of _AM_SUBST_NOTMAKE.
+AC_DEFUN([AM_SUBST_NOTMAKE], [_AM_SUBST_NOTMAKE($@)])
+
+# Check how to create a tarball. -*- Autoconf -*-
+
+# Copyright (C) 2004, 2005, 2012 Free Software Foundation, Inc.
+#
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# serial 2
+
+# _AM_PROG_TAR(FORMAT)
+# --------------------
+# Check how to create a tarball in format FORMAT.
+# FORMAT should be one of `v7', `ustar', or `pax'.
+#
+# Substitute a variable $(am__tar) that is a command
+# writing to stdout a FORMAT-tarball containing the directory
+# $tardir.
+# tardir=directory && $(am__tar) > result.tar
+#
+# Substitute a variable $(am__untar) that extract such
+# a tarball read from stdin.
+# $(am__untar) < result.tar
+AC_DEFUN([_AM_PROG_TAR],
+[# Always define AMTAR for backward compatibility. Yes, it's still used
+# in the wild :-( We should find a proper way to deprecate it ...
+AC_SUBST([AMTAR], ['$${TAR-tar}'])
+m4_if([$1], [v7],
+ [am__tar='$${TAR-tar} chof - "$$tardir"' am__untar='$${TAR-tar} xf -'],
+ [m4_case([$1], [ustar],, [pax],,
+ [m4_fatal([Unknown tar format])])
+AC_MSG_CHECKING([how to create a $1 tar archive])
+# Loop over all known methods to create a tar archive until one works.
+_am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none'
+_am_tools=${am_cv_prog_tar_$1-$_am_tools}
+# Do not fold the above two line into one, because Tru64 sh and
+# Solaris sh will not grok spaces in the rhs of `-'.
+for _am_tool in $_am_tools
+do
+ case $_am_tool in
+ gnutar)
+ for _am_tar in tar gnutar gtar;
+ do
+ AM_RUN_LOG([$_am_tar --version]) && break
+ done
+ am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"'
+ am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"'
+ am__untar="$_am_tar -xf -"
+ ;;
+ plaintar)
+ # Must skip GNU tar: if it does not support --format= it doesn't create
+ # ustar tarball either.
+ (tar --version) >/dev/null 2>&1 && continue
+ am__tar='tar chf - "$$tardir"'
+ am__tar_='tar chf - "$tardir"'
+ am__untar='tar xf -'
+ ;;
+ pax)
+ am__tar='pax -L -x $1 -w "$$tardir"'
+ am__tar_='pax -L -x $1 -w "$tardir"'
+ am__untar='pax -r'
+ ;;
+ cpio)
+ am__tar='find "$$tardir" -print | cpio -o -H $1 -L'
+ am__tar_='find "$tardir" -print | cpio -o -H $1 -L'
+ am__untar='cpio -i -H $1 -d'
+ ;;
+ none)
+ am__tar=false
+ am__tar_=false
+ am__untar=false
+ ;;
+ esac
+
+ # If the value was cached, stop now. We just wanted to have am__tar
+ # and am__untar set.
+ test -n "${am_cv_prog_tar_$1}" && break
+
+ # tar/untar a dummy directory, and stop if the command works
+ rm -rf conftest.dir
+ mkdir conftest.dir
+ echo GrepMe > conftest.dir/file
+ AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar])
+ rm -rf conftest.dir
+ if test -s conftest.tar; then
+ AM_RUN_LOG([$am__untar <conftest.tar])
+ grep GrepMe conftest.dir/file >/dev/null 2>&1 && break
+ fi
+done
+rm -rf conftest.dir
+
+AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool])
+AC_MSG_RESULT([$am_cv_prog_tar_$1])])
+AC_SUBST([am__tar])
+AC_SUBST([am__untar])
+]) # _AM_PROG_TAR
+
Added: trunk/packages/norsp/trunk/configure
===================================================================
--- trunk/packages/norsp/trunk/configure (rev 0)
+++ trunk/packages/norsp/trunk/configure 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,3377 @@
+#! /bin/sh
+# Guess values for system-dependent variables and create Makefiles.
+# Generated by GNU Autoconf 2.69 for norsp 1.0.3.
+#
+# Report bugs to <https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsp>.
+#
+#
+# Copyright (C) 1992-1996, 1998-2012 Free Software Foundation, Inc.
+#
+#
+# This configure script is free software; the Free Software Foundation
+# gives unlimited permission to copy, distribute and modify it.
+## -------------------- ##
+## M4sh Initialization. ##
+## -------------------- ##
+
+# Be more Bourne compatible
+DUALCASE=1; export DUALCASE # for MKS sh
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then :
+ emulate sh
+ NULLCMD=:
+ # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which
+ # is contrary to our usage. Disable this feature.
+ alias -g '${1+"$@"}'='"$@"'
+ setopt NO_GLOB_SUBST
+else
+ case `(set -o) 2>/dev/null` in #(
+ *posix*) :
+ set -o posix ;; #(
+ *) :
+ ;;
+esac
+fi
+
+
+as_nl='
+'
+export as_nl
+# Printing a long string crashes Solaris 7 /usr/bin/printf.
+as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\'
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo
+# Prefer a ksh shell builtin over an external printf program on Solaris,
+# but without wasting forks for bash or zsh.
+if test -z "$BASH_VERSION$ZSH_VERSION" \
+ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then
+ as_echo='print -r --'
+ as_echo_n='print -rn --'
+elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then
+ as_echo='printf %s\n'
+ as_echo_n='printf %s'
+else
+ if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then
+ as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"'
+ as_echo_n='/usr/ucb/echo -n'
+ else
+ as_echo_body='eval expr "X$1" : "X\\(.*\\)"'
+ as_echo_n_body='eval
+ arg=$1;
+ case $arg in #(
+ *"$as_nl"*)
+ expr "X$arg" : "X\\(.*\\)$as_nl";
+ arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;;
+ esac;
+ expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl"
+ '
+ export as_echo_n_body
+ as_echo_n='sh -c $as_echo_n_body as_echo'
+ fi
+ export as_echo_body
+ as_echo='sh -c $as_echo_body as_echo'
+fi
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+ PATH_SEPARATOR=:
+ (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && {
+ (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 ||
+ PATH_SEPARATOR=';'
+ }
+fi
+
+
+# IFS
+# We need space, tab and new line, in precisely that order. Quoting is
+# there to prevent editors from complaining about space-tab.
+# (If _AS_PATH_WALK were called with IFS unset, it would disable word
+# splitting by setting IFS to empty value.)
+IFS=" "" $as_nl"
+
+# Find who we are. Look in the path if we contain no directory separator.
+as_myself=
+case $0 in #((
+ *[\\/]* ) as_myself=$0 ;;
+ *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+ done
+IFS=$as_save_IFS
+
+ ;;
+esac
+# We did not find ourselves, most probably we were run as `sh COMMAND'
+# in which case we are not to be found in the path.
+if test "x$as_myself" = x; then
+ as_myself=$0
+fi
+if test ! -f "$as_myself"; then
+ $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+ exit 1
+fi
+
+# Unset variables that we do not need and which cause bugs (e.g. in
+# pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1"
+# suppresses any "Segmentation fault" message there. '((' could
+# trigger a bug in pdksh 5.2.14.
+for as_var in BASH_ENV ENV MAIL MAILPATH
+do eval test x\${$as_var+set} = xset \
+ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
+done
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+LC_ALL=C
+export LC_ALL
+LANGUAGE=C
+export LANGUAGE
+
+# CDPATH.
+(unset CDPATH) >/dev/null 2>&1 && unset CDPATH
+
+# Use a proper internal environment variable to ensure we don't fall
+ # into an infinite loop, continuously re-executing ourselves.
+ if test x"${_as_can_reexec}" != xno && test "x$CONFIG_SHELL" != x; then
+ _as_can_reexec=no; export _as_can_reexec;
+ # We cannot yet assume a decent shell, so we have to provide a
+# neutralization value for shells without unset; and this also
+# works around shells that cannot unset nonexistent variables.
+# Preserve -v and -x to the replacement shell.
+BASH_ENV=/dev/null
+ENV=/dev/null
+(unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV
+case $- in # ((((
+ *v*x* | *x*v* ) as_opts=-vx ;;
+ *v* ) as_opts=-v ;;
+ *x* ) as_opts=-x ;;
+ * ) as_opts= ;;
+esac
+exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"}
+# Admittedly, this is quite paranoid, since all the known shells bail
+# out after a failed `exec'.
+$as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2
+as_fn_exit 255
+ fi
+ # We don't want this to propagate to other subprocesses.
+ { _as_can_reexec=; unset _as_can_reexec;}
+if test "x$CONFIG_SHELL" = x; then
+ as_bourne_compatible="if test -n \"\${ZSH_VERSION+set}\" && (emulate sh) >/dev/null 2>&1; then :
+ emulate sh
+ NULLCMD=:
+ # Pre-4.2 versions of Zsh do word splitting on \${1+\"\$@\"}, which
+ # is contrary to our usage. Disable this feature.
+ alias -g '\${1+\"\$@\"}'='\"\$@\"'
+ setopt NO_GLOB_SUBST
+else
+ case \`(set -o) 2>/dev/null\` in #(
+ *posix*) :
+ set -o posix ;; #(
+ *) :
+ ;;
+esac
+fi
+"
+ as_required="as_fn_return () { (exit \$1); }
+as_fn_success () { as_fn_return 0; }
+as_fn_failure () { as_fn_return 1; }
+as_fn_ret_success () { return 0; }
+as_fn_ret_failure () { return 1; }
+
+exitcode=0
+as_fn_success || { exitcode=1; echo as_fn_success failed.; }
+as_fn_failure && { exitcode=1; echo as_fn_failure succeeded.; }
+as_fn_ret_success || { exitcode=1; echo as_fn_ret_success failed.; }
+as_fn_ret_failure && { exitcode=1; echo as_fn_ret_failure succeeded.; }
+if ( set x; as_fn_ret_success y && test x = \"\$1\" ); then :
+
+else
+ exitcode=1; echo positional parameters were not saved.
+fi
+test x\$exitcode = x0 || exit 1
+test -x / || exit 1"
+ as_suggested=" as_lineno_1=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_1a=\$LINENO
+ as_lineno_2=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_2a=\$LINENO
+ eval 'test \"x\$as_lineno_1'\$as_run'\" != \"x\$as_lineno_2'\$as_run'\" &&
+ test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1"
+ if (eval "$as_required") 2>/dev/null; then :
+ as_have_required=yes
+else
+ as_have_required=no
+fi
+ if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null; then :
+
+else
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+as_found=false
+for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ as_found=:
+ case $as_dir in #(
+ /*)
+ for as_base in sh bash ksh sh5; do
+ # Try only shells that exist, to save several forks.
+ as_shell=$as_dir/$as_base
+ if { test -f "$as_shell" || test -f "$as_shell.exe"; } &&
+ { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$as_shell"; } 2>/dev/null; then :
+ CONFIG_SHELL=$as_shell as_have_required=yes
+ if { $as_echo "$as_bourne_compatible""$as_suggested" | as_run=a "$as_shell"; } 2>/dev/null; then :
+ break 2
+fi
+fi
+ done;;
+ esac
+ as_found=false
+done
+$as_found || { if { test -f "$SHELL" || test -f "$SHELL.exe"; } &&
+ { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$SHELL"; } 2>/dev/null; then :
+ CONFIG_SHELL=$SHELL as_have_required=yes
+fi; }
+IFS=$as_save_IFS
+
+
+ if test "x$CONFIG_SHELL" != x; then :
+ export CONFIG_SHELL
+ # We cannot yet assume a decent shell, so we have to provide a
+# neutralization value for shells without unset; and this also
+# works around shells that cannot unset nonexistent variables.
+# Preserve -v and -x to the replacement shell.
+BASH_ENV=/dev/null
+ENV=/dev/null
+(unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV
+case $- in # ((((
+ *v*x* | *x*v* ) as_opts=-vx ;;
+ *v* ) as_opts=-v ;;
+ *x* ) as_opts=-x ;;
+ * ) as_opts= ;;
+esac
+exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"}
+# Admittedly, this is quite paranoid, since all the known shells bail
+# out after a failed `exec'.
+$as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2
+exit 255
+fi
+
+ if test x$as_have_required = xno; then :
+ $as_echo "$0: This script requires a shell more modern than all"
+ $as_echo "$0: the shells that I found on your system."
+ if test x${ZSH_VERSION+set} = xset ; then
+ $as_echo "$0: In particular, zsh $ZSH_VERSION has bugs and should"
+ $as_echo "$0: be upgraded to zsh 4.3.4 or later."
+ else
+ $as_echo "$0: Please tell bug-autoconf at gnu.org and
+$0: https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsp
+$0: about your system, including any error possibly output
+$0: before this message. Then install a modern shell, or
+$0: manually run the script under such a shell if you do
+$0: have one."
+ fi
+ exit 1
+fi
+fi
+fi
+SHELL=${CONFIG_SHELL-/bin/sh}
+export SHELL
+# Unset more variables known to interfere with behavior of common tools.
+CLICOLOR_FORCE= GREP_OPTIONS=
+unset CLICOLOR_FORCE GREP_OPTIONS
+
+## --------------------- ##
+## M4sh Shell Functions. ##
+## --------------------- ##
+# as_fn_unset VAR
+# ---------------
+# Portably unset VAR.
+as_fn_unset ()
+{
+ { eval $1=; unset $1;}
+}
+as_unset=as_fn_unset
+
+# as_fn_set_status STATUS
+# -----------------------
+# Set $? to STATUS, without forking.
+as_fn_set_status ()
+{
+ return $1
+} # as_fn_set_status
+
+# as_fn_exit STATUS
+# -----------------
+# Exit the shell with STATUS, even in a "trap 0" or "set -e" context.
+as_fn_exit ()
+{
+ set +e
+ as_fn_set_status $1
+ exit $1
+} # as_fn_exit
+
+# as_fn_mkdir_p
+# -------------
+# Create "$as_dir" as a directory, including parents if necessary.
+as_fn_mkdir_p ()
+{
+
+ case $as_dir in #(
+ -*) as_dir=./$as_dir;;
+ esac
+ test -d "$as_dir" || eval $as_mkdir_p || {
+ as_dirs=
+ while :; do
+ case $as_dir in #(
+ *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
+ *) as_qdir=$as_dir;;
+ esac
+ as_dirs="'$as_qdir' $as_dirs"
+ as_dir=`$as_dirname -- "$as_dir" ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+ X"$as_dir" : 'X\(//\)[^/]' \| \
+ X"$as_dir" : 'X\(//\)$' \| \
+ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$as_dir" |
+ sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)[^/].*/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+ test -d "$as_dir" && break
+ done
+ test -z "$as_dirs" || eval "mkdir $as_dirs"
+ } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir"
+
+
+} # as_fn_mkdir_p
+
+# as_fn_executable_p FILE
+# -----------------------
+# Test if FILE is an executable regular file.
+as_fn_executable_p ()
+{
+ test -f "$1" && test -x "$1"
+} # as_fn_executable_p
+# as_fn_append VAR VALUE
+# ----------------------
+# Append the text in VALUE to the end of the definition contained in VAR. Take
+# advantage of any shell optimizations that allow amortized linear growth over
+# repeated appends, instead of the typical quadratic growth present in naive
+# implementations.
+if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then :
+ eval 'as_fn_append ()
+ {
+ eval $1+=\$2
+ }'
+else
+ as_fn_append ()
+ {
+ eval $1=\$$1\$2
+ }
+fi # as_fn_append
+
+# as_fn_arith ARG...
+# ------------------
+# Perform arithmetic evaluation on the ARGs, and store the result in the
+# global $as_val. Take advantage of shells that can avoid forks. The arguments
+# must be portable across $(()) and expr.
+if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then :
+ eval 'as_fn_arith ()
+ {
+ as_val=$(( $* ))
+ }'
+else
+ as_fn_arith ()
+ {
+ as_val=`expr "$@" || test $? -eq 1`
+ }
+fi # as_fn_arith
+
+
+# as_fn_error STATUS ERROR [LINENO LOG_FD]
+# ----------------------------------------
+# Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are
+# provided, also output the error to LOG_FD, referencing LINENO. Then exit the
+# script with STATUS, using 1 if that was 0.
+as_fn_error ()
+{
+ as_status=$1; test $as_status -eq 0 && as_status=1
+ if test "$4"; then
+ as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
+ $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
+ fi
+ $as_echo "$as_me: error: $2" >&2
+ as_fn_exit $as_status
+} # as_fn_error
+
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+ test "X`expr 00001 : '.*\(...\)'`" = X001; then
+ as_expr=expr
+else
+ as_expr=false
+fi
+
+if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then
+ as_basename=basename
+else
+ as_basename=false
+fi
+
+if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then
+ as_dirname=dirname
+else
+ as_dirname=false
+fi
+
+as_me=`$as_basename -- "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+ X"$0" : 'X\(//\)$' \| \
+ X"$0" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X/"$0" |
+ sed '/^.*\/\([^/][^/]*\)\/*$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+
+ as_lineno_1=$LINENO as_lineno_1a=$LINENO
+ as_lineno_2=$LINENO as_lineno_2a=$LINENO
+ eval 'test "x$as_lineno_1'$as_run'" != "x$as_lineno_2'$as_run'" &&
+ test "x`expr $as_lineno_1'$as_run' + 1`" = "x$as_lineno_2'$as_run'"' || {
+ # Blame Lee E. McMahon (1931-1989) for sed's syntax. :-)
+ sed -n '
+ p
+ /[$]LINENO/=
+ ' <$as_myself |
+ sed '
+ s/[$]LINENO.*/&-/
+ t lineno
+ b
+ :lineno
+ N
+ :loop
+ s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/
+ t loop
+ s/-\n.*//
+ ' >$as_me.lineno &&
+ chmod +x "$as_me.lineno" ||
+ { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; }
+
+ # If we had to re-execute with $CONFIG_SHELL, we're ensured to have
+ # already done that, so ensure we don't try to do so again and fall
+ # in an infinite loop. This has already happened in practice.
+ _as_can_reexec=no; export _as_can_reexec
+ # Don't try to exec as it changes $[0], causing all sort of problems
+ # (the dirname of $[0] is not the place where we might find the
+ # original and so on. Autoconf is especially sensitive to this).
+ . "./$as_me.lineno"
+ # Exit status is that of the last command.
+ exit
+}
+
+ECHO_C= ECHO_N= ECHO_T=
+case `echo -n x` in #(((((
+-n*)
+ case `echo 'xy\c'` in
+ *c*) ECHO_T=' ';; # ECHO_T is single tab character.
+ xy) ECHO_C='\c';;
+ *) echo `echo ksh88 bug on AIX 6.1` > /dev/null
+ ECHO_T=' ';;
+ esac;;
+*)
+ ECHO_N='-n';;
+esac
+
+rm -f conf$$ conf$$.exe conf$$.file
+if test -d conf$$.dir; then
+ rm -f conf$$.dir/conf$$.file
+else
+ rm -f conf$$.dir
+ mkdir conf$$.dir 2>/dev/null
+fi
+if (echo >conf$$.file) 2>/dev/null; then
+ if ln -s conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s='ln -s'
+ # ... but there are two gotchas:
+ # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail.
+ # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable.
+ # In both cases, we have to default to `cp -pR'.
+ ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe ||
+ as_ln_s='cp -pR'
+ elif ln conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s=ln
+ else
+ as_ln_s='cp -pR'
+ fi
+else
+ as_ln_s='cp -pR'
+fi
+rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file
+rmdir conf$$.dir 2>/dev/null
+
+if mkdir -p . 2>/dev/null; then
+ as_mkdir_p='mkdir -p "$as_dir"'
+else
+ test -d ./-p && rmdir ./-p
+ as_mkdir_p=false
+fi
+
+as_test_x='test -x'
+as_executable_p=as_fn_executable_p
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+test -n "$DJDIR" || exec 7<&0 </dev/null
+exec 6>&1
+
+# Name of the host.
+# hostname on some systems (SVR3.2, old GNU/Linux) returns a bogus exit status,
+# so uname gets run too.
+ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q`
+
+#
+# Initializations.
+#
+ac_default_prefix=/usr/local
+ac_clean_files=
+ac_config_libobj_dir=.
+LIBOBJS=
+cross_compiling=no
+subdirs=
+MFLAGS=
+MAKEFLAGS=
+
+# Identity of this package.
+PACKAGE_NAME='norsp'
+PACKAGE_TARNAME='norsp'
+PACKAGE_VERSION='1.0.3'
+PACKAGE_STRING='norsp 1.0.3'
+PACKAGE_BUGREPORT='https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsp'
+PACKAGE_URL=''
+
+ac_unique_file="norsp"
+ac_subst_vars='LTLIBOBJS
+LIBOBJS
+am__untar
+am__tar
+AMTAR
+am__leading_dot
+SET_MAKE
+AWK
+mkdir_p
+MKDIR_P
+INSTALL_STRIP_PROGRAM
+STRIP
+install_sh
+MAKEINFO
+AUTOHEADER
+AUTOMAKE
+AUTOCONF
+ACLOCAL
+VERSION
+PACKAGE
+CYGPATH_W
+am__isrc
+INSTALL_DATA
+INSTALL_SCRIPT
+INSTALL_PROGRAM
+target_alias
+host_alias
+build_alias
+LIBS
+ECHO_T
+ECHO_N
+ECHO_C
+DEFS
+mandir
+localedir
+libdir
+psdir
+pdfdir
+dvidir
+htmldir
+infodir
+docdir
+oldincludedir
+includedir
+localstatedir
+sharedstatedir
+sysconfdir
+datadir
+datarootdir
+libexecdir
+sbindir
+bindir
+program_transform_name
+prefix
+exec_prefix
+PACKAGE_URL
+PACKAGE_BUGREPORT
+PACKAGE_STRING
+PACKAGE_VERSION
+PACKAGE_TARNAME
+PACKAGE_NAME
+PATH_SEPARATOR
+SHELL'
+ac_subst_files=''
+ac_user_opts='
+enable_option_checking
+'
+ ac_precious_vars='build_alias
+host_alias
+target_alias'
+
+
+# Initialize some variables set by options.
+ac_init_help=
+ac_init_version=false
+ac_unrecognized_opts=
+ac_unrecognized_sep=
+# The variables have the same names as the options, with
+# dashes changed to underlines.
+cache_file=/dev/null
+exec_prefix=NONE
+no_create=
+no_recursion=
+prefix=NONE
+program_prefix=NONE
+program_suffix=NONE
+program_transform_name=s,x,x,
+silent=
+site=
+srcdir=
+verbose=
+x_includes=NONE
+x_libraries=NONE
+
+# Installation directory options.
+# These are left unexpanded so users can "make install exec_prefix=/foo"
+# and all the variables that are supposed to be based on exec_prefix
+# by default will actually change.
+# Use braces instead of parens because sh, perl, etc. also accept them.
+# (The list follows the same order as the GNU Coding Standards.)
+bindir='${exec_prefix}/bin'
+sbindir='${exec_prefix}/sbin'
+libexecdir='${exec_prefix}/libexec'
+datarootdir='${prefix}/share'
+datadir='${datarootdir}'
+sysconfdir='${prefix}/etc'
+sharedstatedir='${prefix}/com'
+localstatedir='${prefix}/var'
+includedir='${prefix}/include'
+oldincludedir='/usr/include'
+docdir='${datarootdir}/doc/${PACKAGE_TARNAME}'
+infodir='${datarootdir}/info'
+htmldir='${docdir}'
+dvidir='${docdir}'
+pdfdir='${docdir}'
+psdir='${docdir}'
+libdir='${exec_prefix}/lib'
+localedir='${datarootdir}/locale'
+mandir='${datarootdir}/man'
+
+ac_prev=
+ac_dashdash=
+for ac_option
+do
+ # If the previous option needs an argument, assign it.
+ if test -n "$ac_prev"; then
+ eval $ac_prev=\$ac_option
+ ac_prev=
+ continue
+ fi
+
+ case $ac_option in
+ *=?*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;;
+ *=) ac_optarg= ;;
+ *) ac_optarg=yes ;;
+ esac
+
+ # Accept the important Cygnus configure options, so we can diagnose typos.
+
+ case $ac_dashdash$ac_option in
+ --)
+ ac_dashdash=yes ;;
+
+ -bindir | --bindir | --bindi | --bind | --bin | --bi)
+ ac_prev=bindir ;;
+ -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*)
+ bindir=$ac_optarg ;;
+
+ -build | --build | --buil | --bui | --bu)
+ ac_prev=build_alias ;;
+ -build=* | --build=* | --buil=* | --bui=* | --bu=*)
+ build_alias=$ac_optarg ;;
+
+ -cache-file | --cache-file | --cache-fil | --cache-fi \
+ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c)
+ ac_prev=cache_file ;;
+ -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \
+ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*)
+ cache_file=$ac_optarg ;;
+
+ --config-cache | -C)
+ cache_file=config.cache ;;
+
+ -datadir | --datadir | --datadi | --datad)
+ ac_prev=datadir ;;
+ -datadir=* | --datadir=* | --datadi=* | --datad=*)
+ datadir=$ac_optarg ;;
+
+ -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \
+ | --dataroo | --dataro | --datar)
+ ac_prev=datarootdir ;;
+ -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \
+ | --dataroot=* | --dataroo=* | --dataro=* | --datar=*)
+ datarootdir=$ac_optarg ;;
+
+ -disable-* | --disable-*)
+ ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+ as_fn_error $? "invalid feature name: $ac_useropt"
+ ac_useropt_orig=$ac_useropt
+ ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ case $ac_user_opts in
+ *"
+"enable_$ac_useropt"
+"*) ;;
+ *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--disable-$ac_useropt_orig"
+ ac_unrecognized_sep=', ';;
+ esac
+ eval enable_$ac_useropt=no ;;
+
+ -docdir | --docdir | --docdi | --doc | --do)
+ ac_prev=docdir ;;
+ -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*)
+ docdir=$ac_optarg ;;
+
+ -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv)
+ ac_prev=dvidir ;;
+ -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*)
+ dvidir=$ac_optarg ;;
+
+ -enable-* | --enable-*)
+ ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+ as_fn_error $? "invalid feature name: $ac_useropt"
+ ac_useropt_orig=$ac_useropt
+ ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ case $ac_user_opts in
+ *"
+"enable_$ac_useropt"
+"*) ;;
+ *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--enable-$ac_useropt_orig"
+ ac_unrecognized_sep=', ';;
+ esac
+ eval enable_$ac_useropt=\$ac_optarg ;;
+
+ -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \
+ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \
+ | --exec | --exe | --ex)
+ ac_prev=exec_prefix ;;
+ -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \
+ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \
+ | --exec=* | --exe=* | --ex=*)
+ exec_prefix=$ac_optarg ;;
+
+ -gas | --gas | --ga | --g)
+ # Obsolete; use --with-gas.
+ with_gas=yes ;;
+
+ -help | --help | --hel | --he | -h)
+ ac_init_help=long ;;
+ -help=r* | --help=r* | --hel=r* | --he=r* | -hr*)
+ ac_init_help=recursive ;;
+ -help=s* | --help=s* | --hel=s* | --he=s* | -hs*)
+ ac_init_help=short ;;
+
+ -host | --host | --hos | --ho)
+ ac_prev=host_alias ;;
+ -host=* | --host=* | --hos=* | --ho=*)
+ host_alias=$ac_optarg ;;
+
+ -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht)
+ ac_prev=htmldir ;;
+ -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \
+ | --ht=*)
+ htmldir=$ac_optarg ;;
+
+ -includedir | --includedir | --includedi | --included | --include \
+ | --includ | --inclu | --incl | --inc)
+ ac_prev=includedir ;;
+ -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \
+ | --includ=* | --inclu=* | --incl=* | --inc=*)
+ includedir=$ac_optarg ;;
+
+ -infodir | --infodir | --infodi | --infod | --info | --inf)
+ ac_prev=infodir ;;
+ -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*)
+ infodir=$ac_optarg ;;
+
+ -libdir | --libdir | --libdi | --libd)
+ ac_prev=libdir ;;
+ -libdir=* | --libdir=* | --libdi=* | --libd=*)
+ libdir=$ac_optarg ;;
+
+ -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \
+ | --libexe | --libex | --libe)
+ ac_prev=libexecdir ;;
+ -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \
+ | --libexe=* | --libex=* | --libe=*)
+ libexecdir=$ac_optarg ;;
+
+ -localedir | --localedir | --localedi | --localed | --locale)
+ ac_prev=localedir ;;
+ -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*)
+ localedir=$ac_optarg ;;
+
+ -localstatedir | --localstatedir | --localstatedi | --localstated \
+ | --localstate | --localstat | --localsta | --localst | --locals)
+ ac_prev=localstatedir ;;
+ -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \
+ | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*)
+ localstatedir=$ac_optarg ;;
+
+ -mandir | --mandir | --mandi | --mand | --man | --ma | --m)
+ ac_prev=mandir ;;
+ -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*)
+ mandir=$ac_optarg ;;
+
+ -nfp | --nfp | --nf)
+ # Obsolete; use --without-fp.
+ with_fp=no ;;
+
+ -no-create | --no-create | --no-creat | --no-crea | --no-cre \
+ | --no-cr | --no-c | -n)
+ no_create=yes ;;
+
+ -no-recursion | --no-recursion | --no-recursio | --no-recursi \
+ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r)
+ no_recursion=yes ;;
+
+ -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \
+ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \
+ | --oldin | --oldi | --old | --ol | --o)
+ ac_prev=oldincludedir ;;
+ -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \
+ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \
+ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*)
+ oldincludedir=$ac_optarg ;;
+
+ -prefix | --prefix | --prefi | --pref | --pre | --pr | --p)
+ ac_prev=prefix ;;
+ -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*)
+ prefix=$ac_optarg ;;
+
+ -program-prefix | --program-prefix | --program-prefi | --program-pref \
+ | --program-pre | --program-pr | --program-p)
+ ac_prev=program_prefix ;;
+ -program-prefix=* | --program-prefix=* | --program-prefi=* \
+ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*)
+ program_prefix=$ac_optarg ;;
+
+ -program-suffix | --program-suffix | --program-suffi | --program-suff \
+ | --program-suf | --program-su | --program-s)
+ ac_prev=program_suffix ;;
+ -program-suffix=* | --program-suffix=* | --program-suffi=* \
+ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*)
+ program_suffix=$ac_optarg ;;
+
+ -program-transform-name | --program-transform-name \
+ | --program-transform-nam | --program-transform-na \
+ | --program-transform-n | --program-transform- \
+ | --program-transform | --program-transfor \
+ | --program-transfo | --program-transf \
+ | --program-trans | --program-tran \
+ | --progr-tra | --program-tr | --program-t)
+ ac_prev=program_transform_name ;;
+ -program-transform-name=* | --program-transform-name=* \
+ | --program-transform-nam=* | --program-transform-na=* \
+ | --program-transform-n=* | --program-transform-=* \
+ | --program-transform=* | --program-transfor=* \
+ | --program-transfo=* | --program-transf=* \
+ | --program-trans=* | --program-tran=* \
+ | --progr-tra=* | --program-tr=* | --program-t=*)
+ program_transform_name=$ac_optarg ;;
+
+ -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd)
+ ac_prev=pdfdir ;;
+ -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*)
+ pdfdir=$ac_optarg ;;
+
+ -psdir | --psdir | --psdi | --psd | --ps)
+ ac_prev=psdir ;;
+ -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*)
+ psdir=$ac_optarg ;;
+
+ -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+ | -silent | --silent | --silen | --sile | --sil)
+ silent=yes ;;
+
+ -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb)
+ ac_prev=sbindir ;;
+ -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \
+ | --sbi=* | --sb=*)
+ sbindir=$ac_optarg ;;
+
+ -sharedstatedir | --sharedstatedir | --sharedstatedi \
+ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \
+ | --sharedst | --shareds | --shared | --share | --shar \
+ | --sha | --sh)
+ ac_prev=sharedstatedir ;;
+ -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \
+ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \
+ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \
+ | --sha=* | --sh=*)
+ sharedstatedir=$ac_optarg ;;
+
+ -site | --site | --sit)
+ ac_prev=site ;;
+ -site=* | --site=* | --sit=*)
+ site=$ac_optarg ;;
+
+ -srcdir | --srcdir | --srcdi | --srcd | --src | --sr)
+ ac_prev=srcdir ;;
+ -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*)
+ srcdir=$ac_optarg ;;
+
+ -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \
+ | --syscon | --sysco | --sysc | --sys | --sy)
+ ac_prev=sysconfdir ;;
+ -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \
+ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*)
+ sysconfdir=$ac_optarg ;;
+
+ -target | --target | --targe | --targ | --tar | --ta | --t)
+ ac_prev=target_alias ;;
+ -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*)
+ target_alias=$ac_optarg ;;
+
+ -v | -verbose | --verbose | --verbos | --verbo | --verb)
+ verbose=yes ;;
+
+ -version | --version | --versio | --versi | --vers | -V)
+ ac_init_version=: ;;
+
+ -with-* | --with-*)
+ ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+ as_fn_error $? "invalid package name: $ac_useropt"
+ ac_useropt_orig=$ac_useropt
+ ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ case $ac_user_opts in
+ *"
+"with_$ac_useropt"
+"*) ;;
+ *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--with-$ac_useropt_orig"
+ ac_unrecognized_sep=', ';;
+ esac
+ eval with_$ac_useropt=\$ac_optarg ;;
+
+ -without-* | --without-*)
+ ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
+ as_fn_error $? "invalid package name: $ac_useropt"
+ ac_useropt_orig=$ac_useropt
+ ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ case $ac_user_opts in
+ *"
+"with_$ac_useropt"
+"*) ;;
+ *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--without-$ac_useropt_orig"
+ ac_unrecognized_sep=', ';;
+ esac
+ eval with_$ac_useropt=no ;;
+
+ --x)
+ # Obsolete; use --with-x.
+ with_x=yes ;;
+
+ -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \
+ | --x-incl | --x-inc | --x-in | --x-i)
+ ac_prev=x_includes ;;
+ -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \
+ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*)
+ x_includes=$ac_optarg ;;
+
+ -x-libraries | --x-libraries | --x-librarie | --x-librari \
+ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l)
+ ac_prev=x_libraries ;;
+ -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \
+ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*)
+ x_libraries=$ac_optarg ;;
+
+ -*) as_fn_error $? "unrecognized option: \`$ac_option'
+Try \`$0 --help' for more information"
+ ;;
+
+ *=*)
+ ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='`
+ # Reject names that are not valid shell variable names.
+ case $ac_envvar in #(
+ '' | [0-9]* | *[!_$as_cr_alnum]* )
+ as_fn_error $? "invalid variable name: \`$ac_envvar'" ;;
+ esac
+ eval $ac_envvar=\$ac_optarg
+ export $ac_envvar ;;
+
+ *)
+ # FIXME: should be removed in autoconf 3.0.
+ $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2
+ expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+ $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2
+ : "${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}"
+ ;;
+
+ esac
+done
+
+if test -n "$ac_prev"; then
+ ac_option=--`echo $ac_prev | sed 's/_/-/g'`
+ as_fn_error $? "missing argument to $ac_option"
+fi
+
+if test -n "$ac_unrecognized_opts"; then
+ case $enable_option_checking in
+ no) ;;
+ fatal) as_fn_error $? "unrecognized options: $ac_unrecognized_opts" ;;
+ *) $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;;
+ esac
+fi
+
+# Check all directory arguments for consistency.
+for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \
+ datadir sysconfdir sharedstatedir localstatedir includedir \
+ oldincludedir docdir infodir htmldir dvidir pdfdir psdir \
+ libdir localedir mandir
+do
+ eval ac_val=\$$ac_var
+ # Remove trailing slashes.
+ case $ac_val in
+ */ )
+ ac_val=`expr "X$ac_val" : 'X\(.*[^/]\)' \| "X$ac_val" : 'X\(.*\)'`
+ eval $ac_var=\$ac_val;;
+ esac
+ # Be sure to have absolute directory names.
+ case $ac_val in
+ [\\/$]* | ?:[\\/]* ) continue;;
+ NONE | '' ) case $ac_var in *prefix ) continue;; esac;;
+ esac
+ as_fn_error $? "expected an absolute directory name for --$ac_var: $ac_val"
+done
+
+# There might be people who depend on the old broken behavior: `$host'
+# used to hold the argument of --host etc.
+# FIXME: To remove some day.
+build=$build_alias
+host=$host_alias
+target=$target_alias
+
+# FIXME: To remove some day.
+if test "x$host_alias" != x; then
+ if test "x$build_alias" = x; then
+ cross_compiling=maybe
+ elif test "x$build_alias" != "x$host_alias"; then
+ cross_compiling=yes
+ fi
+fi
+
+ac_tool_prefix=
+test -n "$host_alias" && ac_tool_prefix=$host_alias-
+
+test "$silent" = yes && exec 6>/dev/null
+
+
+ac_pwd=`pwd` && test -n "$ac_pwd" &&
+ac_ls_di=`ls -di .` &&
+ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` ||
+ as_fn_error $? "working directory cannot be determined"
+test "X$ac_ls_di" = "X$ac_pwd_ls_di" ||
+ as_fn_error $? "pwd does not report name of working directory"
+
+
+# Find the source files, if location was not specified.
+if test -z "$srcdir"; then
+ ac_srcdir_defaulted=yes
+ # Try the directory containing this script, then the parent directory.
+ ac_confdir=`$as_dirname -- "$as_myself" ||
+$as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+ X"$as_myself" : 'X\(//\)[^/]' \| \
+ X"$as_myself" : 'X\(//\)$' \| \
+ X"$as_myself" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$as_myself" |
+ sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)[^/].*/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+ srcdir=$ac_confdir
+ if test ! -r "$srcdir/$ac_unique_file"; then
+ srcdir=..
+ fi
+else
+ ac_srcdir_defaulted=no
+fi
+if test ! -r "$srcdir/$ac_unique_file"; then
+ test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .."
+ as_fn_error $? "cannot find sources ($ac_unique_file) in $srcdir"
+fi
+ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work"
+ac_abs_confdir=`(
+ cd "$srcdir" && test -r "./$ac_unique_file" || as_fn_error $? "$ac_msg"
+ pwd)`
+# When building in place, set srcdir=.
+if test "$ac_abs_confdir" = "$ac_pwd"; then
+ srcdir=.
+fi
+# Remove unnecessary trailing slashes from srcdir.
+# Double slashes in file names in object file debugging info
+# mess up M-x gdb in Emacs.
+case $srcdir in
+*/) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;;
+esac
+for ac_var in $ac_precious_vars; do
+ eval ac_env_${ac_var}_set=\${${ac_var}+set}
+ eval ac_env_${ac_var}_value=\$${ac_var}
+ eval ac_cv_env_${ac_var}_set=\${${ac_var}+set}
+ eval ac_cv_env_${ac_var}_value=\$${ac_var}
+done
+
+#
+# Report the --help message.
+#
+if test "$ac_init_help" = "long"; then
+ # Omit some internal or obsolete options to make the list less imposing.
+ # This message is too long to be a string in the A/UX 3.1 sh.
+ cat <<_ACEOF
+\`configure' configures norsp 1.0.3 to adapt to many kinds of systems.
+
+Usage: $0 [OPTION]... [VAR=VALUE]...
+
+To assign environment variables (e.g., CC, CFLAGS...), specify them as
+VAR=VALUE. See below for descriptions of some of the useful variables.
+
+Defaults for the options are specified in brackets.
+
+Configuration:
+ -h, --help display this help and exit
+ --help=short display options specific to this package
+ --help=recursive display the short help of all the included packages
+ -V, --version display version information and exit
+ -q, --quiet, --silent do not print \`checking ...' messages
+ --cache-file=FILE cache test results in FILE [disabled]
+ -C, --config-cache alias for \`--cache-file=config.cache'
+ -n, --no-create do not create output files
+ --srcdir=DIR find the sources in DIR [configure dir or \`..']
+
+Installation directories:
+ --prefix=PREFIX install architecture-independent files in PREFIX
+ [$ac_default_prefix]
+ --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX
+ [PREFIX]
+
+By default, \`make install' will install all the files in
+\`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify
+an installation prefix other than \`$ac_default_prefix' using \`--prefix',
+for instance \`--prefix=\$HOME'.
+
+For better control, use the options below.
+
+Fine tuning of the installation directories:
+ --bindir=DIR user executables [EPREFIX/bin]
+ --sbindir=DIR system admin executables [EPREFIX/sbin]
+ --libexecdir=DIR program executables [EPREFIX/libexec]
+ --sysconfdir=DIR read-only single-machine data [PREFIX/etc]
+ --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com]
+ --localstatedir=DIR modifiable single-machine data [PREFIX/var]
+ --libdir=DIR object code libraries [EPREFIX/lib]
+ --includedir=DIR C header files [PREFIX/include]
+ --oldincludedir=DIR C header files for non-gcc [/usr/include]
+ --datarootdir=DIR read-only arch.-independent data root [PREFIX/share]
+ --datadir=DIR read-only architecture-independent data [DATAROOTDIR]
+ --infodir=DIR info documentation [DATAROOTDIR/info]
+ --localedir=DIR locale-dependent data [DATAROOTDIR/locale]
+ --mandir=DIR man documentation [DATAROOTDIR/man]
+ --docdir=DIR documentation root [DATAROOTDIR/doc/norsp]
+ --htmldir=DIR html documentation [DOCDIR]
+ --dvidir=DIR dvi documentation [DOCDIR]
+ --pdfdir=DIR pdf documentation [DOCDIR]
+ --psdir=DIR ps documentation [DOCDIR]
+_ACEOF
+
+ cat <<\_ACEOF
+
+Program names:
+ --program-prefix=PREFIX prepend PREFIX to installed program names
+ --program-suffix=SUFFIX append SUFFIX to installed program names
+ --program-transform-name=PROGRAM run sed PROGRAM on installed program names
+_ACEOF
+fi
+
+if test -n "$ac_init_help"; then
+ case $ac_init_help in
+ short | recursive ) echo "Configuration of norsp 1.0.3:";;
+ esac
+ cat <<\_ACEOF
+
+Report bugs to <https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsp>.
+_ACEOF
+ac_status=$?
+fi
+
+if test "$ac_init_help" = "recursive"; then
+ # If there are subdirs, report their specific --help.
+ for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue
+ test -d "$ac_dir" ||
+ { cd "$srcdir" && ac_pwd=`pwd` && srcdir=. && test -d "$ac_dir"; } ||
+ continue
+ ac_builddir=.
+
+case "$ac_dir" in
+.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
+*)
+ ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'`
+ # A ".." for each directory in $ac_dir_suffix.
+ ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
+ case $ac_top_builddir_sub in
+ "") ac_top_builddir_sub=. ac_top_build_prefix= ;;
+ *) ac_top_build_prefix=$ac_top_builddir_sub/ ;;
+ esac ;;
+esac
+ac_abs_top_builddir=$ac_pwd
+ac_abs_builddir=$ac_pwd$ac_dir_suffix
+# for backward compatibility:
+ac_top_builddir=$ac_top_build_prefix
+
+case $srcdir in
+ .) # We are building in place.
+ ac_srcdir=.
+ ac_top_srcdir=$ac_top_builddir_sub
+ ac_abs_top_srcdir=$ac_pwd ;;
+ [\\/]* | ?:[\\/]* ) # Absolute name.
+ ac_srcdir=$srcdir$ac_dir_suffix;
+ ac_top_srcdir=$srcdir
+ ac_abs_top_srcdir=$srcdir ;;
+ *) # Relative name.
+ ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix
+ ac_top_srcdir=$ac_top_build_prefix$srcdir
+ ac_abs_top_srcdir=$ac_pwd/$srcdir ;;
+esac
+ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
+
+ cd "$ac_dir" || { ac_status=$?; continue; }
+ # Check for guested configure.
+ if test -f "$ac_srcdir/configure.gnu"; then
+ echo &&
+ $SHELL "$ac_srcdir/configure.gnu" --help=recursive
+ elif test -f "$ac_srcdir/configure"; then
+ echo &&
+ $SHELL "$ac_srcdir/configure" --help=recursive
+ else
+ $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2
+ fi || ac_status=$?
+ cd "$ac_pwd" || { ac_status=$?; break; }
+ done
+fi
+
+test -n "$ac_init_help" && exit $ac_status
+if $ac_init_version; then
+ cat <<\_ACEOF
+norsp configure 1.0.3
+generated by GNU Autoconf 2.69
+
+Copyright (C) 2012 Free Software Foundation, Inc.
+This configure script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it.
+_ACEOF
+ exit
+fi
+
+## ------------------------ ##
+## Autoconf initialization. ##
+## ------------------------ ##
+cat >config.log <<_ACEOF
+This file contains any messages produced by compilers while
+running configure, to aid debugging if configure makes a mistake.
+
+It was created by norsp $as_me 1.0.3, which was
+generated by GNU Autoconf 2.69. Invocation command line was
+
+ $ $0 $@
+
+_ACEOF
+exec 5>>config.log
+{
+cat <<_ASUNAME
+## --------- ##
+## Platform. ##
+## --------- ##
+
+hostname = `(hostname || uname -n) 2>/dev/null | sed 1q`
+uname -m = `(uname -m) 2>/dev/null || echo unknown`
+uname -r = `(uname -r) 2>/dev/null || echo unknown`
+uname -s = `(uname -s) 2>/dev/null || echo unknown`
+uname -v = `(uname -v) 2>/dev/null || echo unknown`
+
+/usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown`
+/bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown`
+
+/bin/arch = `(/bin/arch) 2>/dev/null || echo unknown`
+/usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown`
+/usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown`
+/usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown`
+/bin/machine = `(/bin/machine) 2>/dev/null || echo unknown`
+/usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown`
+/bin/universe = `(/bin/universe) 2>/dev/null || echo unknown`
+
+_ASUNAME
+
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ $as_echo "PATH: $as_dir"
+ done
+IFS=$as_save_IFS
+
+} >&5
+
+cat >&5 <<_ACEOF
+
+
+## ----------- ##
+## Core tests. ##
+## ----------- ##
+
+_ACEOF
+
+
+# Keep a trace of the command line.
+# Strip out --no-create and --no-recursion so they do not pile up.
+# Strip out --silent because we don't want to record it for future runs.
+# Also quote any args containing shell meta-characters.
+# Make two passes to allow for proper duplicate-argument suppression.
+ac_configure_args=
+ac_configure_args0=
+ac_configure_args1=
+ac_must_keep_next=false
+for ac_pass in 1 2
+do
+ for ac_arg
+ do
+ case $ac_arg in
+ -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;;
+ -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+ | -silent | --silent | --silen | --sile | --sil)
+ continue ;;
+ *\'*)
+ ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;;
+ esac
+ case $ac_pass in
+ 1) as_fn_append ac_configure_args0 " '$ac_arg'" ;;
+ 2)
+ as_fn_append ac_configure_args1 " '$ac_arg'"
+ if test $ac_must_keep_next = true; then
+ ac_must_keep_next=false # Got value, back to normal.
+ else
+ case $ac_arg in
+ *=* | --config-cache | -C | -disable-* | --disable-* \
+ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \
+ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \
+ | -with-* | --with-* | -without-* | --without-* | --x)
+ case "$ac_configure_args0 " in
+ "$ac_configure_args1"*" '$ac_arg' "* ) continue ;;
+ esac
+ ;;
+ -* ) ac_must_keep_next=true ;;
+ esac
+ fi
+ as_fn_append ac_configure_args " '$ac_arg'"
+ ;;
+ esac
+ done
+done
+{ ac_configure_args0=; unset ac_configure_args0;}
+{ ac_configure_args1=; unset ac_configure_args1;}
+
+# When interrupted or exit'd, cleanup temporary files, and complete
+# config.log. We remove comments because anyway the quotes in there
+# would cause problems or look ugly.
+# WARNING: Use '\'' to represent an apostrophe within the trap.
+# WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug.
+trap 'exit_status=$?
+ # Save into config.log some information that might help in debugging.
+ {
+ echo
+
+ $as_echo "## ---------------- ##
+## Cache variables. ##
+## ---------------- ##"
+ echo
+ # The following way of writing the cache mishandles newlines in values,
+(
+ for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do
+ eval ac_val=\$$ac_var
+ case $ac_val in #(
+ *${as_nl}*)
+ case $ac_var in #(
+ *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
+$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
+ esac
+ case $ac_var in #(
+ _ | IFS | as_nl) ;; #(
+ BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #(
+ *) { eval $ac_var=; unset $ac_var;} ;;
+ esac ;;
+ esac
+ done
+ (set) 2>&1 |
+ case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #(
+ *${as_nl}ac_space=\ *)
+ sed -n \
+ "s/'\''/'\''\\\\'\'''\''/g;
+ s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p"
+ ;; #(
+ *)
+ sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p"
+ ;;
+ esac |
+ sort
+)
+ echo
+
+ $as_echo "## ----------------- ##
+## Output variables. ##
+## ----------------- ##"
+ echo
+ for ac_var in $ac_subst_vars
+ do
+ eval ac_val=\$$ac_var
+ case $ac_val in
+ *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+ esac
+ $as_echo "$ac_var='\''$ac_val'\''"
+ done | sort
+ echo
+
+ if test -n "$ac_subst_files"; then
+ $as_echo "## ------------------- ##
+## File substitutions. ##
+## ------------------- ##"
+ echo
+ for ac_var in $ac_subst_files
+ do
+ eval ac_val=\$$ac_var
+ case $ac_val in
+ *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+ esac
+ $as_echo "$ac_var='\''$ac_val'\''"
+ done | sort
+ echo
+ fi
+
+ if test -s confdefs.h; then
+ $as_echo "## ----------- ##
+## confdefs.h. ##
+## ----------- ##"
+ echo
+ cat confdefs.h
+ echo
+ fi
+ test "$ac_signal" != 0 &&
+ $as_echo "$as_me: caught signal $ac_signal"
+ $as_echo "$as_me: exit $exit_status"
+ } >&5
+ rm -f core *.core core.conftest.* &&
+ rm -f -r conftest* confdefs* conf$$* $ac_clean_files &&
+ exit $exit_status
+' 0
+for ac_signal in 1 2 13 15; do
+ trap 'ac_signal='$ac_signal'; as_fn_exit 1' $ac_signal
+done
+ac_signal=0
+
+# confdefs.h avoids OS command line length limits that DEFS can exceed.
+rm -f -r conftest* confdefs.h
+
+$as_echo "/* confdefs.h */" > confdefs.h
+
+# Predefined preprocessor variables.
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_NAME "$PACKAGE_NAME"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_TARNAME "$PACKAGE_TARNAME"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_VERSION "$PACKAGE_VERSION"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_STRING "$PACKAGE_STRING"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT"
+_ACEOF
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_URL "$PACKAGE_URL"
+_ACEOF
+
+
+# Let the site file select an alternate cache file if it wants to.
+# Prefer an explicitly selected file to automatically selected ones.
+ac_site_file1=NONE
+ac_site_file2=NONE
+if test -n "$CONFIG_SITE"; then
+ # We do not want a PATH search for config.site.
+ case $CONFIG_SITE in #((
+ -*) ac_site_file1=./$CONFIG_SITE;;
+ */*) ac_site_file1=$CONFIG_SITE;;
+ *) ac_site_file1=./$CONFIG_SITE;;
+ esac
+elif test "x$prefix" != xNONE; then
+ ac_site_file1=$prefix/share/config.site
+ ac_site_file2=$prefix/etc/config.site
+else
+ ac_site_file1=$ac_default_prefix/share/config.site
+ ac_site_file2=$ac_default_prefix/etc/config.site
+fi
+for ac_site_file in "$ac_site_file1" "$ac_site_file2"
+do
+ test "x$ac_site_file" = xNONE && continue
+ if test /dev/null != "$ac_site_file" && test -r "$ac_site_file"; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5
+$as_echo "$as_me: loading site script $ac_site_file" >&6;}
+ sed 's/^/| /' "$ac_site_file" >&5
+ . "$ac_site_file" \
+ || { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+as_fn_error $? "failed to load site script $ac_site_file
+See \`config.log' for more details" "$LINENO" 5; }
+ fi
+done
+
+if test -r "$cache_file"; then
+ # Some versions of bash will fail to source /dev/null (special files
+ # actually), so we avoid doing that. DJGPP emulates it as a regular file.
+ if test /dev/null != "$cache_file" && test -f "$cache_file"; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5
+$as_echo "$as_me: loading cache $cache_file" >&6;}
+ case $cache_file in
+ [\\/]* | ?:[\\/]* ) . "$cache_file";;
+ *) . "./$cache_file";;
+ esac
+ fi
+else
+ { $as_echo "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5
+$as_echo "$as_me: creating cache $cache_file" >&6;}
+ >$cache_file
+fi
+
+# Check that the precious variables saved in the cache have kept the same
+# value.
+ac_cache_corrupted=false
+for ac_var in $ac_precious_vars; do
+ eval ac_old_set=\$ac_cv_env_${ac_var}_set
+ eval ac_new_set=\$ac_env_${ac_var}_set
+ eval ac_old_val=\$ac_cv_env_${ac_var}_value
+ eval ac_new_val=\$ac_env_${ac_var}_value
+ case $ac_old_set,$ac_new_set in
+ set,)
+ { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5
+$as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;}
+ ac_cache_corrupted=: ;;
+ ,set)
+ { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5
+$as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;}
+ ac_cache_corrupted=: ;;
+ ,);;
+ *)
+ if test "x$ac_old_val" != "x$ac_new_val"; then
+ # differences in whitespace do not lead to failure.
+ ac_old_val_w=`echo x $ac_old_val`
+ ac_new_val_w=`echo x $ac_new_val`
+ if test "$ac_old_val_w" != "$ac_new_val_w"; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5
+$as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;}
+ ac_cache_corrupted=:
+ else
+ { $as_echo "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5
+$as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;}
+ eval $ac_var=\$ac_old_val
+ fi
+ { $as_echo "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5
+$as_echo "$as_me: former value: \`$ac_old_val'" >&2;}
+ { $as_echo "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5
+$as_echo "$as_me: current value: \`$ac_new_val'" >&2;}
+ fi;;
+ esac
+ # Pass precious variables to config.status.
+ if test "$ac_new_set" = set; then
+ case $ac_new_val in
+ *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;;
+ *) ac_arg=$ac_var=$ac_new_val ;;
+ esac
+ case " $ac_configure_args " in
+ *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy.
+ *) as_fn_append ac_configure_args " '$ac_arg'" ;;
+ esac
+ fi
+done
+if $ac_cache_corrupted; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+ { $as_echo "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5
+$as_echo "$as_me: error: changes in the environment can compromise the build" >&2;}
+ as_fn_error $? "run \`make distclean' and/or \`rm $cache_file' and start over" "$LINENO" 5
+fi
+## -------------------- ##
+## Main body of script. ##
+## -------------------- ##
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+
+
+am__api_version='1.11'
+
+ac_aux_dir=
+for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do
+ if test -f "$ac_dir/install-sh"; then
+ ac_aux_dir=$ac_dir
+ ac_install_sh="$ac_aux_dir/install-sh -c"
+ break
+ elif test -f "$ac_dir/install.sh"; then
+ ac_aux_dir=$ac_dir
+ ac_install_sh="$ac_aux_dir/install.sh -c"
+ break
+ elif test -f "$ac_dir/shtool"; then
+ ac_aux_dir=$ac_dir
+ ac_install_sh="$ac_aux_dir/shtool install -c"
+ break
+ fi
+done
+if test -z "$ac_aux_dir"; then
+ as_fn_error $? "cannot find install-sh, install.sh, or shtool in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" "$LINENO" 5
+fi
+
+# These three variables are undocumented and unsupported,
+# and are intended to be withdrawn in a future Autoconf release.
+# They can cause serious problems if a builder's source tree is in a directory
+# whose full name contains unusual characters.
+ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var.
+ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var.
+ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var.
+
+
+# Find a good install program. We prefer a C program (faster),
+# so one script is as good as another. But avoid the broken or
+# incompatible versions:
+# SysV /etc/install, /usr/sbin/install
+# SunOS /usr/etc/install
+# IRIX /sbin/install
+# AIX /bin/install
+# AmigaOS /C/install, which installs bootblocks on floppy discs
+# AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag
+# AFS /usr/afsws/bin/install, which mishandles nonexistent args
+# SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff"
+# OS/2's system install, which has a completely different semantic
+# ./install, which can be erroneously created by make from ./install.sh.
+# Reject install programs that cannot install multiple files.
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5
+$as_echo_n "checking for a BSD-compatible install... " >&6; }
+if test -z "$INSTALL"; then
+if ${ac_cv_path_install+:} false; then :
+ $as_echo_n "(cached) " >&6
+else
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ # Account for people who put trailing slashes in PATH elements.
+case $as_dir/ in #((
+ ./ | .// | /[cC]/* | \
+ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \
+ ?:[\\/]os2[\\/]install[\\/]* | ?:[\\/]OS2[\\/]INSTALL[\\/]* | \
+ /usr/ucb/* ) ;;
+ *)
+ # OSF1 and SCO ODT 3.0 have their own names for install.
+ # Don't use installbsd from OSF since it installs stuff as root
+ # by default.
+ for ac_prog in ginstall scoinst install; do
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext"; then
+ if test $ac_prog = install &&
+ grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+ # AIX install. It has an incompatible calling convention.
+ :
+ elif test $ac_prog = install &&
+ grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+ # program-specific install script used by HP pwplus--don't use.
+ :
+ else
+ rm -rf conftest.one conftest.two conftest.dir
+ echo one > conftest.one
+ echo two > conftest.two
+ mkdir conftest.dir
+ if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" &&
+ test -s conftest.one && test -s conftest.two &&
+ test -s conftest.dir/conftest.one &&
+ test -s conftest.dir/conftest.two
+ then
+ ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c"
+ break 3
+ fi
+ fi
+ fi
+ done
+ done
+ ;;
+esac
+
+ done
+IFS=$as_save_IFS
+
+rm -rf conftest.one conftest.two conftest.dir
+
+fi
+ if test "${ac_cv_path_install+set}" = set; then
+ INSTALL=$ac_cv_path_install
+ else
+ # As a last resort, use the slow shell script. Don't cache a
+ # value for INSTALL within a source directory, because that will
+ # break other packages using the cache if that directory is
+ # removed, or if the value is a relative name.
+ INSTALL=$ac_install_sh
+ fi
+fi
+{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5
+$as_echo "$INSTALL" >&6; }
+
+# Use test -z because SunOS4 sh mishandles braces in ${var-val}.
+# It thinks the first close brace ends the variable substitution.
+test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}'
+
+test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}'
+
+test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644'
+
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether build environment is sane" >&5
+$as_echo_n "checking whether build environment is sane... " >&6; }
+# Just in case
+sleep 1
+echo timestamp > conftest.file
+# Reject unsafe characters in $srcdir or the absolute working directory
+# name. Accept space and tab only in the latter.
+am_lf='
+'
+case `pwd` in
+ *[\\\"\#\$\&\'\`$am_lf]*)
+ as_fn_error $? "unsafe absolute working directory name" "$LINENO" 5;;
+esac
+case $srcdir in
+ *[\\\"\#\$\&\'\`$am_lf\ \ ]*)
+ as_fn_error $? "unsafe srcdir value: \`$srcdir'" "$LINENO" 5;;
+esac
+
+# Do `set' in a subshell so we don't clobber the current shell's
+# arguments. Must try -L first in case configure is actually a
+# symlink; some systems play weird games with the mod time of symlinks
+# (eg FreeBSD returns the mod time of the symlink's containing
+# directory).
+if (
+ set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null`
+ if test "$*" = "X"; then
+ # -L didn't work.
+ set X `ls -t "$srcdir/configure" conftest.file`
+ fi
+ rm -f conftest.file
+ if test "$*" != "X $srcdir/configure conftest.file" \
+ && test "$*" != "X conftest.file $srcdir/configure"; then
+
+ # If neither matched, then we have a broken ls. This can happen
+ # if, for instance, CONFIG_SHELL is bash and it inherits a
+ # broken ls alias from the environment. This has actually
+ # happened. Such a system could not be considered "sane".
+ as_fn_error $? "ls -t appears to fail. Make sure there is not a broken
+alias in your environment" "$LINENO" 5
+ fi
+
+ test "$2" = conftest.file
+ )
+then
+ # Ok.
+ :
+else
+ as_fn_error $? "newly created file is older than distributed files!
+Check your system clock" "$LINENO" 5
+fi
+{ $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5
+$as_echo "yes" >&6; }
+test "$program_prefix" != NONE &&
+ program_transform_name="s&^&$program_prefix&;$program_transform_name"
+# Use a double $ so make ignores it.
+test "$program_suffix" != NONE &&
+ program_transform_name="s&\$&$program_suffix&;$program_transform_name"
+# Double any \ or $.
+# By default was `s,x,x', remove it if useless.
+ac_script='s/[\\$]/&&/g;s/;s,x,x,$//'
+program_transform_name=`$as_echo "$program_transform_name" | sed "$ac_script"`
+
+# expand $ac_aux_dir to an absolute path
+am_aux_dir=`cd $ac_aux_dir && pwd`
+
+if test x"${MISSING+set}" != xset; then
+ case $am_aux_dir in
+ *\ * | *\ *)
+ MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;;
+ *)
+ MISSING="\${SHELL} $am_aux_dir/missing" ;;
+ esac
+fi
+# Use eval to expand $SHELL
+if eval "$MISSING --run true"; then
+ am_missing_run="$MISSING --run "
+else
+ am_missing_run=
+ { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: \`missing' script is too old or missing" >&5
+$as_echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;}
+fi
+
+if test x"${install_sh}" != xset; then
+ case $am_aux_dir in
+ *\ * | *\ *)
+ install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;;
+ *)
+ install_sh="\${SHELL} $am_aux_dir/install-sh"
+ esac
+fi
+
+# Installed binaries are usually stripped using `strip' when the user
+# run `make install-strip'. However `strip' might not be the right
+# tool to use in cross-compilation environments, therefore Automake
+# will honor the `STRIP' environment variable to overrule this program.
+if test "$cross_compiling" != no; then
+ if test -n "$ac_tool_prefix"; then
+ # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args.
+set dummy ${ac_tool_prefix}strip; ac_word=$2
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+$as_echo_n "checking for $ac_word... " >&6; }
+if ${ac_cv_prog_STRIP+:} false; then :
+ $as_echo_n "(cached) " >&6
+else
+ if test -n "$STRIP"; then
+ ac_cv_prog_STRIP="$STRIP" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ ac_cv_prog_STRIP="${ac_tool_prefix}strip"
+ $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+ done
+IFS=$as_save_IFS
+
+fi
+fi
+STRIP=$ac_cv_prog_STRIP
+if test -n "$STRIP"; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: $STRIP" >&5
+$as_echo "$STRIP" >&6; }
+else
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+fi
+
+
+fi
+if test -z "$ac_cv_prog_STRIP"; then
+ ac_ct_STRIP=$STRIP
+ # Extract the first word of "strip", so it can be a program name with args.
+set dummy strip; ac_word=$2
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+$as_echo_n "checking for $ac_word... " >&6; }
+if ${ac_cv_prog_ac_ct_STRIP+:} false; then :
+ $as_echo_n "(cached) " >&6
+else
+ if test -n "$ac_ct_STRIP"; then
+ ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ ac_cv_prog_ac_ct_STRIP="strip"
+ $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+ done
+IFS=$as_save_IFS
+
+fi
+fi
+ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP
+if test -n "$ac_ct_STRIP"; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_STRIP" >&5
+$as_echo "$ac_ct_STRIP" >&6; }
+else
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+fi
+
+ if test "x$ac_ct_STRIP" = x; then
+ STRIP=":"
+ else
+ case $cross_compiling:$ac_tool_warned in
+yes:)
+{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
+$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
+ac_tool_warned=yes ;;
+esac
+ STRIP=$ac_ct_STRIP
+ fi
+else
+ STRIP="$ac_cv_prog_STRIP"
+fi
+
+fi
+INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s"
+
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for a thread-safe mkdir -p" >&5
+$as_echo_n "checking for a thread-safe mkdir -p... " >&6; }
+if test -z "$MKDIR_P"; then
+ if ${ac_cv_path_mkdir+:} false; then :
+ $as_echo_n "(cached) " >&6
+else
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH$PATH_SEPARATOR/opt/sfw/bin
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_prog in mkdir gmkdir; do
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext" || continue
+ case `"$as_dir/$ac_prog$ac_exec_ext" --version 2>&1` in #(
+ 'mkdir (GNU coreutils) '* | \
+ 'mkdir (coreutils) '* | \
+ 'mkdir (fileutils) '4.1*)
+ ac_cv_path_mkdir=$as_dir/$ac_prog$ac_exec_ext
+ break 3;;
+ esac
+ done
+ done
+ done
+IFS=$as_save_IFS
+
+fi
+
+ test -d ./--version && rmdir ./--version
+ if test "${ac_cv_path_mkdir+set}" = set; then
+ MKDIR_P="$ac_cv_path_mkdir -p"
+ else
+ # As a last resort, use the slow shell script. Don't cache a
+ # value for MKDIR_P within a source directory, because that will
+ # break other packages using the cache if that directory is
+ # removed, or if the value is a relative name.
+ MKDIR_P="$ac_install_sh -d"
+ fi
+fi
+{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $MKDIR_P" >&5
+$as_echo "$MKDIR_P" >&6; }
+
+mkdir_p="$MKDIR_P"
+case $mkdir_p in
+ [\\/$]* | ?:[\\/]*) ;;
+ */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;;
+esac
+
+for ac_prog in gawk mawk nawk awk
+do
+ # Extract the first word of "$ac_prog", so it can be a program name with args.
+set dummy $ac_prog; ac_word=$2
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+$as_echo_n "checking for $ac_word... " >&6; }
+if ${ac_cv_prog_AWK+:} false; then :
+ $as_echo_n "(cached) " >&6
+else
+ if test -n "$AWK"; then
+ ac_cv_prog_AWK="$AWK" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ ac_cv_prog_AWK="$ac_prog"
+ $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+ done
+IFS=$as_save_IFS
+
+fi
+fi
+AWK=$ac_cv_prog_AWK
+if test -n "$AWK"; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: $AWK" >&5
+$as_echo "$AWK" >&6; }
+else
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+fi
+
+
+ test -n "$AWK" && break
+done
+
+{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5
+$as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; }
+set x ${MAKE-make}
+ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'`
+if eval \${ac_cv_prog_make_${ac_make}_set+:} false; then :
+ $as_echo_n "(cached) " >&6
+else
+ cat >conftest.make <<\_ACEOF
+SHELL = /bin/sh
+all:
+ @echo '@@@%%%=$(MAKE)=@@@%%%'
+_ACEOF
+# GNU make sometimes prints "make[1]: Entering ...", which would confuse us.
+case `${MAKE-make} -f conftest.make 2>/dev/null` in
+ *@@@%%%=?*=@@@%%%*)
+ eval ac_cv_prog_make_${ac_make}_set=yes;;
+ *)
+ eval ac_cv_prog_make_${ac_make}_set=no;;
+esac
+rm -f conftest.make
+fi
+if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5
+$as_echo "yes" >&6; }
+ SET_MAKE=
+else
+ { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
+$as_echo "no" >&6; }
+ SET_MAKE="MAKE=${MAKE-make}"
+fi
+
+rm -rf .tst 2>/dev/null
+mkdir .tst 2>/dev/null
+if test -d .tst; then
+ am__leading_dot=.
+else
+ am__leading_dot=_
+fi
+rmdir .tst 2>/dev/null
+
+if test "`cd $srcdir && pwd`" != "`pwd`"; then
+ # Use -I$(srcdir) only when $(srcdir) != ., so that make's output
+ # is not polluted with repeated "-I."
+ am__isrc=' -I$(srcdir)'
+ # test to see if srcdir already configured
+ if test -f $srcdir/config.status; then
+ as_fn_error $? "source directory already configured; run \"make distclean\" there first" "$LINENO" 5
+ fi
+fi
+
+# test whether we have cygpath
+if test -z "$CYGPATH_W"; then
+ if (cygpath --version) >/dev/null 2>/dev/null; then
+ CYGPATH_W='cygpath -w'
+ else
+ CYGPATH_W=echo
+ fi
+fi
+
+
+# Define the identity of the package.
+ PACKAGE='norsp'
+ VERSION='1.0.3'
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE "$PACKAGE"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define VERSION "$VERSION"
+_ACEOF
+
+# Some tools Automake needs.
+
+ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"}
+
+
+AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"}
+
+
+AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"}
+
+
+AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"}
+
+
+MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"}
+
+# We need awk for the "check" target. The system "awk" is bad on
+# some platforms.
+# Always define AMTAR for backward compatibility. Yes, it's still used
+# in the wild :-( We should find a proper way to deprecate it ...
+AMTAR='$${TAR-tar}'
+
+am__tar='$${TAR-tar} chof - "$$tardir"' am__untar='$${TAR-tar} xf -'
+
+
+
+
+
+ac_config_files="$ac_config_files Makefile"
+
+
+cat >confcache <<\_ACEOF
+# This file is a shell script that caches the results of configure
+# tests run on this system so they can be shared between configure
+# scripts and configure runs, see configure's option --config-cache.
+# It is not useful on other systems. If it contains results you don't
+# want to keep, you may remove or edit it.
+#
+# config.status only pays attention to the cache file if you give it
+# the --recheck option to rerun configure.
+#
+# `ac_cv_env_foo' variables (set or unset) will be overridden when
+# loading this file, other *unset* `ac_cv_foo' will be assigned the
+# following values.
+
+_ACEOF
+
+# The following way of writing the cache mishandles newlines in values,
+# but we know of no workaround that is simple, portable, and efficient.
+# So, we kill variables containing newlines.
+# Ultrix sh set writes to stderr and can't be redirected directly,
+# and sets the high bit in the cache file unless we assign to the vars.
+(
+ for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do
+ eval ac_val=\$$ac_var
+ case $ac_val in #(
+ *${as_nl}*)
+ case $ac_var in #(
+ *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
+$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
+ esac
+ case $ac_var in #(
+ _ | IFS | as_nl) ;; #(
+ BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #(
+ *) { eval $ac_var=; unset $ac_var;} ;;
+ esac ;;
+ esac
+ done
+
+ (set) 2>&1 |
+ case $as_nl`(ac_space=' '; set) 2>&1` in #(
+ *${as_nl}ac_space=\ *)
+ # `set' does not quote correctly, so add quotes: double-quote
+ # substitution turns \\\\ into \\, and sed turns \\ into \.
+ sed -n \
+ "s/'/'\\\\''/g;
+ s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p"
+ ;; #(
+ *)
+ # `set' quotes correctly as required by POSIX, so do not add quotes.
+ sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p"
+ ;;
+ esac |
+ sort
+) |
+ sed '
+ /^ac_cv_env_/b end
+ t clear
+ :clear
+ s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/
+ t end
+ s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/
+ :end' >>confcache
+if diff "$cache_file" confcache >/dev/null 2>&1; then :; else
+ if test -w "$cache_file"; then
+ if test "x$cache_file" != "x/dev/null"; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5
+$as_echo "$as_me: updating cache $cache_file" >&6;}
+ if test ! -f "$cache_file" || test -h "$cache_file"; then
+ cat confcache >"$cache_file"
+ else
+ case $cache_file in #(
+ */* | ?:*)
+ mv -f confcache "$cache_file"$$ &&
+ mv -f "$cache_file"$$ "$cache_file" ;; #(
+ *)
+ mv -f confcache "$cache_file" ;;
+ esac
+ fi
+ fi
+ else
+ { $as_echo "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5
+$as_echo "$as_me: not updating unwritable cache $cache_file" >&6;}
+ fi
+fi
+rm -f confcache
+
+test "x$prefix" = xNONE && prefix=$ac_default_prefix
+# Let make expand exec_prefix.
+test "x$exec_prefix" = xNONE && exec_prefix='${prefix}'
+
+# Transform confdefs.h into DEFS.
+# Protect against shell expansion while executing Makefile rules.
+# Protect against Makefile macro expansion.
+#
+# If the first sed substitution is executed (which looks for macros that
+# take arguments), then branch to the quote section. Otherwise,
+# look for a macro that doesn't take arguments.
+ac_script='
+:mline
+/\\$/{
+ N
+ s,\\\n,,
+ b mline
+}
+t clear
+:clear
+s/^[ ]*#[ ]*define[ ][ ]*\([^ (][^ (]*([^)]*)\)[ ]*\(.*\)/-D\1=\2/g
+t quote
+s/^[ ]*#[ ]*define[ ][ ]*\([^ ][^ ]*\)[ ]*\(.*\)/-D\1=\2/g
+t quote
+b any
+:quote
+s/[ `~#$^&*(){}\\|;'\''"<>?]/\\&/g
+s/\[/\\&/g
+s/\]/\\&/g
+s/\$/$$/g
+H
+:any
+${
+ g
+ s/^\n//
+ s/\n/ /g
+ p
+}
+'
+DEFS=`sed -n "$ac_script" confdefs.h`
+
+
+ac_libobjs=
+ac_ltlibobjs=
+U=
+for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue
+ # 1. Remove the extension, and $U if already installed.
+ ac_script='s/\$U\././;s/\.o$//;s/\.obj$//'
+ ac_i=`$as_echo "$ac_i" | sed "$ac_script"`
+ # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR
+ # will be set to the directory where LIBOBJS objects are built.
+ as_fn_append ac_libobjs " \${LIBOBJDIR}$ac_i\$U.$ac_objext"
+ as_fn_append ac_ltlibobjs " \${LIBOBJDIR}$ac_i"'$U.lo'
+done
+LIBOBJS=$ac_libobjs
+
+LTLIBOBJS=$ac_ltlibobjs
+
+
+
+
+: "${CONFIG_STATUS=./config.status}"
+ac_write_fail=0
+ac_clean_files_save=$ac_clean_files
+ac_clean_files="$ac_clean_files $CONFIG_STATUS"
+{ $as_echo "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5
+$as_echo "$as_me: creating $CONFIG_STATUS" >&6;}
+as_write_fail=0
+cat >$CONFIG_STATUS <<_ASEOF || as_write_fail=1
+#! $SHELL
+# Generated by $as_me.
+# Run this file to recreate the current configuration.
+# Compiler output produced by configure, useful for debugging
+# configure, is in config.log if it exists.
+
+debug=false
+ac_cs_recheck=false
+ac_cs_silent=false
+
+SHELL=\${CONFIG_SHELL-$SHELL}
+export SHELL
+_ASEOF
+cat >>$CONFIG_STATUS <<\_ASEOF || as_write_fail=1
+## -------------------- ##
+## M4sh Initialization. ##
+## -------------------- ##
+
+# Be more Bourne compatible
+DUALCASE=1; export DUALCASE # for MKS sh
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then :
+ emulate sh
+ NULLCMD=:
+ # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which
+ # is contrary to our usage. Disable this feature.
+ alias -g '${1+"$@"}'='"$@"'
+ setopt NO_GLOB_SUBST
+else
+ case `(set -o) 2>/dev/null` in #(
+ *posix*) :
+ set -o posix ;; #(
+ *) :
+ ;;
+esac
+fi
+
+
+as_nl='
+'
+export as_nl
+# Printing a long string crashes Solaris 7 /usr/bin/printf.
+as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\'
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo
+as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo
+# Prefer a ksh shell builtin over an external printf program on Solaris,
+# but without wasting forks for bash or zsh.
+if test -z "$BASH_VERSION$ZSH_VERSION" \
+ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then
+ as_echo='print -r --'
+ as_echo_n='print -rn --'
+elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then
+ as_echo='printf %s\n'
+ as_echo_n='printf %s'
+else
+ if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then
+ as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"'
+ as_echo_n='/usr/ucb/echo -n'
+ else
+ as_echo_body='eval expr "X$1" : "X\\(.*\\)"'
+ as_echo_n_body='eval
+ arg=$1;
+ case $arg in #(
+ *"$as_nl"*)
+ expr "X$arg" : "X\\(.*\\)$as_nl";
+ arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;;
+ esac;
+ expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl"
+ '
+ export as_echo_n_body
+ as_echo_n='sh -c $as_echo_n_body as_echo'
+ fi
+ export as_echo_body
+ as_echo='sh -c $as_echo_body as_echo'
+fi
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+ PATH_SEPARATOR=:
+ (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && {
+ (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 ||
+ PATH_SEPARATOR=';'
+ }
+fi
+
+
+# IFS
+# We need space, tab and new line, in precisely that order. Quoting is
+# there to prevent editors from complaining about space-tab.
+# (If _AS_PATH_WALK were called with IFS unset, it would disable word
+# splitting by setting IFS to empty value.)
+IFS=" "" $as_nl"
+
+# Find who we are. Look in the path if we contain no directory separator.
+as_myself=
+case $0 in #((
+ *[\\/]* ) as_myself=$0 ;;
+ *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+ done
+IFS=$as_save_IFS
+
+ ;;
+esac
+# We did not find ourselves, most probably we were run as `sh COMMAND'
+# in which case we are not to be found in the path.
+if test "x$as_myself" = x; then
+ as_myself=$0
+fi
+if test ! -f "$as_myself"; then
+ $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+ exit 1
+fi
+
+# Unset variables that we do not need and which cause bugs (e.g. in
+# pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1"
+# suppresses any "Segmentation fault" message there. '((' could
+# trigger a bug in pdksh 5.2.14.
+for as_var in BASH_ENV ENV MAIL MAILPATH
+do eval test x\${$as_var+set} = xset \
+ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
+done
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+LC_ALL=C
+export LC_ALL
+LANGUAGE=C
+export LANGUAGE
+
+# CDPATH.
+(unset CDPATH) >/dev/null 2>&1 && unset CDPATH
+
+
+# as_fn_error STATUS ERROR [LINENO LOG_FD]
+# ----------------------------------------
+# Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are
+# provided, also output the error to LOG_FD, referencing LINENO. Then exit the
+# script with STATUS, using 1 if that was 0.
+as_fn_error ()
+{
+ as_status=$1; test $as_status -eq 0 && as_status=1
+ if test "$4"; then
+ as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
+ $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
+ fi
+ $as_echo "$as_me: error: $2" >&2
+ as_fn_exit $as_status
+} # as_fn_error
+
+
+# as_fn_set_status STATUS
+# -----------------------
+# Set $? to STATUS, without forking.
+as_fn_set_status ()
+{
+ return $1
+} # as_fn_set_status
+
+# as_fn_exit STATUS
+# -----------------
+# Exit the shell with STATUS, even in a "trap 0" or "set -e" context.
+as_fn_exit ()
+{
+ set +e
+ as_fn_set_status $1
+ exit $1
+} # as_fn_exit
+
+# as_fn_unset VAR
+# ---------------
+# Portably unset VAR.
+as_fn_unset ()
+{
+ { eval $1=; unset $1;}
+}
+as_unset=as_fn_unset
+# as_fn_append VAR VALUE
+# ----------------------
+# Append the text in VALUE to the end of the definition contained in VAR. Take
+# advantage of any shell optimizations that allow amortized linear growth over
+# repeated appends, instead of the typical quadratic growth present in naive
+# implementations.
+if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then :
+ eval 'as_fn_append ()
+ {
+ eval $1+=\$2
+ }'
+else
+ as_fn_append ()
+ {
+ eval $1=\$$1\$2
+ }
+fi # as_fn_append
+
+# as_fn_arith ARG...
+# ------------------
+# Perform arithmetic evaluation on the ARGs, and store the result in the
+# global $as_val. Take advantage of shells that can avoid forks. The arguments
+# must be portable across $(()) and expr.
+if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then :
+ eval 'as_fn_arith ()
+ {
+ as_val=$(( $* ))
+ }'
+else
+ as_fn_arith ()
+ {
+ as_val=`expr "$@" || test $? -eq 1`
+ }
+fi # as_fn_arith
+
+
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+ test "X`expr 00001 : '.*\(...\)'`" = X001; then
+ as_expr=expr
+else
+ as_expr=false
+fi
+
+if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then
+ as_basename=basename
+else
+ as_basename=false
+fi
+
+if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then
+ as_dirname=dirname
+else
+ as_dirname=false
+fi
+
+as_me=`$as_basename -- "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+ X"$0" : 'X\(//\)$' \| \
+ X"$0" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X/"$0" |
+ sed '/^.*\/\([^/][^/]*\)\/*$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+ECHO_C= ECHO_N= ECHO_T=
+case `echo -n x` in #(((((
+-n*)
+ case `echo 'xy\c'` in
+ *c*) ECHO_T=' ';; # ECHO_T is single tab character.
+ xy) ECHO_C='\c';;
+ *) echo `echo ksh88 bug on AIX 6.1` > /dev/null
+ ECHO_T=' ';;
+ esac;;
+*)
+ ECHO_N='-n';;
+esac
+
+rm -f conf$$ conf$$.exe conf$$.file
+if test -d conf$$.dir; then
+ rm -f conf$$.dir/conf$$.file
+else
+ rm -f conf$$.dir
+ mkdir conf$$.dir 2>/dev/null
+fi
+if (echo >conf$$.file) 2>/dev/null; then
+ if ln -s conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s='ln -s'
+ # ... but there are two gotchas:
+ # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail.
+ # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable.
+ # In both cases, we have to default to `cp -pR'.
+ ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe ||
+ as_ln_s='cp -pR'
+ elif ln conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s=ln
+ else
+ as_ln_s='cp -pR'
+ fi
+else
+ as_ln_s='cp -pR'
+fi
+rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file
+rmdir conf$$.dir 2>/dev/null
+
+
+# as_fn_mkdir_p
+# -------------
+# Create "$as_dir" as a directory, including parents if necessary.
+as_fn_mkdir_p ()
+{
+
+ case $as_dir in #(
+ -*) as_dir=./$as_dir;;
+ esac
+ test -d "$as_dir" || eval $as_mkdir_p || {
+ as_dirs=
+ while :; do
+ case $as_dir in #(
+ *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
+ *) as_qdir=$as_dir;;
+ esac
+ as_dirs="'$as_qdir' $as_dirs"
+ as_dir=`$as_dirname -- "$as_dir" ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+ X"$as_dir" : 'X\(//\)[^/]' \| \
+ X"$as_dir" : 'X\(//\)$' \| \
+ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$as_dir" |
+ sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)[^/].*/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+ test -d "$as_dir" && break
+ done
+ test -z "$as_dirs" || eval "mkdir $as_dirs"
+ } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir"
+
+
+} # as_fn_mkdir_p
+if mkdir -p . 2>/dev/null; then
+ as_mkdir_p='mkdir -p "$as_dir"'
+else
+ test -d ./-p && rmdir ./-p
+ as_mkdir_p=false
+fi
+
+
+# as_fn_executable_p FILE
+# -----------------------
+# Test if FILE is an executable regular file.
+as_fn_executable_p ()
+{
+ test -f "$1" && test -x "$1"
+} # as_fn_executable_p
+as_test_x='test -x'
+as_executable_p=as_fn_executable_p
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+exec 6>&1
+## ----------------------------------- ##
+## Main body of $CONFIG_STATUS script. ##
+## ----------------------------------- ##
+_ASEOF
+test $as_write_fail = 0 && chmod +x $CONFIG_STATUS || ac_write_fail=1
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+# Save the log message, to keep $0 and so on meaningful, and to
+# report actual input values of CONFIG_FILES etc. instead of their
+# values after options handling.
+ac_log="
+This file was extended by norsp $as_me 1.0.3, which was
+generated by GNU Autoconf 2.69. Invocation command line was
+
+ CONFIG_FILES = $CONFIG_FILES
+ CONFIG_HEADERS = $CONFIG_HEADERS
+ CONFIG_LINKS = $CONFIG_LINKS
+ CONFIG_COMMANDS = $CONFIG_COMMANDS
+ $ $0 $@
+
+on `(hostname || uname -n) 2>/dev/null | sed 1q`
+"
+
+_ACEOF
+
+case $ac_config_files in *"
+"*) set x $ac_config_files; shift; ac_config_files=$*;;
+esac
+
+
+
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+# Files that config.status was made for.
+config_files="$ac_config_files"
+
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+ac_cs_usage="\
+\`$as_me' instantiates files and other configuration actions
+from templates according to the current configuration. Unless the files
+and actions are specified as TAGs, all are instantiated by default.
+
+Usage: $0 [OPTION]... [TAG]...
+
+ -h, --help print this help, then exit
+ -V, --version print version number and configuration settings, then exit
+ --config print configuration, then exit
+ -q, --quiet, --silent
+ do not print progress messages
+ -d, --debug don't remove temporary files
+ --recheck update $as_me by reconfiguring in the same conditions
+ --file=FILE[:TEMPLATE]
+ instantiate the configuration file FILE
+
+Configuration files:
+$config_files
+
+Report bugs to <https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsp>."
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`"
+ac_cs_version="\\
+norsp config.status 1.0.3
+configured by $0, generated by GNU Autoconf 2.69,
+ with options \\"\$ac_cs_config\\"
+
+Copyright (C) 2012 Free Software Foundation, Inc.
+This config.status script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it."
+
+ac_pwd='$ac_pwd'
+srcdir='$srcdir'
+INSTALL='$INSTALL'
+MKDIR_P='$MKDIR_P'
+AWK='$AWK'
+test -n "\$AWK" || AWK=awk
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+# The default lists apply if the user does not specify any file.
+ac_need_defaults=:
+while test $# != 0
+do
+ case $1 in
+ --*=?*)
+ ac_option=`expr "X$1" : 'X\([^=]*\)='`
+ ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'`
+ ac_shift=:
+ ;;
+ --*=)
+ ac_option=`expr "X$1" : 'X\([^=]*\)='`
+ ac_optarg=
+ ac_shift=:
+ ;;
+ *)
+ ac_option=$1
+ ac_optarg=$2
+ ac_shift=shift
+ ;;
+ esac
+
+ case $ac_option in
+ # Handling of the options.
+ -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r)
+ ac_cs_recheck=: ;;
+ --version | --versio | --versi | --vers | --ver | --ve | --v | -V )
+ $as_echo "$ac_cs_version"; exit ;;
+ --config | --confi | --conf | --con | --co | --c )
+ $as_echo "$ac_cs_config"; exit ;;
+ --debug | --debu | --deb | --de | --d | -d )
+ debug=: ;;
+ --file | --fil | --fi | --f )
+ $ac_shift
+ case $ac_optarg in
+ *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;;
+ '') as_fn_error $? "missing file argument" ;;
+ esac
+ as_fn_append CONFIG_FILES " '$ac_optarg'"
+ ac_need_defaults=false;;
+ --he | --h | --help | --hel | -h )
+ $as_echo "$ac_cs_usage"; exit ;;
+ -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+ | -silent | --silent | --silen | --sile | --sil | --si | --s)
+ ac_cs_silent=: ;;
+
+ # This is an error.
+ -*) as_fn_error $? "unrecognized option: \`$1'
+Try \`$0 --help' for more information." ;;
+
+ *) as_fn_append ac_config_targets " $1"
+ ac_need_defaults=false ;;
+
+ esac
+ shift
+done
+
+ac_configure_extra_args=
+
+if $ac_cs_silent; then
+ exec 6>/dev/null
+ ac_configure_extra_args="$ac_configure_extra_args --silent"
+fi
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+if \$ac_cs_recheck; then
+ set X $SHELL '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion
+ shift
+ \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6
+ CONFIG_SHELL='$SHELL'
+ export CONFIG_SHELL
+ exec "\$@"
+fi
+
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+exec 5>>config.log
+{
+ echo
+ sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX
+## Running $as_me. ##
+_ASBOX
+ $as_echo "$ac_log"
+} >&5
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+
+# Handling of arguments.
+for ac_config_target in $ac_config_targets
+do
+ case $ac_config_target in
+ "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;;
+
+ *) as_fn_error $? "invalid argument: \`$ac_config_target'" "$LINENO" 5;;
+ esac
+done
+
+
+# If the user did not use the arguments to specify the items to instantiate,
+# then the envvar interface is used. Set only those that are not.
+# We use the long form for the default assignment because of an extremely
+# bizarre bug on SunOS 4.1.3.
+if $ac_need_defaults; then
+ test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files
+fi
+
+# Have a temporary directory for convenience. Make it in the build tree
+# simply because there is no reason against having it here, and in addition,
+# creating and moving files from /tmp can sometimes cause problems.
+# Hook for its removal unless debugging.
+# Note that there is a small window in which the directory will not be cleaned:
+# after its creation but before its name has been assigned to `$tmp'.
+$debug ||
+{
+ tmp= ac_tmp=
+ trap 'exit_status=$?
+ : "${ac_tmp:=$tmp}"
+ { test ! -d "$ac_tmp" || rm -fr "$ac_tmp"; } && exit $exit_status
+' 0
+ trap 'as_fn_exit 1' 1 2 13 15
+}
+# Create a (secure) tmp directory for tmp files.
+
+{
+ tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` &&
+ test -d "$tmp"
+} ||
+{
+ tmp=./conf$$-$RANDOM
+ (umask 077 && mkdir "$tmp")
+} || as_fn_error $? "cannot create a temporary directory in ." "$LINENO" 5
+ac_tmp=$tmp
+
+# Set up the scripts for CONFIG_FILES section.
+# No need to generate them if there are no CONFIG_FILES.
+# This happens for instance with `./config.status config.h'.
+if test -n "$CONFIG_FILES"; then
+
+
+ac_cr=`echo X | tr X '\015'`
+# On cygwin, bash can eat \r inside `` if the user requested igncr.
+# But we know of no other shell where ac_cr would be empty at this
+# point, so we can use a bashism as a fallback.
+if test "x$ac_cr" = x; then
+ eval ac_cr=\$\'\\r\'
+fi
+ac_cs_awk_cr=`$AWK 'BEGIN { print "a\rb" }' </dev/null 2>/dev/null`
+if test "$ac_cs_awk_cr" = "a${ac_cr}b"; then
+ ac_cs_awk_cr='\\r'
+else
+ ac_cs_awk_cr=$ac_cr
+fi
+
+echo 'BEGIN {' >"$ac_tmp/subs1.awk" &&
+_ACEOF
+
+
+{
+ echo "cat >conf$$subs.awk <<_ACEOF" &&
+ echo "$ac_subst_vars" | sed 's/.*/&!$&$ac_delim/' &&
+ echo "_ACEOF"
+} >conf$$subs.sh ||
+ as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5
+ac_delim_num=`echo "$ac_subst_vars" | grep -c '^'`
+ac_delim='%!_!# '
+for ac_last_try in false false false false false :; do
+ . ./conf$$subs.sh ||
+ as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5
+
+ ac_delim_n=`sed -n "s/.*$ac_delim\$/X/p" conf$$subs.awk | grep -c X`
+ if test $ac_delim_n = $ac_delim_num; then
+ break
+ elif $ac_last_try; then
+ as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5
+ else
+ ac_delim="$ac_delim!$ac_delim _$ac_delim!! "
+ fi
+done
+rm -f conf$$subs.sh
+
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+cat >>"\$ac_tmp/subs1.awk" <<\\_ACAWK &&
+_ACEOF
+sed -n '
+h
+s/^/S["/; s/!.*/"]=/
+p
+g
+s/^[^!]*!//
+:repl
+t repl
+s/'"$ac_delim"'$//
+t delim
+:nl
+h
+s/\(.\{148\}\)..*/\1/
+t more1
+s/["\\]/\\&/g; s/^/"/; s/$/\\n"\\/
+p
+n
+b repl
+:more1
+s/["\\]/\\&/g; s/^/"/; s/$/"\\/
+p
+g
+s/.\{148\}//
+t nl
+:delim
+h
+s/\(.\{148\}\)..*/\1/
+t more2
+s/["\\]/\\&/g; s/^/"/; s/$/"/
+p
+b
+:more2
+s/["\\]/\\&/g; s/^/"/; s/$/"\\/
+p
+g
+s/.\{148\}//
+t delim
+' <conf$$subs.awk | sed '
+/^[^""]/{
+ N
+ s/\n//
+}
+' >>$CONFIG_STATUS || ac_write_fail=1
+rm -f conf$$subs.awk
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+_ACAWK
+cat >>"\$ac_tmp/subs1.awk" <<_ACAWK &&
+ for (key in S) S_is_set[key] = 1
+ FS = ""
+
+}
+{
+ line = $ 0
+ nfields = split(line, field, "@")
+ substed = 0
+ len = length(field[1])
+ for (i = 2; i < nfields; i++) {
+ key = field[i]
+ keylen = length(key)
+ if (S_is_set[key]) {
+ value = S[key]
+ line = substr(line, 1, len) "" value "" substr(line, len + keylen + 3)
+ len += length(value) + length(field[++i])
+ substed = 1
+ } else
+ len += 1 + keylen
+ }
+
+ print line
+}
+
+_ACAWK
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+if sed "s/$ac_cr//" < /dev/null > /dev/null 2>&1; then
+ sed "s/$ac_cr\$//; s/$ac_cr/$ac_cs_awk_cr/g"
+else
+ cat
+fi < "$ac_tmp/subs1.awk" > "$ac_tmp/subs.awk" \
+ || as_fn_error $? "could not setup config files machinery" "$LINENO" 5
+_ACEOF
+
+# VPATH may cause trouble with some makes, so we remove sole $(srcdir),
+# ${srcdir} and @srcdir@ entries from VPATH if srcdir is ".", strip leading and
+# trailing colons and then remove the whole line if VPATH becomes empty
+# (actually we leave an empty line to preserve line numbers).
+if test "x$srcdir" = x.; then
+ ac_vpsub='/^[ ]*VPATH[ ]*=[ ]*/{
+h
+s///
+s/^/:/
+s/[ ]*$/:/
+s/:\$(srcdir):/:/g
+s/:\${srcdir}:/:/g
+s/:@srcdir@:/:/g
+s/^:*//
+s/:*$//
+x
+s/\(=[ ]*\).*/\1/
+G
+s/\n//
+s/^[^=]*=[ ]*$//
+}'
+fi
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+fi # test -n "$CONFIG_FILES"
+
+
+eval set X " :F $CONFIG_FILES "
+shift
+for ac_tag
+do
+ case $ac_tag in
+ :[FHLC]) ac_mode=$ac_tag; continue;;
+ esac
+ case $ac_mode$ac_tag in
+ :[FHL]*:*);;
+ :L* | :C*:*) as_fn_error $? "invalid tag \`$ac_tag'" "$LINENO" 5;;
+ :[FH]-) ac_tag=-:-;;
+ :[FH]*) ac_tag=$ac_tag:$ac_tag.in;;
+ esac
+ ac_save_IFS=$IFS
+ IFS=:
+ set x $ac_tag
+ IFS=$ac_save_IFS
+ shift
+ ac_file=$1
+ shift
+
+ case $ac_mode in
+ :L) ac_source=$1;;
+ :[FH])
+ ac_file_inputs=
+ for ac_f
+ do
+ case $ac_f in
+ -) ac_f="$ac_tmp/stdin";;
+ *) # Look for the file first in the build tree, then in the source tree
+ # (if the path is not absolute). The absolute path cannot be DOS-style,
+ # because $ac_f cannot contain `:'.
+ test -f "$ac_f" ||
+ case $ac_f in
+ [\\/$]*) false;;
+ *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";;
+ esac ||
+ as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5;;
+ esac
+ case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac
+ as_fn_append ac_file_inputs " '$ac_f'"
+ done
+
+ # Let's still pretend it is `configure' which instantiates (i.e., don't
+ # use $as_me), people would be surprised to read:
+ # /* config.h. Generated by config.status. */
+ configure_input='Generated from '`
+ $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g'
+ `' by configure.'
+ if test x"$ac_file" != x-; then
+ configure_input="$ac_file. $configure_input"
+ { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5
+$as_echo "$as_me: creating $ac_file" >&6;}
+ fi
+ # Neutralize special characters interpreted by sed in replacement strings.
+ case $configure_input in #(
+ *\&* | *\|* | *\\* )
+ ac_sed_conf_input=`$as_echo "$configure_input" |
+ sed 's/[\\\\&|]/\\\\&/g'`;; #(
+ *) ac_sed_conf_input=$configure_input;;
+ esac
+
+ case $ac_tag in
+ *:-:* | *:-) cat >"$ac_tmp/stdin" \
+ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;;
+ esac
+ ;;
+ esac
+
+ ac_dir=`$as_dirname -- "$ac_file" ||
+$as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+ X"$ac_file" : 'X\(//\)[^/]' \| \
+ X"$ac_file" : 'X\(//\)$' \| \
+ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null ||
+$as_echo X"$ac_file" |
+ sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)[^/].*/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+ as_dir="$ac_dir"; as_fn_mkdir_p
+ ac_builddir=.
+
+case "$ac_dir" in
+.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
+*)
+ ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'`
+ # A ".." for each directory in $ac_dir_suffix.
+ ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
+ case $ac_top_builddir_sub in
+ "") ac_top_builddir_sub=. ac_top_build_prefix= ;;
+ *) ac_top_build_prefix=$ac_top_builddir_sub/ ;;
+ esac ;;
+esac
+ac_abs_top_builddir=$ac_pwd
+ac_abs_builddir=$ac_pwd$ac_dir_suffix
+# for backward compatibility:
+ac_top_builddir=$ac_top_build_prefix
+
+case $srcdir in
+ .) # We are building in place.
+ ac_srcdir=.
+ ac_top_srcdir=$ac_top_builddir_sub
+ ac_abs_top_srcdir=$ac_pwd ;;
+ [\\/]* | ?:[\\/]* ) # Absolute name.
+ ac_srcdir=$srcdir$ac_dir_suffix;
+ ac_top_srcdir=$srcdir
+ ac_abs_top_srcdir=$srcdir ;;
+ *) # Relative name.
+ ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix
+ ac_top_srcdir=$ac_top_build_prefix$srcdir
+ ac_abs_top_srcdir=$ac_pwd/$srcdir ;;
+esac
+ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
+
+
+ case $ac_mode in
+ :F)
+ #
+ # CONFIG_FILE
+ #
+
+ case $INSTALL in
+ [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;;
+ *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;;
+ esac
+ ac_MKDIR_P=$MKDIR_P
+ case $MKDIR_P in
+ [\\/$]* | ?:[\\/]* ) ;;
+ */*) ac_MKDIR_P=$ac_top_build_prefix$MKDIR_P ;;
+ esac
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+# If the template does not know about datarootdir, expand it.
+# FIXME: This hack should be removed a few years after 2.60.
+ac_datarootdir_hack=; ac_datarootdir_seen=
+ac_sed_dataroot='
+/datarootdir/ {
+ p
+ q
+}
+/@datadir@/p
+/@docdir@/p
+/@infodir@/p
+/@localedir@/p
+/@mandir@/p'
+case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in
+*datarootdir*) ac_datarootdir_seen=yes;;
+*@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*)
+ { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5
+$as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;}
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+ ac_datarootdir_hack='
+ s&@datadir@&$datadir&g
+ s&@docdir@&$docdir&g
+ s&@infodir@&$infodir&g
+ s&@localedir@&$localedir&g
+ s&@mandir@&$mandir&g
+ s&\\\${datarootdir}&$datarootdir&g' ;;
+esac
+_ACEOF
+
+# Neutralize VPATH when `$srcdir' = `.'.
+# Shell code in configure.ac might set extrasub.
+# FIXME: do we really want to maintain this feature?
+cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
+ac_sed_extra="$ac_vpsub
+$extrasub
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
+:t
+/@[a-zA-Z_][a-zA-Z_0-9]*@/!b
+s|@configure_input@|$ac_sed_conf_input|;t t
+s&@top_builddir@&$ac_top_builddir_sub&;t t
+s&@top_build_prefix@&$ac_top_build_prefix&;t t
+s&@srcdir@&$ac_srcdir&;t t
+s&@abs_srcdir@&$ac_abs_srcdir&;t t
+s&@top_srcdir@&$ac_top_srcdir&;t t
+s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t
+s&@builddir@&$ac_builddir&;t t
+s&@abs_builddir@&$ac_abs_builddir&;t t
+s&@abs_top_builddir@&$ac_abs_top_builddir&;t t
+s&@INSTALL@&$ac_INSTALL&;t t
+s&@MKDIR_P@&$ac_MKDIR_P&;t t
+$ac_datarootdir_hack
+"
+eval sed \"\$ac_sed_extra\" "$ac_file_inputs" | $AWK -f "$ac_tmp/subs.awk" \
+ >$ac_tmp/out || as_fn_error $? "could not create $ac_file" "$LINENO" 5
+
+test -z "$ac_datarootdir_hack$ac_datarootdir_seen" &&
+ { ac_out=`sed -n '/\${datarootdir}/p' "$ac_tmp/out"`; test -n "$ac_out"; } &&
+ { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' \
+ "$ac_tmp/out"`; test -z "$ac_out"; } &&
+ { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+which seems to be undefined. Please make sure it is defined" >&5
+$as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+which seems to be undefined. Please make sure it is defined" >&2;}
+
+ rm -f "$ac_tmp/stdin"
+ case $ac_file in
+ -) cat "$ac_tmp/out" && rm -f "$ac_tmp/out";;
+ *) rm -f "$ac_file" && mv "$ac_tmp/out" "$ac_file";;
+ esac \
+ || as_fn_error $? "could not create $ac_file" "$LINENO" 5
+ ;;
+
+
+
+ esac
+
+done # for ac_tag
+
+
+as_fn_exit 0
+_ACEOF
+ac_clean_files=$ac_clean_files_save
+
+test $ac_write_fail = 0 ||
+ as_fn_error $? "write failure creating $CONFIG_STATUS" "$LINENO" 5
+
+
+# configure is writing to config.log, and then calls config.status.
+# config.status does its own redirection, appending to config.log.
+# Unfortunately, on DOS this fails, as config.log is still kept open
+# by configure, so config.status won't be able to write to it; its
+# output is simply discarded. So we exec the FD to /dev/null,
+# effectively closing config.log, so it can be properly (re)opened and
+# appended to by config.status. When coming back to configure, we
+# need to make the FD available again.
+if test "$no_create" != yes; then
+ ac_cs_success=:
+ ac_config_status_args=
+ test "$silent" = yes &&
+ ac_config_status_args="$ac_config_status_args --quiet"
+ exec 5>/dev/null
+ $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false
+ exec 5>>config.log
+ # Use ||, not &&, to avoid exiting from the if with $? = 1, which
+ # would make configure fail if this is the last instruction.
+ $ac_cs_success || as_fn_exit 1
+fi
+if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then
+ { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5
+$as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;}
+fi
+
Property changes on: trunk/packages/norsp/trunk/configure
___________________________________________________________________
Added: svn:executable
+ *
Added: trunk/packages/norsp/trunk/configure.ac
===================================================================
--- trunk/packages/norsp/trunk/configure.ac (rev 0)
+++ trunk/packages/norsp/trunk/configure.ac 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,6 @@
+AC_INIT([norsp], [1.0.3], [https://rostlab.org/bugzilla3/enter_bug.cgi?product=norsp])
+AC_CONFIG_SRCDIR([norsp])
+AM_INIT_AUTOMAKE
+AC_CONFIG_FILES([Makefile])
+
+AC_OUTPUT
Modified: trunk/packages/norsp/trunk/debian/changelog
===================================================================
--- trunk/packages/norsp/trunk/debian/changelog 2012-07-13 12:00:34 UTC (rev 11777)
+++ trunk/packages/norsp/trunk/debian/changelog 2012-07-13 12:02:04 UTC (rev 11778)
@@ -1,3 +1,9 @@
+norsp (1.0.3-1) UNRELEASED; urgency=low
+
+ * Initial release (Closes: #680367)
+
+ -- eva reisinger <eva at eva.tbl> Fri, 13 Jul 2012 11:53:07 +0000
+
norsp (1.0.3) unstable; urgency=low
* recommends now on ncoils (>= 2002-3)
Modified: trunk/packages/norsp/trunk/debian/control
===================================================================
--- trunk/packages/norsp/trunk/debian/control 2012-07-13 12:00:34 UTC (rev 11777)
+++ trunk/packages/norsp/trunk/debian/control 2012-07-13 12:02:04 UTC (rev 11778)
@@ -2,9 +2,9 @@
Section: science
Priority: extra
Maintainer: Guy Yachdav <gyachdav at rostlab.org>
-Uploaders: Laszlo Kajan <lkajan at rostlab.org>
-Build-Depends: debhelper (>= 7), autotools-dev
-Standards-Version: 3.9.1
+Uploaders: Laszlo Kajan <lkajan at rostlab.org>, Eva Reisinger <e.reisinger at gmx.net>
+Build-Depends: debhelper (>= 8), autotools-dev
+Standards-Version: 3.9.3
Homepage: https://rostlab.org/owiki/index.php/NORSp_-_predictor_of_NOn-Regular_Secondary_Structure
Package: norsp
Added: trunk/packages/norsp/trunk/example/query.coils
===================================================================
--- trunk/packages/norsp/trunk/example/query.coils (rev 0)
+++ trunk/packages/norsp/trunk/example/query.coils 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,405 @@
+>query
+
+
+ . : . : . : . : . 5
+seq VSELPARWHELAKQFPKLERIPGERLLNDLRDWFHNDDPDKRDKITSQLP
+frame-14 abcdefgabcdefgabcdefgcabcdefgabcdefggdefgabcdefgab
+frame-21 abcdefgabcdefgabcdefgaabcdefgabcdefgabcdefgcdefgab
+frame-28 abcdefgabcdefgabcdefgabcdefgcdefgdefgabcdabcdefgab
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 10
+seq NTLLTPLVVLTQLAHFARYLSYNPSGGSVHADDLFRALAQRGVETVGLCT
+frame-14 cdefgfabcdefgabcdefgefgaabaabcabcdefgabcdefgdefggb
+frame-21 cdefgabcdefggabcdefgabcaabaabcdefgabcdefgabcdefgab
+frame-28 cdefgabcdefgabcdefgdefgabcdabcdefgabcdefgabcdefgab
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 15
+seq GLLSASAVSSASDAATFRQYGAVAAYISVLFDENRATVTTAEATAPLMLQ
+frame-14 cabcabcdefgabcdefgfgbaabcdabababcdefgabcdefgabcdab
+frame-21 cdefggabcdefabcdabcabababcdefgabcdefgabcdefgabcdef
+frame-28 cdefgefgdefgabcdabcdefgabcdefgabcdefgabcdefgabcdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 20
+seq QIRQKGIKAAEVRLRGRFHSEVHNEDLRRVLQFCDLDPAFQFPETSALAF
+frame-14 cabcdefgabcdefgfgbcabcdabcdefgabcdefgcdefgabcdabaa
+frame-21 gabcdefgabcdefgfgbcdefgabcdefgabcdefgabcdefgdeabcd
+frame-28 gabcdefgabcdefgabcdefgabcdefgabcdefggcdefgfgfgabca
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 25
+seq PIHLGKGGCRAKRLHHAVLGMILAEQAAWYETLSGALPAHPQAVIVTFGP
+frame-14 bababcdefgabcabcdefgababcdefgabcdefgabcdefgefggcde
+frame-21 eababcdefgaabcdefgabcdefgabcdefgdefgabcdefgefgdefg
+frame-28 babaaabcabcdefgabcdefgabcdefgabcdefgefgdefgefggefg
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 30
+seq DSGVPPSLLRKMGSRLVHASDLNWAPTLLSPKDGALNPPGSYTAWSAARG
+frame-14 fabababaabcdefgabcdefggfgdefgggabcdefgeaaabcdefgab
+frame-21 aabcabcdabcdefgabcdefgabcdefggcdefabcdefgabcabcdef
+frame-28 gabcdefaabcdefgabcdefgabcdefgabcdefgcabcdaababcdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 35
+seq NENDSDIVVVGMSCRVAGADDLDEFWKILCAGKSQHIEVPGERFGVETQW
+frame-14 cdefgfggabcdefgabcdefgabcdefgabcdefgefgdefabcdefga
+frame-21 gabcdefgabcdefgabcdefgabcdefgabcdefgefgdefgbcabcde
+frame-28 gabcdefgabcdefgabcdefgabcdefgabcdefgabcdefgbcabcde
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 40
+seq RDVDSSRKWYGNFIRDHDTFDHKFFKKSPREMTSSDPQQRLMLQCAYQAV
+frame-14 bcabcdefgabcdefgabcdefgcdefgabcdefgabababcdefgabcd
+frame-21 fgabcdefgabcdefgabcdefgcdefgabcdabcdefgabcdefgabcd
+frame-28 fgabcdefgabcdefgabcdefgcdabcdefgabcdeababcdefgabcd
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 45
+seq EQSGYFHQAKVDTKNLSGASFLSPTGQCKPWDQGADGYCRGEAAAVVFLK
+frame-14 efgababcdefgabcdefgefggbcdefgcdabcdefgabcdefgabcde
+frame-21 efgabcdefgabcdefgfgefgabcdefgcaabcdefgabcdefgabcde
+frame-28 efgabcdefgabcdefgfggfgfgcdefgcaabcdefgabcdefgabcde
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 50
+seq RRADAVADGNRILGCISSTAVYQNENCTPVFVPNSPSLTYLFKDVLDRAK
+frame-14 fgabcdefgefggcabcdefgabcdefgfgcdefabcdabcdefgabcde
+frame-21 fgabcdefgabcdefgefgabcdefgfgfgcabcabcdefgabcdefgab
+frame-28 fgabcdefgabcdefgefgabcdefgdefgeabcabcdefgabcdefgab
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 55
+seq LEPRDISVVEAHGTGTPVGDPAEYLSVLQALGGSLRDKPLALGSVKGLIG
+frame-14 fgabcdefgefgfggfgabcabcaabcdefgabcdefgefgabcdefgab
+frame-21 cdefgabcdefgdefggabcdefgabcabcdefgabcdefgabcdefgef
+frame-28 cdefgabcdefgdefgefgcabcabcdabcdefgabcdefgabcdefgab
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 60
+seq HTEGASGVVSLIKIILMMQHGYVPPQASFQSLAHNIAASPSDKIEIVTKL
+frame-14 cdefgefabcdefgabcdefggbcdabcdefgabcdefgdefabcdefga
+frame-21 gabcdefgabcdefgefggfggbcdaababcdefgabcdefgabcdefga
+frame-28 cdefgabcdefgabcdefgefgbcdabcabcdefgabcdefgabcdefga
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 65
+seq RSWDADYRAALINNYGASGSNASMVVTPPPQPNRAALSPIHAPGIKHPFW
+frame-14 bcdefgabcdefggabcdefgdefgfggbcdeabcdefgabcdefgabcd
+frame-21 bcdefgabcdefgabcdefgabcdefgggefgabcdefgabcdeababcd
+frame-28 bcdefgabcdefgabcdefgabcdefggabcdabcdefgabcdeabcdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 70
+seq LCGLDDKALIAYSKRLRHFIAHKTSSYSSTATISLANLSFNVCRQSNRHL
+frame-14 aabcdefgabcdefgabcdefgdefgaabcdefgabcdeabcdefgabcd
+frame-21 aabcdefgabcdefgabcdefgabcdefgcdeabcdefgabcdefgabcd
+frame-28 gabcdefgabcdefgabcdefgabcabcdefgabcdefgabcdefgabcd
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 75
+seq DRALMFSCSSLGELDEKLALFIDGDAKLGSTSTKTITKRRPVIMCFGGQV
+frame-14 efgabcdefgabcdefgabcdefgefgbcdefgabcdefgbcabcabcde
+frame-21 efgabcdefgabcdefgabcdefgabcdefgefgcdefgggcabcdefga
+frame-28 efgabcdefgabcdefgabcdefgabcdefgabcdefggfgcabcabcda
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 80
+seq SSFVGLDRQVYDSVKIVRDYLDQCNAVFLSIGLEGIFPAVFQREPIEDPV
+frame-14 fgaababcdabcdabcdefgabcdefgefgdefgfgabcdefgbcdefga
+frame-21 bcabcdefgabcdefgabcdefgdefgabcdefgefgcabcabcdeabca
+frame-28 bcabcdefgabcdefgabcdefgabcdefgdefgefgabcdefgcdabca
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 85
+seq RLQTALFAVQYACAKSWMDSGIQAEAVVGHSFGELTALCVSGVLSLLDAS
+frame-14 aabcdefgabcdeabcdefgabcdefgdefgabcdeabcabcaabcabcd
+frame-21 bcdefgabcdefgabcdefgabcdefgabcdabcdefgaabcabcdabcd
+frame-28 bcdefgabcdefgabcdefgabcdefgabcdefgabcdeabcdefgabcd
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 90
+seq KMIVARAKLVRDTWGSDRGAMAAVEADLDMVRSAIESHNRAMVDDELPVT
+frame-14 efgabcdefgfgcdefgcdeabcdefgabcdefgabcdefgefgggfgcd
+frame-21 efgabcdefgabcdefgefgabcdefgabcdefgabcdefgefggefgab
+frame-28 efgabcabcdefgabcdefgabcdefgabcdefgabcdefgabcdefgab
+prob-14 --------------------------------------------------
+prob-21 --------------------222222222222222222222---------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 95
+seq IACYNGPRSFTLAGPTKSMDKFVETLTGSPMYSPVMRVKRLNVTHAFHSV
+frame-14 efgdefgabcdabcdabcdefgabcdefgeababaababcdefgabcdef
+frame-21 cdefgcdeabcdefgabcabcdefgabcdeababcdeabcdefgabcdef
+frame-28 cdefgabcdefgbcdefgabcdefgabcdeabcdabcabcdefgabcdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 100
+seq LVEPLIDELDAIGRTLTFREPSILLERSTKELNLETTSEFVAQHMRQPVF
+frame-14 gabcdefgabcdefgdefgcdabcabcdefgabcdefgfgabcdefgabc
+frame-21 gabcdefgabcdefgdeabcdefaababcdefgabcdefgabcdefgabc
+frame-28 gabcdefgabcdefgdefgabcdefgabcdefgabcdefgabcdefgabc
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 105
+seq FEHAVKRLAEQYPDAAWIEAGSASTITNMASRALGSPSTYHFQSLNITCD
+frame-14 defgabcdefgabcdefgabcdabcdefgabcdefgefgababcdefgab
+frame-21 defgabcdefgabcdefgabcdefgdefgabcdefgefaababcdefgab
+frame-28 defgabcdefgabcdefgabcdefgabcdefgdefgcdeababcdefgab
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 110
+seq HGMKSLADATLALWKAGVETAYWPHHPGQTYEFDHLFLPPYQFEKVKHWM
+frame-14 cdefgabcdefgabcdefggggfgfabcdeabcdefgabaabcdeabcde
+frame-21 cdefgabcdefgabcdefgcdefgfgcdefgbabcdeabcaabcaabcde
+frame-28 cdefgabcdefgabcdefgabcdefgcdefgbcdefgabcabcdeabcde
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 115
+seq DLKKPQKGLVELPAAEAGNVEARVPVGLWSFLGYDDSKEQTARFVVNTDS
+frame-14 fgabcdefgabcdefgabcdefgfgcdabaabcabcdefgabcdefgdef
+frame-21 fgabcdefgabcdefgabcdefgabcdabcabcabcdefgabcdefgabc
+frame-28 fgabcdefgabcdefgabcdefgabcdefgabcdefababcdefgabcde
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 120
+seq KKYHDFVSGHLIANTAPICPATLEVDMAIEALMSIRPDLKTDGMQPTIQN
+frame-14 ggabcdefggefgefgfaabaabcdefgabcdefgabcdefgcdefgabc
+frame-21 defggdefgabcdefgfabcaabcdefgabcdefgabcdefgefgdefgc
+frame-28 fgabcdefgabcdefgcabcdabcdefgabcdefgabcdefgabcdefgc
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 125
+seq LQNHSPICVDPSRQVFIVYTASDIRGHVWEWKMTSSPAQGPGPTTEHVHG
+frame-14 defgabcdefgabcdeabcdabcdefgabcdefgcdefgfgabcdefgab
+frame-21 defgabcdefgababcdefgabcdefgabcdefgcdefgfgabcabcdef
+frame-28 defgabcdefgabcdefgabcdefgabcdefgabcdefgfgabcabcdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 130
+seq SIVFRSPEDPGYQAEFGRYGRHFTHQRCLDVLNAVEADDIIQGRNIYKTF
+frame-14 cabcdefgabcabcdefgababcdabcdefgabcdefgdefgefgabcde
+frame-21 gabcdefgabcababcdabcabcdabcdefgaabcdefgabcdefabcde
+frame-28 gabcdefgabaabcdefgabcabcabcdefgabcdefgabcdefgabcde
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 135
+seq AEIVDYGEQYRGLKRLVGRGSECAGRVSKRWTGETWLDTHLSDCFSQVGG
+frame-14 fgabcdefgabcdefgefgabcdefggabcdefgcdefggabcdefgefg
+frame-21 fgabcdefgabcdefgabcdefgabcdefgdefgabcdefgabcdefgef
+frame-28 fgabcdefgabcdefgabcdefgabcdefgdefgefgdefgabcdefgef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 140
+seq IWVNCMTNRAPDDMYIASGCELVIRSPNLRPDGPRPEIWDVFATHHRVSD
+frame-14 gaabcdefgabcdefgabcdefgabcdefgfggaabcabcdefgabcdef
+frame-21 gaabcdefgabcdefgabcdefgabcdefgfgcdabcdefgaabcabcda
+frame-28 ggabcdefgabcdefgabcdefgabcdefgabcdabcaabcdabcdefga
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 145
+seq KLYVTDIFTFDSTSGELLDVMIGIKYAKISKPSMQKILARLSPGVCVPPP
+frame-14 gdefggabcabcdefgabcdefgabcdefgabcdefgefgdefgefggaa
+frame-21 bcdefgabcabcdefgabcdefgabcdefgabcdefgabcdefgefggab
+frame-28 bcabcdefgabcdefgabcdefgabcdefgabcdefgabcdefgefggga
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 150
+seq PGLGTAPVTHNKTSREPIEPSEASGAVPTATGATVSKSFKAGGAEVSKKQ
+frame-14 baabcdefgabcdefggabcdefgfgabcababcdabcdefgaabcdabc
+frame-21 caabcabcdeababcdeababcdefgabaabcdefabcababcabcdabc
+frame-28 bcabcabcdefgabcdeababcabcdabcabababcabcdabcdefgabc
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 155
+seq PENTRANIKKQVRDLLANVAGVEPADISESTVLSDIGIDSLMGMELAREA
+frame-14 defgabcdefgabcdefgdefgefgdefgfgababcdabcabcabcdefg
+frame-21 defgabcdefgabcdefgabcdefgdefgdefabcdefgabcdefabcde
+frame-28 defgabcdefgabcdefgabcdefgabcdefggabcdefgabcdefgabc
+prob-14 ----33333333333333--------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 160
+seq ETVMKCTLSPDKLMEAFDFPSFVDCVISALGITADGQEEEMEEEQDDKQE
+frame-14 abcdefgfggbcdefgefgbcaabcaabcdefgabcdefgabcdefgdef
+frame-21 fgabcdefgabcdefggfaabaabcaabcdefgabcdefgabcdefgabc
+frame-28 defgcdefgabcdefgefaabcabcaabcdefgabcdefgabcdefgabc
+prob-14 ---------------------------------99999999999999777
+prob-21 --------------------------333333399999999999999999
+prob-28 --------------------------777777799999999999999999
+ . : . : . : . : . 165
+seq KEEGARQRVQESEPTTDDEQYRPYKAQDASWSQSSGTSTPPSSLDDDLNE
+frame-14 gefgdefgdefggbcdefgefgcdefgabcdefgefgfgdabcabcdabc
+frame-21 defgdefgefggefgdefgefgcdefgfgcdefgefgfgaabcdefgabc
+frame-28 defgabcdefgdefgefggefgabcdefgcdefgefgabcabcabcdabc
+prob-14 7444----------------------------------------------
+prob-21 99998888222---------------------------------------
+prob-28 99999999999---------------------------------------
+ . : . : . : . : . 170
+seq LTLPAGAVLESFGKTKLLTDEMIRRYKVDTFANVIAPKSTQLCIALTLEA
+frame-14 defgabcabcdabcdabcdefgabcdefgefgfgaabcdefgaabcdabc
+frame-21 defgabcdabcdefgabcdefgabcdefgcdefggabcdeabcabcdefg
+frame-28 defgabcdefgabcdefgabcdefgabcdefgdefabcdefgabcdefga
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 175
+seq FEKLGVSIRATKAGQVVPRINYAPQHQRLVDYLYRLLENEARLIDSTDRG
+frame-14 defgabcdefgefgfgabcdefabcabcaabcaabcdefgabcdefgfgg
+frame-21 abcdefgabcdefgfgababcaabcdefabcdefgabcdefgabcdefgg
+frame-28 bcdefgabcdefggfabcabcaabcdefgabcdefgabcdefgabcdefg
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 180
+seq EHVRTAVSPPKKASVALLQDLVRLYPDWSNAQKLTHFAGSRLADVLEGKT
+frame-14 bcdefggabcabcdefgabcdefgabcdefgcdefabcdefgabcdefga
+frame-21 bcdefgggcdabcdefgabcdefgabcdefgdefgabcdefgabcdefga
+frame-28 bcdefggbcdabcdefgabcdefgabcdefgabcdefgabcdefgdefga
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 185
+seq DGIKIIFGSDEGRALVGGLYCDHVFNKMNYQQMADCLEGLVSKLPADQGP
+frame-14 bcdefgefgbcdefgabcdeabcdefabcdefgabcdefgefgdefgefg
+frame-21 bcdefgabcdefgfgabcdabcabcdabcdefgabcdefgabcdefgefg
+frame-28 bcdefgababcdefgabcdefgabcdefgabcdefgabcdefgdefgabc
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 190
+seq LRILELGAGTGGTTLYVAPMLERLQVPVEYVFTDISPSMVSAAKKKFGKY
+frame-14 abcdefgabcdefgefgabcabcdefgabcdefgcdefgabcdefgabcd
+frame-21 abcdefgfgabcdefgabcdabcdefgabcdeabcabcdabcabcdefga
+frame-28 defgefgabcdefgfgaabcdefgabcdefgabcdabcdabcabcdefga
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 195
+seq AFMKYMVHDMEKPMSAELLGTQHIVIASNAVHATRDLVKTGTNIHNALRP
+frame-14 efgefgabcdefgdaabcdefgaabcdefgabcdefgbcdefggefgefg
+frame-21 bcdefgabcdefgaaabcdefgaabcdefgabcdefgabcdefgbcdefg
+frame-28 bcdefgabcdefgababcdefgabcdefgabcdefgabcdefggabcdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 200
+seq DGFLMMLEMTEIVPFVDTIFGLLEGWWLFDDGRQHAITGPEGWEKAMHSA
+frame-14 gdefaabcdefgabcdefgbcdefgefgabcdabcdefgabcdefgefga
+frame-21 gdefgabcdefgbcdefgabcdefggbcabcdabcdefgabcdefgabcd
+frame-28 gbcdefggdefgabcdefgabcdefgabcdefabcdefgabcdefgabcd
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 205
+seq GFGHVDWTDGHLPESKIQKVIVAMASGPVQERLPPPPPPARKAAESGPDL
+frame-14 bcdeabcdefgababcdefgabcdefgefgefgggaabaabcdefgabca
+frame-21 efggabcdefgabcdefgabcdefgabcdefggggaabaabcabcdefga
+frame-28 efgaabcdefgabcdefgabcdefgabcdefggggabcaabcdefgabcd
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 210
+seq ASREEDISAYVQKFSAGFKAPSVVLPNPGRLGGGKLQCVLITGATGSLGT
+frame-14 bcdefgabcdefgdefgefgdefgbcdeababcdefgabcabcdefgabc
+frame-21 bcdefgabcdefgabcdefgdefgabcdefabcabcdabcabcdefgabc
+frame-28 efgabcdefgabcdefgefgdefgefgdefabcdefgabcabcdefgabc
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 215
+seq HLVKAFAERADVGTVICLNRPGPSVAVPPESRQLEAMAARGVTINDEARA
+frame-14 dabcdefgabcdefggdefggcdabcabcdabcabcdefgabcdefgdef
+frame-21 defgabcdefgdefgefgfgbcdefaabcdabcdefgabcdefgabcdef
+frame-28 defgabcdefgabcdefgfabcdabcdefaabcdefgabcdefgabcdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 220
+seq KLCFIETDSSKARLGLGEEEYASLAGSVTGILHNAWPMSGNRPLKAFEPA
+frame-14 gabcdeabcdefgabcdefgabcdefgabcdefggbcdefgbcabcdefa
+frame-21 gcdefgabcdefgabcdefgabcdefgabcdefgabcdefgcdabcdefg
+frame-28 gabcdefgcdefgabcdefgabcdefgabcdefgabcdefgcdabcdefg
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 225
+seq FHSLRNLIDLAREAAGRQQKIRFQLISSIGVVGHYPLWSGKIRVPEERME
+frame-14 abcabcdefgabcdefgefggefgefgggfgefgababcdabcdefgabc
+frame-21 abcabcdefgabcdefgabcdefgefggefggfgababcdabcdefgabc
+frame-28 abcdefgabcdefgabcdefgabcdefgefgefggbcdefabcdefgabc
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 230
+seq VRSVLPNGYCDGKFTCERILDETLHRYPEYFHTMSARLGQVAGSKTSGYW
+frame-14 defgefgdefgaabcdefgabcdefgabcdefgdefgabcdefgefggef
+frame-21 defgabcdefgaabcdefgabcdefgabcdefgabcdefgabcdefgdef
+frame-28 defgabcdefgaabcdefgabcdefgabcdefgabcdefgabcdefgdef
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 235
+seq NPVEHFCFMVKSSQNLRVLPQLEGNLTWCPVNDMASALSDLLLLPFRPQP
+frame-14 gaabcdefabcabcdefgabcdefgabcdeabcdefgabcdefgefggcd
+frame-21 gaababcdefgabcdefgabcdefgdefgefgabcdefgcdefgefgdef
+frame-28 ggababcdefgabcdefgabcdefgabcdefgabcdefggdefgefgabc
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 240
+seq IYHIDNPVQQPWSEMVRMLAKALDIPQSNIIPFDDWVARVRRSPLAPETD
+frame-14 efgabcdaabcabcdefgabcdefgdefgfgcabcdefgabcdefgbcda
+frame-21 aabcabcdabcdefgabcdefgabcdefgabcdefgabcdefgababcde
+frame-28 aabcdefgabcabcdabcdefgabcdefgabcdefgabcdefgfgabcde
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 245
+seq NPAARLIDFLEFHFRRMSCGGLLLDLSKACHDSPALAAVGPVNEDMVRKY
+frame-14 bcabcdefgabcdefgdeabcdefgabcdefgabcdefgefgaabcdefg
+frame-21 fgabcdefgabcdefgababcdefgabcdefgabcdefgabaabcdefga
+frame-28 fgabcdefgabcdefgabcdefgabcdefgfgabcdefgabcdefgabcd
+prob-14 --------------------------------------------------
+prob-21 --------------------------------------------------
+prob-28 --------------------------------------------------
+ . : . : . : . : . 250
+seq VSSWKKMGFLAQGNR
+frame-14 abcdefgabcdefgg
+frame-21 bcdefgabcdefggg
+frame-28 efgefgabcdefggg
+prob-14 ---------------
+prob-21 ---------------
+prob-28 ---------------
+// End
+
Added: trunk/packages/norsp/trunk/example/query.coils_raw
===================================================================
--- trunk/packages/norsp/trunk/example/query.coils_raw (rev 0)
+++ trunk/packages/norsp/trunk/example/query.coils_raw 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,2465 @@
+ 1 V a 0.704 0.000 ( 0.000 4.820)
+ 2 S b 0.704 0.000 ( 0.000 4.820)
+ 3 E c 0.704 0.000 ( 0.000 4.820)
+ 4 L d 0.704 0.000 ( 0.000 4.820)
+ 5 P e 0.704 0.000 ( 0.000 4.820)
+ 6 A f 0.704 0.000 ( 0.000 4.820)
+ 7 R g 0.704 0.000 ( 0.000 4.820)
+ 8 W a 0.704 0.000 ( 0.000 4.820)
+ 9 H b 0.704 0.000 ( 0.000 4.820)
+ 10 E c 0.704 0.000 ( 0.000 4.820)
+ 11 L d 0.704 0.000 ( 0.000 4.820)
+ 12 A e 0.704 0.000 ( 0.000 4.820)
+ 13 K f 0.704 0.000 ( 0.000 4.820)
+ 14 Q g 0.704 0.000 ( 0.000 4.820)
+ 15 F a 0.704 0.000 ( 0.000 4.820)
+ 16 P b 0.704 0.000 ( 0.000 4.820)
+ 17 K c 0.704 0.000 ( 0.000 4.820)
+ 18 L d 0.704 0.000 ( 0.000 4.820)
+ 19 E e 0.704 0.000 ( 0.000 4.820)
+ 20 R f 0.704 0.000 ( 0.000 4.820)
+ 21 I g 0.704 0.000 ( 0.000 4.820)
+ 22 P a 0.704 0.000 ( 0.000 4.820)
+ 23 G b 0.704 0.000 ( 0.000 4.820)
+ 24 E c 0.704 0.000 ( 0.000 4.820)
+ 25 R d 0.704 0.000 ( 0.000 4.820)
+ 26 L e 0.704 0.000 ( 0.000 4.820)
+ 27 L f 0.704 0.000 ( 0.000 4.820)
+ 28 N g 0.704 0.000 ( 0.000 4.820)
+ 29 D c 0.682 0.000 ( 0.000 4.475)
+ 30 L d 0.682 0.000 ( 0.000 4.475)
+ 31 R e 0.682 0.000 ( 0.000 4.475)
+ 32 D f 0.682 0.000 ( 0.000 4.475)
+ 33 W g 0.682 0.000 ( 0.000 4.475)
+ 34 F d 0.669 0.000 ( 0.000 4.267)
+ 35 H e 0.669 0.000 ( 0.000 4.267)
+ 36 N f 0.669 0.000 ( 0.000 4.267)
+ 37 D g 0.669 0.000 ( 0.000 4.267)
+ 38 D a 0.669 0.000 ( 0.000 4.267)
+ 39 P b 0.669 0.000 ( 0.000 4.267)
+ 40 D c 0.669 0.000 ( 0.000 4.267)
+ 41 K d 0.669 0.000 ( 0.000 4.267)
+ 42 R a 0.687 0.000 ( 0.000 4.569)
+ 43 D b 0.687 0.000 ( 0.000 4.569)
+ 44 K c 0.687 0.000 ( 0.000 4.569)
+ 45 I d 0.687 0.000 ( 0.000 4.569)
+ 46 T e 0.687 0.000 ( 0.000 4.569)
+ 47 S f 0.687 0.000 ( 0.000 4.569)
+ 48 Q g 0.687 0.000 ( 0.000 4.569)
+ 49 L a 0.687 0.000 ( 0.000 4.569)
+ 50 P b 0.687 0.000 ( 0.000 4.569)
+ 51 N c 0.687 0.000 ( 0.000 4.569)
+ 52 T d 0.687 0.000 ( 0.000 4.569)
+ 53 L e 0.687 0.000 ( 0.000 4.569)
+ 54 L f 0.687 0.000 ( 0.000 4.569)
+ 55 T g 0.687 0.000 ( 0.000 4.569)
+ 56 P a 0.687 0.000 ( 0.000 4.569)
+ 57 L b 0.687 0.000 ( 0.000 4.569)
+ 58 V c 0.687 0.000 ( 0.000 4.569)
+ 59 V d 0.687 0.000 ( 0.000 4.569)
+ 60 L e 0.687 0.000 ( 0.000 4.569)
+ 61 T f 0.687 0.000 ( 0.000 4.569)
+ 62 Q g 0.687 0.000 ( 0.000 4.569)
+ 63 L a 0.687 0.000 ( 0.000 4.569)
+ 64 A b 0.687 0.000 ( 0.000 4.569)
+ 65 H c 0.687 0.000 ( 0.000 4.569)
+ 66 F d 0.687 0.000 ( 0.000 4.569)
+ 67 A e 0.687 0.000 ( 0.000 4.569)
+ 68 R f 0.687 0.000 ( 0.000 4.569)
+ 69 Y g 0.687 0.000 ( 0.000 4.569)
+ 70 L d 0.617 0.000 ( 0.000 3.311)
+ 71 S e 0.617 0.000 ( 0.000 3.311)
+ 72 Y f 0.617 0.000 ( 0.000 3.311)
+ 73 N g 0.617 0.000 ( 0.000 3.311)
+ 74 P a 0.617 0.000 ( 0.000 3.311)
+ 75 S b 0.617 0.000 ( 0.000 3.311)
+ 76 G c 0.617 0.000 ( 0.000 3.311)
+ 77 G d 0.617 0.000 ( 0.000 3.311)
+ 78 S a 0.783 0.000 ( 0.000 5.530)
+ 79 V b 0.783 0.000 ( 0.000 5.530)
+ 80 H c 0.783 0.000 ( 0.000 5.530)
+ 81 A d 0.783 0.000 ( 0.000 5.530)
+ 82 D e 0.783 0.000 ( 0.000 5.530)
+ 83 D f 0.783 0.000 ( 0.000 5.530)
+ 84 L g 0.783 0.000 ( 0.000 5.530)
+ 85 F a 0.783 0.000 ( 0.000 5.530)
+ 86 R b 0.783 0.000 ( 0.000 5.530)
+ 87 A c 0.783 0.000 ( 0.000 5.530)
+ 88 L d 0.783 0.000 ( 0.000 5.530)
+ 89 A e 0.783 0.000 ( 0.000 5.530)
+ 90 Q f 0.783 0.000 ( 0.000 5.530)
+ 91 R g 0.783 0.000 ( 0.000 5.530)
+ 92 G a 0.783 0.000 ( 0.000 5.530)
+ 93 V b 0.783 0.000 ( 0.000 5.530)
+ 94 E c 0.783 0.000 ( 0.000 5.530)
+ 95 T d 0.783 0.000 ( 0.000 5.530)
+ 96 V e 0.783 0.000 ( 0.000 5.530)
+ 97 G f 0.783 0.000 ( 0.000 5.530)
+ 98 L g 0.783 0.000 ( 0.000 5.530)
+ 99 C a 0.783 0.000 ( 0.000 5.530)
+ 100 T b 0.783 0.000 ( 0.000 5.530)
+ 101 G c 0.783 0.000 ( 0.000 5.530)
+ 102 L d 0.783 0.000 ( 0.000 5.530)
+ 103 L e 0.783 0.000 ( 0.000 5.530)
+ 104 S f 0.783 0.000 ( 0.000 5.530)
+ 105 A g 0.783 0.000 ( 0.000 5.530)
+ 106 S e 0.776 0.000 ( 0.000 5.508)
+ 107 A f 0.776 0.000 ( 0.000 5.508)
+ 108 V g 0.776 0.000 ( 0.000 5.508)
+ 109 S d 0.747 0.000 ( 0.000 5.316)
+ 110 S e 0.747 0.000 ( 0.000 5.316)
+ 111 A f 0.747 0.000 ( 0.000 5.316)
+ 112 S g 0.747 0.000 ( 0.000 5.316)
+ 113 D a 0.745 0.000 ( 0.000 5.298)
+ 114 A b 0.745 0.000 ( 0.000 5.298)
+ 115 A c 0.745 0.000 ( 0.000 5.298)
+ 116 T d 0.745 0.000 ( 0.000 5.298)
+ 117 F a 0.871 0.000 ( 0.000 5.137)
+ 118 R b 0.871 0.000 ( 0.000 5.137)
+ 119 Q c 0.871 0.000 ( 0.000 5.137)
+ 120 Y d 0.871 0.000 ( 0.000 5.137)
+ 121 G e 0.871 0.000 ( 0.000 5.137)
+ 122 A f 0.871 0.000 ( 0.000 5.137)
+ 123 V g 0.871 0.000 ( 0.000 5.137)
+ 124 A a 0.876 0.000 ( 0.000 5.085)
+ 125 A b 0.876 0.000 ( 0.000 5.085)
+ 126 Y c 0.876 0.000 ( 0.000 5.085)
+ 127 I d 0.876 0.000 ( 0.000 5.085)
+ 128 S e 0.876 0.000 ( 0.000 5.085)
+ 129 V f 0.876 0.000 ( 0.000 5.085)
+ 130 L g 0.876 0.000 ( 0.000 5.085)
+ 131 F a 0.996 0.000 ( 0.003 3.080)
+ 132 D b 0.996 0.000 ( 0.003 3.080)
+ 133 E c 0.996 0.000 ( 0.003 3.080)
+ 134 N d 0.996 0.000 ( 0.003 3.080)
+ 135 R e 0.996 0.000 ( 0.003 3.080)
+ 136 A f 0.996 0.000 ( 0.003 3.080)
+ 137 T g 0.996 0.000 ( 0.003 3.080)
+ 138 V a 1.068 0.000 ( 0.014 1.839)
+ 139 T b 1.068 0.000 ( 0.014 1.839)
+ 140 T c 1.068 0.000 ( 0.014 1.839)
+ 141 A d 1.068 0.000 ( 0.014 1.839)
+ 142 E e 1.068 0.000 ( 0.014 1.839)
+ 143 A f 1.068 0.000 ( 0.014 1.839)
+ 144 T g 1.068 0.000 ( 0.014 1.839)
+ 145 A a 1.068 0.000 ( 0.014 1.839)
+ 146 P b 1.068 0.000 ( 0.014 1.839)
+ 147 L c 1.068 0.000 ( 0.014 1.839)
+ 148 M d 1.068 0.000 ( 0.014 1.839)
+ 149 L e 1.068 0.000 ( 0.014 1.839)
+ 150 Q f 1.068 0.000 ( 0.014 1.839)
+ 151 Q g 1.068 0.000 ( 0.014 1.839)
+ 152 I a 1.068 0.000 ( 0.014 1.839)
+ 153 R b 1.068 0.000 ( 0.014 1.839)
+ 154 Q c 1.068 0.000 ( 0.014 1.839)
+ 155 K d 1.068 0.000 ( 0.014 1.839)
+ 156 G e 1.068 0.000 ( 0.014 1.839)
+ 157 I f 1.068 0.000 ( 0.014 1.839)
+ 158 K g 1.068 0.000 ( 0.014 1.839)
+ 159 A a 1.068 0.000 ( 0.014 1.839)
+ 160 A b 1.068 0.000 ( 0.014 1.839)
+ 161 E c 1.068 0.000 ( 0.014 1.839)
+ 162 V d 1.068 0.000 ( 0.014 1.839)
+ 163 R e 1.068 0.000 ( 0.014 1.839)
+ 164 L f 1.068 0.000 ( 0.014 1.839)
+ 165 R g 1.068 0.000 ( 0.014 1.839)
+ 166 G a 0.935 0.000 ( 0.001 4.187)
+ 167 R b 0.935 0.000 ( 0.001 4.187)
+ 168 F c 0.935 0.000 ( 0.001 4.187)
+ 169 H d 0.935 0.000 ( 0.001 4.187)
+ 170 S e 0.935 0.000 ( 0.001 4.187)
+ 171 E f 0.935 0.000 ( 0.001 4.187)
+ 172 V g 0.935 0.000 ( 0.001 4.187)
+ 173 H a 0.935 0.000 ( 0.001 4.187)
+ 174 N b 0.935 0.000 ( 0.001 4.187)
+ 175 E c 0.935 0.000 ( 0.001 4.187)
+ 176 D d 0.935 0.000 ( 0.001 4.187)
+ 177 L e 0.935 0.000 ( 0.001 4.187)
+ 178 R f 0.935 0.000 ( 0.001 4.187)
+ 179 R g 0.935 0.000 ( 0.001 4.187)
+ 180 V a 0.864 0.000 ( 0.000 5.215)
+ 181 L b 0.864 0.000 ( 0.000 5.215)
+ 182 Q c 0.864 0.000 ( 0.000 5.215)
+ 183 F d 0.864 0.000 ( 0.000 5.215)
+ 184 C e 0.864 0.000 ( 0.000 5.215)
+ 185 D f 0.864 0.000 ( 0.000 5.215)
+ 186 L g 0.864 0.000 ( 0.000 5.215)
+ 187 D g 0.828 0.000 ( 0.000 5.491)
+ 188 P c 0.654 0.000 ( 0.000 4.000)
+ 189 A d 0.654 0.000 ( 0.000 4.000)
+ 190 F e 0.654 0.000 ( 0.000 4.000)
+ 191 Q f 0.654 0.000 ( 0.000 4.000)
+ 192 F g 0.654 0.000 ( 0.000 4.000)
+ 193 P f 0.604 0.000 ( 0.000 3.076)
+ 194 E g 0.604 0.000 ( 0.000 3.076)
+ 195 T f 0.560 0.000 ( 0.000 2.292)
+ 196 S g 0.560 0.000 ( 0.000 2.292)
+ 197 A a 0.611 0.000 ( 0.000 3.199)
+ 198 L b 0.611 0.000 ( 0.000 3.199)
+ 199 A c 0.611 0.000 ( 0.000 3.199)
+ 200 F a 0.618 0.000 ( 0.000 3.335)
+ 201 P b 0.618 0.000 ( 0.000 3.335)
+ 202 I a 0.638 0.000 ( 0.000 3.713)
+ 203 H b 0.638 0.000 ( 0.000 3.713)
+ 204 L a 0.663 0.000 ( 0.000 4.164)
+ 205 G a 0.676 0.000 ( 0.000 4.387)
+ 206 K a 0.738 0.000 ( 0.000 5.231)
+ 207 G b 0.738 0.000 ( 0.000 5.231)
+ 208 G c 0.738 0.000 ( 0.000 5.231)
+ 209 C a 0.793 0.000 ( 0.000 5.552)
+ 210 R b 0.793 0.000 ( 0.000 5.552)
+ 211 A c 0.793 0.000 ( 0.000 5.552)
+ 212 K d 0.793 0.000 ( 0.000 5.552)
+ 213 R e 0.793 0.000 ( 0.000 5.552)
+ 214 L f 0.793 0.000 ( 0.000 5.552)
+ 215 H g 0.793 0.000 ( 0.000 5.552)
+ 216 H a 0.793 0.000 ( 0.000 5.552)
+ 217 A b 0.793 0.000 ( 0.000 5.552)
+ 218 V c 0.793 0.000 ( 0.000 5.552)
+ 219 L d 0.793 0.000 ( 0.000 5.552)
+ 220 G e 0.793 0.000 ( 0.000 5.552)
+ 221 M f 0.793 0.000 ( 0.000 5.552)
+ 222 I g 0.793 0.000 ( 0.000 5.552)
+ 223 L a 0.793 0.000 ( 0.000 5.552)
+ 224 A b 0.793 0.000 ( 0.000 5.552)
+ 225 E c 0.793 0.000 ( 0.000 5.552)
+ 226 Q d 0.793 0.000 ( 0.000 5.552)
+ 227 A e 0.793 0.000 ( 0.000 5.552)
+ 228 A f 0.793 0.000 ( 0.000 5.552)
+ 229 W g 0.793 0.000 ( 0.000 5.552)
+ 230 Y a 0.793 0.000 ( 0.000 5.552)
+ 231 E b 0.793 0.000 ( 0.000 5.552)
+ 232 T c 0.793 0.000 ( 0.000 5.552)
+ 233 L d 0.793 0.000 ( 0.000 5.552)
+ 234 S e 0.793 0.000 ( 0.000 5.552)
+ 235 G f 0.793 0.000 ( 0.000 5.552)
+ 236 A g 0.793 0.000 ( 0.000 5.552)
+ 237 L e 0.691 0.000 ( 0.000 4.620)
+ 238 P f 0.691 0.000 ( 0.000 4.620)
+ 239 A g 0.691 0.000 ( 0.000 4.620)
+ 240 H d 0.689 0.000 ( 0.000 4.586)
+ 241 P e 0.689 0.000 ( 0.000 4.586)
+ 242 Q f 0.689 0.000 ( 0.000 4.586)
+ 243 A g 0.689 0.000 ( 0.000 4.586)
+ 244 V e 0.651 0.000 ( 0.000 3.942)
+ 245 I f 0.651 0.000 ( 0.000 3.942)
+ 246 V g 0.651 0.000 ( 0.000 3.942)
+ 247 T g 0.563 0.000 ( 0.000 2.342)
+ 248 F e 0.544 0.000 ( 0.000 2.026)
+ 249 G f 0.544 0.000 ( 0.000 2.026)
+ 250 P g 0.544 0.000 ( 0.000 2.026)
+ 251 D g 0.475 0.000 ( 0.000 1.087)
+ 252 S a 0.475 0.000 ( 0.000 1.087)
+ 253 G b 0.475 0.000 ( 0.000 1.087)
+ 254 V c 0.475 0.000 ( 0.000 1.087)
+ 255 P d 0.475 0.000 ( 0.000 1.087)
+ 256 P e 0.475 0.000 ( 0.000 1.087)
+ 257 S f 0.475 0.000 ( 0.000 1.087)
+ 258 L a 0.553 0.000 ( 0.000 2.174)
+ 259 L a 0.597 0.000 ( 0.000 2.950)
+ 260 R b 0.597 0.000 ( 0.000 2.950)
+ 261 K c 0.597 0.000 ( 0.000 2.950)
+ 262 M d 0.597 0.000 ( 0.000 2.950)
+ 263 G e 0.597 0.000 ( 0.000 2.950)
+ 264 S f 0.597 0.000 ( 0.000 2.950)
+ 265 R g 0.597 0.000 ( 0.000 2.950)
+ 266 L a 0.597 0.000 ( 0.000 2.950)
+ 267 V b 0.597 0.000 ( 0.000 2.950)
+ 268 H c 0.597 0.000 ( 0.000 2.950)
+ 269 A d 0.597 0.000 ( 0.000 2.950)
+ 270 S e 0.597 0.000 ( 0.000 2.950)
+ 271 D f 0.597 0.000 ( 0.000 2.950)
+ 272 L g 0.597 0.000 ( 0.000 2.950)
+ 273 N a 0.597 0.000 ( 0.000 2.950)
+ 274 W b 0.597 0.000 ( 0.000 2.950)
+ 275 A c 0.597 0.000 ( 0.000 2.950)
+ 276 P d 0.597 0.000 ( 0.000 2.950)
+ 277 T e 0.597 0.000 ( 0.000 2.950)
+ 278 L f 0.597 0.000 ( 0.000 2.950)
+ 279 L g 0.597 0.000 ( 0.000 2.950)
+ 280 S a 0.597 0.000 ( 0.000 2.950)
+ 281 P b 0.597 0.000 ( 0.000 2.950)
+ 282 K c 0.597 0.000 ( 0.000 2.950)
+ 283 D d 0.597 0.000 ( 0.000 2.950)
+ 284 G e 0.597 0.000 ( 0.000 2.950)
+ 285 A f 0.597 0.000 ( 0.000 2.950)
+ 286 L g 0.597 0.000 ( 0.000 2.950)
+ 287 N c 0.501 0.000 ( 0.000 1.392)
+ 288 P a 0.523 0.000 ( 0.000 1.699)
+ 289 P b 0.523 0.000 ( 0.000 1.699)
+ 290 G c 0.523 0.000 ( 0.000 1.699)
+ 291 S d 0.523 0.000 ( 0.000 1.699)
+ 292 Y a 0.524 0.000 ( 0.000 1.709)
+ 293 T a 0.625 0.000 ( 0.000 3.468)
+ 294 A b 0.625 0.000 ( 0.000 3.468)
+ 295 W a 0.795 0.000 ( 0.000 5.554)
+ 296 S b 0.795 0.000 ( 0.000 5.554)
+ 297 A c 0.795 0.000 ( 0.000 5.554)
+ 298 A d 0.795 0.000 ( 0.000 5.554)
+ 299 R e 0.795 0.000 ( 0.000 5.554)
+ 300 G f 0.795 0.000 ( 0.000 5.554)
+ 301 N g 0.795 0.000 ( 0.000 5.554)
+ 302 E a 0.795 0.000 ( 0.000 5.554)
+ 303 N b 0.795 0.000 ( 0.000 5.554)
+ 304 D c 0.795 0.000 ( 0.000 5.554)
+ 305 S d 0.795 0.000 ( 0.000 5.554)
+ 306 D e 0.795 0.000 ( 0.000 5.554)
+ 307 I f 0.795 0.000 ( 0.000 5.554)
+ 308 V g 0.795 0.000 ( 0.000 5.554)
+ 309 V a 0.804 0.000 ( 0.000 5.554)
+ 310 V b 0.804 0.000 ( 0.000 5.554)
+ 311 G c 0.804 0.000 ( 0.000 5.554)
+ 312 M d 0.804 0.000 ( 0.000 5.554)
+ 313 S e 0.804 0.000 ( 0.000 5.554)
+ 314 C f 0.804 0.000 ( 0.000 5.554)
+ 315 R g 0.804 0.000 ( 0.000 5.554)
+ 316 V a 0.804 0.000 ( 0.000 5.554)
+ 317 A b 0.804 0.000 ( 0.000 5.554)
+ 318 G c 0.804 0.000 ( 0.000 5.554)
+ 319 A d 0.804 0.000 ( 0.000 5.554)
+ 320 D e 0.804 0.000 ( 0.000 5.554)
+ 321 D f 0.804 0.000 ( 0.000 5.554)
+ 322 L g 0.804 0.000 ( 0.000 5.554)
+ 323 D a 0.804 0.000 ( 0.000 5.554)
+ 324 E b 0.804 0.000 ( 0.000 5.554)
+ 325 F c 0.804 0.000 ( 0.000 5.554)
+ 326 W d 0.804 0.000 ( 0.000 5.554)
+ 327 K e 0.804 0.000 ( 0.000 5.554)
+ 328 I f 0.804 0.000 ( 0.000 5.554)
+ 329 L g 0.804 0.000 ( 0.000 5.554)
+ 330 C a 0.804 0.000 ( 0.000 5.554)
+ 331 A b 0.804 0.000 ( 0.000 5.554)
+ 332 G c 0.804 0.000 ( 0.000 5.554)
+ 333 K d 0.804 0.000 ( 0.000 5.554)
+ 334 S e 0.804 0.000 ( 0.000 5.554)
+ 335 Q f 0.804 0.000 ( 0.000 5.554)
+ 336 H g 0.804 0.000 ( 0.000 5.554)
+ 337 I a 0.722 0.000 ( 0.000 5.059)
+ 338 E b 0.722 0.000 ( 0.000 5.059)
+ 339 V c 0.722 0.000 ( 0.000 5.059)
+ 340 P d 0.722 0.000 ( 0.000 5.059)
+ 341 G e 0.722 0.000 ( 0.000 5.059)
+ 342 E f 0.722 0.000 ( 0.000 5.059)
+ 343 R g 0.722 0.000 ( 0.000 5.059)
+ 344 F b 0.629 0.000 ( 0.000 3.538)
+ 345 G c 0.629 0.000 ( 0.000 3.538)
+ 346 V a 0.757 0.000 ( 0.000 5.403)
+ 347 E b 0.757 0.000 ( 0.000 5.403)
+ 348 T c 0.757 0.000 ( 0.000 5.403)
+ 349 Q d 0.757 0.000 ( 0.000 5.403)
+ 350 W e 0.757 0.000 ( 0.000 5.403)
+ 351 R f 0.757 0.000 ( 0.000 5.403)
+ 352 D g 0.757 0.000 ( 0.000 5.403)
+ 353 V a 0.757 0.000 ( 0.000 5.403)
+ 354 D b 0.757 0.000 ( 0.000 5.403)
+ 355 S c 0.757 0.000 ( 0.000 5.403)
+ 356 S d 0.757 0.000 ( 0.000 5.403)
+ 357 R e 0.757 0.000 ( 0.000 5.403)
+ 358 K f 0.757 0.000 ( 0.000 5.403)
+ 359 W g 0.757 0.000 ( 0.000 5.403)
+ 360 Y a 0.757 0.000 ( 0.000 5.403)
+ 361 G b 0.757 0.000 ( 0.000 5.403)
+ 362 N c 0.757 0.000 ( 0.000 5.403)
+ 363 F d 0.757 0.000 ( 0.000 5.403)
+ 364 I e 0.757 0.000 ( 0.000 5.403)
+ 365 R f 0.757 0.000 ( 0.000 5.403)
+ 366 D g 0.757 0.000 ( 0.000 5.403)
+ 367 H a 0.757 0.000 ( 0.000 5.403)
+ 368 D b 0.757 0.000 ( 0.000 5.403)
+ 369 T c 0.757 0.000 ( 0.000 5.403)
+ 370 F d 0.757 0.000 ( 0.000 5.403)
+ 371 D e 0.757 0.000 ( 0.000 5.403)
+ 372 H f 0.757 0.000 ( 0.000 5.403)
+ 373 K g 0.757 0.000 ( 0.000 5.403)
+ 374 F c 0.717 0.000 ( 0.000 4.993)
+ 375 F d 0.717 0.000 ( 0.000 4.993)
+ 376 K a 0.757 0.000 ( 0.000 5.396)
+ 377 K b 0.757 0.000 ( 0.000 5.396)
+ 378 S c 0.757 0.000 ( 0.000 5.396)
+ 379 P d 0.757 0.000 ( 0.000 5.396)
+ 380 R e 0.757 0.000 ( 0.000 5.396)
+ 381 E f 0.757 0.000 ( 0.000 5.396)
+ 382 M g 0.757 0.000 ( 0.000 5.396)
+ 383 T a 0.757 0.000 ( 0.000 5.396)
+ 384 S b 0.757 0.000 ( 0.000 5.396)
+ 385 S c 0.757 0.000 ( 0.000 5.396)
+ 386 D d 0.757 0.000 ( 0.000 5.396)
+ 387 P e 0.757 0.000 ( 0.000 5.396)
+ 388 Q a 0.818 0.000 ( 0.000 5.527)
+ 389 Q b 0.818 0.000 ( 0.000 5.527)
+ 390 R a 0.898 0.000 ( 0.000 4.797)
+ 391 L b 0.898 0.000 ( 0.000 4.797)
+ 392 M c 0.898 0.000 ( 0.000 4.797)
+ 393 L d 0.898 0.000 ( 0.000 4.797)
+ 394 Q e 0.898 0.000 ( 0.000 4.797)
+ 395 C f 0.898 0.000 ( 0.000 4.797)
+ 396 A g 0.898 0.000 ( 0.000 4.797)
+ 397 Y a 0.898 0.000 ( 0.000 4.797)
+ 398 Q b 0.898 0.000 ( 0.000 4.797)
+ 399 A c 0.898 0.000 ( 0.000 4.797)
+ 400 V d 0.898 0.000 ( 0.000 4.797)
+ 401 E e 0.898 0.000 ( 0.000 4.797)
+ 402 Q f 0.898 0.000 ( 0.000 4.797)
+ 403 S g 0.898 0.000 ( 0.000 4.797)
+ 404 G a 0.898 0.000 ( 0.000 4.797)
+ 405 Y b 0.898 0.000 ( 0.000 4.797)
+ 406 F c 0.898 0.000 ( 0.000 4.797)
+ 407 H d 0.898 0.000 ( 0.000 4.797)
+ 408 Q e 0.898 0.000 ( 0.000 4.797)
+ 409 A f 0.898 0.000 ( 0.000 4.797)
+ 410 K g 0.898 0.000 ( 0.000 4.797)
+ 411 V a 0.898 0.000 ( 0.000 4.797)
+ 412 D b 0.898 0.000 ( 0.000 4.797)
+ 413 T c 0.898 0.000 ( 0.000 4.797)
+ 414 K d 0.898 0.000 ( 0.000 4.797)
+ 415 N e 0.898 0.000 ( 0.000 4.797)
+ 416 L f 0.898 0.000 ( 0.000 4.797)
+ 417 S g 0.898 0.000 ( 0.000 4.797)
+ 418 G f 0.828 0.000 ( 0.000 5.489)
+ 419 A g 0.828 0.000 ( 0.000 5.489)
+ 420 S g 0.715 0.000 ( 0.000 4.975)
+ 421 F f 0.709 0.000 ( 0.000 4.895)
+ 422 L g 0.709 0.000 ( 0.000 4.895)
+ 423 S f 0.680 0.000 ( 0.000 4.441)
+ 424 P g 0.680 0.000 ( 0.000 4.441)
+ 425 T c 0.655 0.000 ( 0.000 4.024)
+ 426 G d 0.655 0.000 ( 0.000 4.024)
+ 427 Q e 0.655 0.000 ( 0.000 4.024)
+ 428 C f 0.655 0.000 ( 0.000 4.024)
+ 429 K g 0.655 0.000 ( 0.000 4.024)
+ 430 P c 0.610 0.000 ( 0.000 3.178)
+ 431 W a 0.649 0.000 ( 0.000 3.912)
+ 432 D a 0.800 0.000 ( 0.000 5.556)
+ 433 Q b 0.800 0.000 ( 0.000 5.556)
+ 434 G c 0.800 0.000 ( 0.000 5.556)
+ 435 A d 0.800 0.000 ( 0.000 5.556)
+ 436 D e 0.800 0.000 ( 0.000 5.556)
+ 437 G f 0.800 0.000 ( 0.000 5.556)
+ 438 Y g 0.800 0.000 ( 0.000 5.556)
+ 439 C a 0.877 0.000 ( 0.000 5.069)
+ 440 R b 0.877 0.000 ( 0.000 5.069)
+ 441 G c 0.877 0.000 ( 0.000 5.069)
+ 442 E d 0.877 0.000 ( 0.000 5.069)
+ 443 A e 0.877 0.000 ( 0.000 5.069)
+ 444 A f 0.877 0.000 ( 0.000 5.069)
+ 445 A g 0.877 0.000 ( 0.000 5.069)
+ 446 V a 0.877 0.000 ( 0.000 5.069)
+ 447 V b 0.877 0.000 ( 0.000 5.069)
+ 448 F c 0.877 0.000 ( 0.000 5.069)
+ 449 L d 0.877 0.000 ( 0.000 5.069)
+ 450 K e 0.877 0.000 ( 0.000 5.069)
+ 451 R f 0.877 0.000 ( 0.000 5.069)
+ 452 R g 0.877 0.000 ( 0.000 5.069)
+ 453 A a 0.877 0.000 ( 0.000 5.069)
+ 454 D b 0.877 0.000 ( 0.000 5.069)
+ 455 A c 0.877 0.000 ( 0.000 5.069)
+ 456 V d 0.877 0.000 ( 0.000 5.069)
+ 457 A e 0.877 0.000 ( 0.000 5.069)
+ 458 D f 0.877 0.000 ( 0.000 5.069)
+ 459 G g 0.877 0.000 ( 0.000 5.069)
+ 460 N a 0.877 0.000 ( 0.000 5.069)
+ 461 R b 0.877 0.000 ( 0.000 5.069)
+ 462 I c 0.877 0.000 ( 0.000 5.069)
+ 463 L d 0.877 0.000 ( 0.000 5.069)
+ 464 G e 0.877 0.000 ( 0.000 5.069)
+ 465 C f 0.877 0.000 ( 0.000 5.069)
+ 466 I g 0.877 0.000 ( 0.000 5.069)
+ 467 S e 0.859 0.000 ( 0.000 5.269)
+ 468 S f 0.859 0.000 ( 0.000 5.269)
+ 469 T g 0.859 0.000 ( 0.000 5.269)
+ 470 A a 0.859 0.000 ( 0.000 5.269)
+ 471 V b 0.859 0.000 ( 0.000 5.269)
+ 472 Y c 0.859 0.000 ( 0.000 5.269)
+ 473 Q d 0.859 0.000 ( 0.000 5.269)
+ 474 N e 0.859 0.000 ( 0.000 5.269)
+ 475 E f 0.859 0.000 ( 0.000 5.269)
+ 476 N g 0.859 0.000 ( 0.000 5.269)
+ 477 C d 0.624 0.000 ( 0.000 3.446)
+ 478 T e 0.624 0.000 ( 0.000 3.446)
+ 479 P f 0.624 0.000 ( 0.000 3.446)
+ 480 V g 0.624 0.000 ( 0.000 3.446)
+ 481 F e 0.543 0.000 ( 0.000 1.998)
+ 482 V a 0.577 0.000 ( 0.000 2.579)
+ 483 P b 0.577 0.000 ( 0.000 2.579)
+ 484 N c 0.577 0.000 ( 0.000 2.579)
+ 485 S a 0.766 0.000 ( 0.000 5.455)
+ 486 P b 0.766 0.000 ( 0.000 5.455)
+ 487 S c 0.766 0.000 ( 0.000 5.455)
+ 488 L d 0.766 0.000 ( 0.000 5.455)
+ 489 T e 0.766 0.000 ( 0.000 5.455)
+ 490 Y f 0.766 0.000 ( 0.000 5.455)
+ 491 L g 0.766 0.000 ( 0.000 5.455)
+ 492 F a 0.766 0.000 ( 0.000 5.455)
+ 493 K b 0.766 0.000 ( 0.000 5.455)
+ 494 D c 0.766 0.000 ( 0.000 5.455)
+ 495 V d 0.766 0.000 ( 0.000 5.455)
+ 496 L e 0.766 0.000 ( 0.000 5.455)
+ 497 D f 0.766 0.000 ( 0.000 5.455)
+ 498 R g 0.766 0.000 ( 0.000 5.455)
+ 499 A a 0.766 0.000 ( 0.000 5.455)
+ 500 K b 0.766 0.000 ( 0.000 5.455)
+ 501 L c 0.766 0.000 ( 0.000 5.455)
+ 502 E d 0.766 0.000 ( 0.000 5.455)
+ 503 P e 0.766 0.000 ( 0.000 5.455)
+ 504 R f 0.766 0.000 ( 0.000 5.455)
+ 505 D g 0.766 0.000 ( 0.000 5.455)
+ 506 I a 0.766 0.000 ( 0.000 5.455)
+ 507 S b 0.766 0.000 ( 0.000 5.455)
+ 508 V c 0.766 0.000 ( 0.000 5.455)
+ 509 V d 0.766 0.000 ( 0.000 5.455)
+ 510 E e 0.766 0.000 ( 0.000 5.455)
+ 511 A f 0.766 0.000 ( 0.000 5.455)
+ 512 H g 0.766 0.000 ( 0.000 5.455)
+ 513 G d 0.626 0.000 ( 0.000 3.484)
+ 514 T e 0.626 0.000 ( 0.000 3.484)
+ 515 G f 0.626 0.000 ( 0.000 3.484)
+ 516 T g 0.626 0.000 ( 0.000 3.484)
+ 517 P e 0.592 0.000 ( 0.000 2.857)
+ 518 V f 0.592 0.000 ( 0.000 2.857)
+ 519 G g 0.592 0.000 ( 0.000 2.857)
+ 520 D c 0.572 0.000 ( 0.000 2.489)
+ 521 P a 0.672 0.000 ( 0.000 4.310)
+ 522 A b 0.672 0.000 ( 0.000 4.310)
+ 523 E c 0.672 0.000 ( 0.000 4.310)
+ 524 Y a 0.733 0.000 ( 0.000 5.185)
+ 525 L b 0.733 0.000 ( 0.000 5.185)
+ 526 S c 0.733 0.000 ( 0.000 5.185)
+ 527 V d 0.733 0.000 ( 0.000 5.185)
+ 528 L a 0.789 0.000 ( 0.000 5.545)
+ 529 Q b 0.789 0.000 ( 0.000 5.545)
+ 530 A c 0.789 0.000 ( 0.000 5.545)
+ 531 L d 0.789 0.000 ( 0.000 5.545)
+ 532 G e 0.789 0.000 ( 0.000 5.545)
+ 533 G f 0.789 0.000 ( 0.000 5.545)
+ 534 S g 0.789 0.000 ( 0.000 5.545)
+ 535 L a 0.789 0.000 ( 0.000 5.545)
+ 536 R b 0.789 0.000 ( 0.000 5.545)
+ 537 D c 0.789 0.000 ( 0.000 5.545)
+ 538 K d 0.789 0.000 ( 0.000 5.545)
+ 539 P e 0.789 0.000 ( 0.000 5.545)
+ 540 L f 0.789 0.000 ( 0.000 5.545)
+ 541 A g 0.789 0.000 ( 0.000 5.545)
+ 542 L a 0.789 0.000 ( 0.000 5.545)
+ 543 G b 0.789 0.000 ( 0.000 5.545)
+ 544 S c 0.789 0.000 ( 0.000 5.545)
+ 545 V d 0.789 0.000 ( 0.000 5.545)
+ 546 K e 0.789 0.000 ( 0.000 5.545)
+ 547 G f 0.789 0.000 ( 0.000 5.545)
+ 548 L g 0.789 0.000 ( 0.000 5.545)
+ 549 I a 0.789 0.000 ( 0.000 5.545)
+ 550 G b 0.789 0.000 ( 0.000 5.545)
+ 551 H c 0.789 0.000 ( 0.000 5.545)
+ 552 T d 0.789 0.000 ( 0.000 5.545)
+ 553 E e 0.789 0.000 ( 0.000 5.545)
+ 554 G f 0.789 0.000 ( 0.000 5.545)
+ 555 A g 0.789 0.000 ( 0.000 5.545)
+ 556 S a 0.705 0.000 ( 0.000 4.835)
+ 557 G b 0.705 0.000 ( 0.000 4.835)
+ 558 V c 0.705 0.000 ( 0.000 4.835)
+ 559 V d 0.705 0.000 ( 0.000 4.835)
+ 560 S e 0.705 0.000 ( 0.000 4.835)
+ 561 L f 0.705 0.000 ( 0.000 4.835)
+ 562 I g 0.705 0.000 ( 0.000 4.835)
+ 563 K a 0.705 0.000 ( 0.000 4.835)
+ 564 I b 0.705 0.000 ( 0.000 4.835)
+ 565 I c 0.705 0.000 ( 0.000 4.835)
+ 566 L d 0.705 0.000 ( 0.000 4.835)
+ 567 M e 0.705 0.000 ( 0.000 4.835)
+ 568 M f 0.705 0.000 ( 0.000 4.835)
+ 569 Q g 0.705 0.000 ( 0.000 4.835)
+ 570 H e 0.672 0.000 ( 0.000 4.317)
+ 571 G f 0.672 0.000 ( 0.000 4.317)
+ 572 Y g 0.672 0.000 ( 0.000 4.317)
+ 573 V b 0.667 0.000 ( 0.000 4.235)
+ 574 P c 0.667 0.000 ( 0.000 4.235)
+ 575 P d 0.667 0.000 ( 0.000 4.235)
+ 576 Q a 0.675 0.000 ( 0.000 4.360)
+ 577 A b 0.675 0.000 ( 0.000 4.360)
+ 578 S c 0.675 0.000 ( 0.000 4.360)
+ 579 F a 0.899 0.000 ( 0.000 4.776)
+ 580 Q b 0.899 0.000 ( 0.000 4.776)
+ 581 S c 0.899 0.000 ( 0.000 4.776)
+ 582 L d 0.899 0.000 ( 0.000 4.776)
+ 583 A e 0.899 0.000 ( 0.000 4.776)
+ 584 H f 0.899 0.000 ( 0.000 4.776)
+ 585 N g 0.899 0.000 ( 0.000 4.776)
+ 586 I a 0.899 0.000 ( 0.000 4.776)
+ 587 A b 0.899 0.000 ( 0.000 4.776)
+ 588 A c 0.899 0.000 ( 0.000 4.776)
+ 589 S d 0.899 0.000 ( 0.000 4.776)
+ 590 P e 0.899 0.000 ( 0.000 4.776)
+ 591 S f 0.899 0.000 ( 0.000 4.776)
+ 592 D g 0.899 0.000 ( 0.000 4.776)
+ 593 K a 0.899 0.000 ( 0.000 4.776)
+ 594 I b 0.899 0.000 ( 0.000 4.776)
+ 595 E c 0.899 0.000 ( 0.000 4.776)
+ 596 I d 0.899 0.000 ( 0.000 4.776)
+ 597 V e 0.899 0.000 ( 0.000 4.776)
+ 598 T f 0.899 0.000 ( 0.000 4.776)
+ 599 K g 0.899 0.000 ( 0.000 4.776)
+ 600 L a 0.899 0.000 ( 0.000 4.776)
+ 601 R b 0.899 0.000 ( 0.000 4.776)
+ 602 S c 0.899 0.000 ( 0.000 4.776)
+ 603 W d 0.899 0.000 ( 0.000 4.776)
+ 604 D e 0.899 0.000 ( 0.000 4.776)
+ 605 A f 0.899 0.000 ( 0.000 4.776)
+ 606 D g 0.899 0.000 ( 0.000 4.776)
+ 607 Y a 0.894 0.000 ( 0.000 4.842)
+ 608 R b 0.894 0.000 ( 0.000 4.842)
+ 609 A c 0.894 0.000 ( 0.000 4.842)
+ 610 A d 0.894 0.000 ( 0.000 4.842)
+ 611 L e 0.894 0.000 ( 0.000 4.842)
+ 612 I f 0.894 0.000 ( 0.000 4.842)
+ 613 N g 0.894 0.000 ( 0.000 4.842)
+ 614 N a 0.880 0.000 ( 0.000 5.038)
+ 615 Y b 0.880 0.000 ( 0.000 5.038)
+ 616 G c 0.880 0.000 ( 0.000 5.038)
+ 617 A d 0.880 0.000 ( 0.000 5.038)
+ 618 S e 0.880 0.000 ( 0.000 5.038)
+ 619 G f 0.880 0.000 ( 0.000 5.038)
+ 620 S g 0.880 0.000 ( 0.000 5.038)
+ 621 N a 0.861 0.000 ( 0.000 5.249)
+ 622 A b 0.861 0.000 ( 0.000 5.249)
+ 623 S c 0.861 0.000 ( 0.000 5.249)
+ 624 M d 0.861 0.000 ( 0.000 5.249)
+ 625 V e 0.861 0.000 ( 0.000 5.249)
+ 626 V f 0.861 0.000 ( 0.000 5.249)
+ 627 T g 0.861 0.000 ( 0.000 5.249)
+ 628 P g 0.567 0.000 ( 0.000 2.399)
+ 629 P a 0.498 0.000 ( 0.000 1.361)
+ 630 P b 0.498 0.000 ( 0.000 1.361)
+ 631 Q c 0.498 0.000 ( 0.000 1.361)
+ 632 P d 0.498 0.000 ( 0.000 1.361)
+ 633 N a 0.501 0.000 ( 0.000 1.403)
+ 634 R b 0.501 0.000 ( 0.000 1.403)
+ 635 A c 0.501 0.000 ( 0.000 1.403)
+ 636 A d 0.501 0.000 ( 0.000 1.403)
+ 637 L e 0.501 0.000 ( 0.000 1.403)
+ 638 S f 0.501 0.000 ( 0.000 1.403)
+ 639 P g 0.501 0.000 ( 0.000 1.403)
+ 640 I a 0.534 0.000 ( 0.000 1.869)
+ 641 H b 0.534 0.000 ( 0.000 1.869)
+ 642 A c 0.534 0.000 ( 0.000 1.869)
+ 643 P d 0.534 0.000 ( 0.000 1.869)
+ 644 G e 0.534 0.000 ( 0.000 1.869)
+ 645 I a 0.625 0.000 ( 0.000 3.467)
+ 646 K b 0.625 0.000 ( 0.000 3.467)
+ 647 H c 0.625 0.000 ( 0.000 3.467)
+ 648 P d 0.625 0.000 ( 0.000 3.467)
+ 649 F e 0.625 0.000 ( 0.000 3.467)
+ 650 W f 0.625 0.000 ( 0.000 3.467)
+ 651 L g 0.625 0.000 ( 0.000 3.467)
+ 652 C a 0.748 0.000 ( 0.000 5.325)
+ 653 G b 0.748 0.000 ( 0.000 5.325)
+ 654 L c 0.748 0.000 ( 0.000 5.325)
+ 655 D d 0.748 0.000 ( 0.000 5.325)
+ 656 D e 0.748 0.000 ( 0.000 5.325)
+ 657 K f 0.748 0.000 ( 0.000 5.325)
+ 658 A g 0.748 0.000 ( 0.000 5.325)
+ 659 L a 0.787 0.000 ( 0.000 5.540)
+ 660 I b 0.787 0.000 ( 0.000 5.540)
+ 661 A c 0.787 0.000 ( 0.000 5.540)
+ 662 Y d 0.787 0.000 ( 0.000 5.540)
+ 663 S e 0.787 0.000 ( 0.000 5.540)
+ 664 K f 0.787 0.000 ( 0.000 5.540)
+ 665 R g 0.787 0.000 ( 0.000 5.540)
+ 666 L a 0.787 0.000 ( 0.000 5.540)
+ 667 R b 0.787 0.000 ( 0.000 5.540)
+ 668 H c 0.787 0.000 ( 0.000 5.540)
+ 669 F d 0.787 0.000 ( 0.000 5.540)
+ 670 I e 0.787 0.000 ( 0.000 5.540)
+ 671 A f 0.787 0.000 ( 0.000 5.540)
+ 672 H g 0.787 0.000 ( 0.000 5.540)
+ 673 K a 0.787 0.000 ( 0.000 5.540)
+ 674 T b 0.787 0.000 ( 0.000 5.540)
+ 675 S c 0.787 0.000 ( 0.000 5.540)
+ 676 S a 0.832 0.000 ( 0.000 5.467)
+ 677 Y b 0.832 0.000 ( 0.000 5.467)
+ 678 S c 0.832 0.000 ( 0.000 5.467)
+ 679 S d 0.832 0.000 ( 0.000 5.467)
+ 680 T e 0.832 0.000 ( 0.000 5.467)
+ 681 A f 0.832 0.000 ( 0.000 5.467)
+ 682 T g 0.832 0.000 ( 0.000 5.467)
+ 683 I a 0.856 0.000 ( 0.000 5.290)
+ 684 S b 0.856 0.000 ( 0.000 5.290)
+ 685 L c 0.856 0.000 ( 0.000 5.290)
+ 686 A d 0.856 0.000 ( 0.000 5.290)
+ 687 N e 0.856 0.000 ( 0.000 5.290)
+ 688 L f 0.856 0.000 ( 0.000 5.290)
+ 689 S g 0.856 0.000 ( 0.000 5.290)
+ 690 F a 0.979 0.000 ( 0.002 3.393)
+ 691 N b 0.979 0.000 ( 0.002 3.393)
+ 692 V c 0.979 0.000 ( 0.002 3.393)
+ 693 C d 0.979 0.000 ( 0.002 3.393)
+ 694 R e 0.979 0.000 ( 0.002 3.393)
+ 695 Q f 0.979 0.000 ( 0.002 3.393)
+ 696 S g 0.979 0.000 ( 0.002 3.393)
+ 697 N a 0.979 0.000 ( 0.002 3.393)
+ 698 R b 0.979 0.000 ( 0.002 3.393)
+ 699 H c 0.979 0.000 ( 0.002 3.393)
+ 700 L d 0.979 0.000 ( 0.002 3.393)
+ 701 D e 0.979 0.000 ( 0.002 3.393)
+ 702 R f 0.979 0.000 ( 0.002 3.393)
+ 703 A g 0.979 0.000 ( 0.002 3.393)
+ 704 L a 0.979 0.000 ( 0.002 3.393)
+ 705 M b 0.979 0.000 ( 0.002 3.393)
+ 706 F c 0.979 0.000 ( 0.002 3.393)
+ 707 S d 0.979 0.000 ( 0.002 3.393)
+ 708 C e 0.979 0.000 ( 0.002 3.393)
+ 709 S f 0.979 0.000 ( 0.002 3.393)
+ 710 S g 0.979 0.000 ( 0.002 3.393)
+ 711 L a 0.979 0.000 ( 0.002 3.393)
+ 712 G b 0.979 0.000 ( 0.002 3.393)
+ 713 E c 0.979 0.000 ( 0.002 3.393)
+ 714 L d 0.979 0.000 ( 0.002 3.393)
+ 715 D e 0.979 0.000 ( 0.002 3.393)
+ 716 E f 0.979 0.000 ( 0.002 3.393)
+ 717 K g 0.979 0.000 ( 0.002 3.393)
+ 718 L a 0.940 0.000 ( 0.001 4.106)
+ 719 A b 0.940 0.000 ( 0.001 4.106)
+ 720 L c 0.940 0.000 ( 0.001 4.106)
+ 721 F d 0.940 0.000 ( 0.001 4.106)
+ 722 I e 0.940 0.000 ( 0.001 4.106)
+ 723 D f 0.940 0.000 ( 0.001 4.106)
+ 724 G g 0.940 0.000 ( 0.001 4.106)
+ 725 D a 0.862 0.000 ( 0.000 5.235)
+ 726 A b 0.862 0.000 ( 0.000 5.235)
+ 727 K c 0.862 0.000 ( 0.000 5.235)
+ 728 L d 0.862 0.000 ( 0.000 5.235)
+ 729 G e 0.862 0.000 ( 0.000 5.235)
+ 730 S f 0.862 0.000 ( 0.000 5.235)
+ 731 T g 0.862 0.000 ( 0.000 5.235)
+ 732 S a 0.862 0.000 ( 0.000 5.235)
+ 733 T b 0.862 0.000 ( 0.000 5.235)
+ 734 K c 0.862 0.000 ( 0.000 5.235)
+ 735 T d 0.862 0.000 ( 0.000 5.235)
+ 736 I e 0.862 0.000 ( 0.000 5.235)
+ 737 T f 0.862 0.000 ( 0.000 5.235)
+ 738 K g 0.862 0.000 ( 0.000 5.235)
+ 739 R g 0.713 0.000 ( 0.000 4.940)
+ 740 R f 0.690 0.000 ( 0.000 4.611)
+ 741 P g 0.690 0.000 ( 0.000 4.611)
+ 742 V c 0.586 0.000 ( 0.000 2.736)
+ 743 I a 0.678 0.000 ( 0.000 4.415)
+ 744 M b 0.678 0.000 ( 0.000 4.415)
+ 745 C c 0.678 0.000 ( 0.000 4.415)
+ 746 F a 0.770 0.000 ( 0.000 5.478)
+ 747 G b 0.770 0.000 ( 0.000 5.478)
+ 748 G c 0.770 0.000 ( 0.000 5.478)
+ 749 Q d 0.770 0.000 ( 0.000 5.478)
+ 750 V a 0.797 0.000 ( 0.000 5.555)
+ 751 S b 0.797 0.000 ( 0.000 5.555)
+ 752 S c 0.797 0.000 ( 0.000 5.555)
+ 753 F a 0.839 0.000 ( 0.000 5.425)
+ 754 V b 0.839 0.000 ( 0.000 5.425)
+ 755 G c 0.839 0.000 ( 0.000 5.425)
+ 756 L d 0.839 0.000 ( 0.000 5.425)
+ 757 D e 0.839 0.000 ( 0.000 5.425)
+ 758 R f 0.839 0.000 ( 0.000 5.425)
+ 759 Q g 0.839 0.000 ( 0.000 5.425)
+ 760 V a 0.839 0.000 ( 0.000 5.425)
+ 761 Y b 0.839 0.000 ( 0.000 5.425)
+ 762 D c 0.839 0.000 ( 0.000 5.425)
+ 763 S d 0.839 0.000 ( 0.000 5.425)
+ 764 V e 0.839 0.000 ( 0.000 5.425)
+ 765 K f 0.839 0.000 ( 0.000 5.425)
+ 766 I g 0.839 0.000 ( 0.000 5.425)
+ 767 V a 0.839 0.000 ( 0.000 5.425)
+ 768 R b 0.839 0.000 ( 0.000 5.425)
+ 769 D c 0.839 0.000 ( 0.000 5.425)
+ 770 Y d 0.839 0.000 ( 0.000 5.425)
+ 771 L e 0.839 0.000 ( 0.000 5.425)
+ 772 D f 0.839 0.000 ( 0.000 5.425)
+ 773 Q g 0.839 0.000 ( 0.000 5.425)
+ 774 C a 0.839 0.000 ( 0.000 5.425)
+ 775 N b 0.839 0.000 ( 0.000 5.425)
+ 776 A c 0.839 0.000 ( 0.000 5.425)
+ 777 V d 0.839 0.000 ( 0.000 5.425)
+ 778 F e 0.839 0.000 ( 0.000 5.425)
+ 779 L f 0.839 0.000 ( 0.000 5.425)
+ 780 S g 0.839 0.000 ( 0.000 5.425)
+ 781 I d 0.793 0.000 ( 0.000 5.551)
+ 782 G e 0.793 0.000 ( 0.000 5.551)
+ 783 L f 0.793 0.000 ( 0.000 5.551)
+ 784 E g 0.793 0.000 ( 0.000 5.551)
+ 785 G e 0.648 0.000 ( 0.000 3.896)
+ 786 I f 0.648 0.000 ( 0.000 3.896)
+ 787 F g 0.648 0.000 ( 0.000 3.896)
+ 788 P a 0.648 0.000 ( 0.000 3.896)
+ 789 A b 0.648 0.000 ( 0.000 3.896)
+ 790 V c 0.648 0.000 ( 0.000 3.896)
+ 791 F d 0.648 0.000 ( 0.000 3.896)
+ 792 Q e 0.648 0.000 ( 0.000 3.896)
+ 793 R f 0.648 0.000 ( 0.000 3.896)
+ 794 E g 0.648 0.000 ( 0.000 3.896)
+ 795 P c 0.647 0.000 ( 0.000 3.863)
+ 796 I d 0.647 0.000 ( 0.000 3.863)
+ 797 E a 0.657 0.000 ( 0.000 4.049)
+ 798 D b 0.657 0.000 ( 0.000 4.049)
+ 799 P c 0.657 0.000 ( 0.000 4.049)
+ 800 V a 0.757 0.000 ( 0.000 5.398)
+ 801 R b 0.757 0.000 ( 0.000 5.398)
+ 802 L c 0.757 0.000 ( 0.000 5.398)
+ 803 Q d 0.757 0.000 ( 0.000 5.398)
+ 804 T e 0.757 0.000 ( 0.000 5.398)
+ 805 A f 0.757 0.000 ( 0.000 5.398)
+ 806 L g 0.757 0.000 ( 0.000 5.398)
+ 807 F a 0.757 0.000 ( 0.000 5.398)
+ 808 A b 0.757 0.000 ( 0.000 5.398)
+ 809 V c 0.757 0.000 ( 0.000 5.398)
+ 810 Q d 0.757 0.000 ( 0.000 5.398)
+ 811 Y e 0.757 0.000 ( 0.000 5.398)
+ 812 A f 0.757 0.000 ( 0.000 5.398)
+ 813 C g 0.757 0.000 ( 0.000 5.398)
+ 814 A a 0.767 0.000 ( 0.000 5.462)
+ 815 K b 0.767 0.000 ( 0.000 5.462)
+ 816 S c 0.767 0.000 ( 0.000 5.462)
+ 817 W d 0.767 0.000 ( 0.000 5.462)
+ 818 M e 0.767 0.000 ( 0.000 5.462)
+ 819 D f 0.767 0.000 ( 0.000 5.462)
+ 820 S g 0.767 0.000 ( 0.000 5.462)
+ 821 G a 0.767 0.000 ( 0.000 5.462)
+ 822 I b 0.767 0.000 ( 0.000 5.462)
+ 823 Q c 0.767 0.000 ( 0.000 5.462)
+ 824 A d 0.767 0.000 ( 0.000 5.462)
+ 825 E e 0.767 0.000 ( 0.000 5.462)
+ 826 A f 0.767 0.000 ( 0.000 5.462)
+ 827 V g 0.767 0.000 ( 0.000 5.462)
+ 828 V a 0.767 0.000 ( 0.000 5.462)
+ 829 G b 0.767 0.000 ( 0.000 5.462)
+ 830 H c 0.767 0.000 ( 0.000 5.462)
+ 831 S d 0.767 0.000 ( 0.000 5.462)
+ 832 F e 0.767 0.000 ( 0.000 5.462)
+ 833 G f 0.767 0.000 ( 0.000 5.462)
+ 834 E g 0.767 0.000 ( 0.000 5.462)
+ 835 L a 0.781 0.000 ( 0.000 5.523)
+ 836 T b 0.781 0.000 ( 0.000 5.523)
+ 837 A c 0.781 0.000 ( 0.000 5.523)
+ 838 L d 0.781 0.000 ( 0.000 5.523)
+ 839 C e 0.781 0.000 ( 0.000 5.523)
+ 840 V a 0.895 0.000 ( 0.000 4.827)
+ 841 S b 0.895 0.000 ( 0.000 4.827)
+ 842 G c 0.895 0.000 ( 0.000 4.827)
+ 843 V d 0.895 0.000 ( 0.000 4.827)
+ 844 L e 0.895 0.000 ( 0.000 4.827)
+ 845 S f 0.895 0.000 ( 0.000 4.827)
+ 846 L g 0.895 0.000 ( 0.000 4.827)
+ 847 L a 0.895 0.000 ( 0.000 4.827)
+ 848 D b 0.895 0.000 ( 0.000 4.827)
+ 849 A c 0.895 0.000 ( 0.000 4.827)
+ 850 S d 0.895 0.000 ( 0.000 4.827)
+ 851 K e 0.895 0.000 ( 0.000 4.827)
+ 852 M f 0.895 0.000 ( 0.000 4.827)
+ 853 I g 0.895 0.000 ( 0.000 4.827)
+ 854 V a 0.895 0.000 ( 0.000 4.827)
+ 855 A b 0.895 0.000 ( 0.000 4.827)
+ 856 R c 0.895 0.000 ( 0.000 4.827)
+ 857 A a 0.942 0.000 ( 0.001 4.071)
+ 858 K b 0.942 0.000 ( 0.001 4.071)
+ 859 L c 0.942 0.000 ( 0.001 4.071)
+ 860 V d 0.942 0.000 ( 0.001 4.071)
+ 861 R e 0.942 0.000 ( 0.001 4.071)
+ 862 D f 0.942 0.000 ( 0.001 4.071)
+ 863 T g 0.942 0.000 ( 0.001 4.071)
+ 864 W a 1.022 0.000 ( 0.006 2.604)
+ 865 G b 1.022 0.000 ( 0.006 2.604)
+ 866 S c 1.022 0.000 ( 0.006 2.604)
+ 867 D d 1.022 0.000 ( 0.006 2.604)
+ 868 R e 1.022 0.000 ( 0.006 2.604)
+ 869 G f 1.022 0.000 ( 0.006 2.604)
+ 870 A g 1.022 0.000 ( 0.006 2.604)
+ 871 M a 1.074 0.000 ( 0.016 1.740)
+ 872 A b 1.074 0.000 ( 0.016 1.740)
+ 873 A c 1.074 0.000 ( 0.016 1.740)
+ 874 V d 1.074 0.000 ( 0.016 1.740)
+ 875 E e 1.074 0.000 ( 0.016 1.740)
+ 876 A f 1.074 0.000 ( 0.016 1.740)
+ 877 D g 1.074 0.000 ( 0.016 1.740)
+ 878 L a 1.074 0.000 ( 0.016 1.740)
+ 879 D b 1.074 0.000 ( 0.016 1.740)
+ 880 M c 1.074 0.000 ( 0.016 1.740)
+ 881 V d 1.074 0.000 ( 0.016 1.740)
+ 882 R e 1.074 0.000 ( 0.016 1.740)
+ 883 S f 1.074 0.000 ( 0.016 1.740)
+ 884 A g 1.074 0.000 ( 0.016 1.740)
+ 885 I a 1.074 0.000 ( 0.016 1.740)
+ 886 E b 1.074 0.000 ( 0.016 1.740)
+ 887 S c 1.074 0.000 ( 0.016 1.740)
+ 888 H d 1.074 0.000 ( 0.016 1.740)
+ 889 N e 1.074 0.000 ( 0.016 1.740)
+ 890 R f 1.074 0.000 ( 0.016 1.740)
+ 891 A g 1.074 0.000 ( 0.016 1.740)
+ 892 M a 1.074 0.000 ( 0.016 1.740)
+ 893 V b 1.074 0.000 ( 0.016 1.740)
+ 894 D c 1.074 0.000 ( 0.016 1.740)
+ 895 D d 1.074 0.000 ( 0.016 1.740)
+ 896 E e 1.074 0.000 ( 0.016 1.740)
+ 897 L f 1.074 0.000 ( 0.016 1.740)
+ 898 P g 1.074 0.000 ( 0.016 1.740)
+ 899 V a 0.836 0.000 ( 0.000 5.448)
+ 900 T b 0.836 0.000 ( 0.000 5.448)
+ 901 I c 0.836 0.000 ( 0.000 5.448)
+ 902 A d 0.836 0.000 ( 0.000 5.448)
+ 903 C e 0.836 0.000 ( 0.000 5.448)
+ 904 Y f 0.836 0.000 ( 0.000 5.448)
+ 905 N g 0.836 0.000 ( 0.000 5.448)
+ 906 G a 0.602 0.000 ( 0.000 3.034)
+ 907 P b 0.602 0.000 ( 0.000 3.034)
+ 908 R c 0.602 0.000 ( 0.000 3.034)
+ 909 S d 0.602 0.000 ( 0.000 3.034)
+ 910 F e 0.602 0.000 ( 0.000 3.034)
+ 911 T f 0.602 0.000 ( 0.000 3.034)
+ 912 L g 0.602 0.000 ( 0.000 3.034)
+ 913 A b 0.557 0.000 ( 0.000 2.240)
+ 914 G c 0.557 0.000 ( 0.000 2.240)
+ 915 P d 0.557 0.000 ( 0.000 2.240)
+ 916 T e 0.557 0.000 ( 0.000 2.240)
+ 917 K f 0.557 0.000 ( 0.000 2.240)
+ 918 S g 0.557 0.000 ( 0.000 2.240)
+ 919 M a 0.630 0.000 ( 0.000 3.561)
+ 920 D b 0.630 0.000 ( 0.000 3.561)
+ 921 K c 0.630 0.000 ( 0.000 3.561)
+ 922 F d 0.630 0.000 ( 0.000 3.561)
+ 923 V e 0.630 0.000 ( 0.000 3.561)
+ 924 E f 0.630 0.000 ( 0.000 3.561)
+ 925 T g 0.630 0.000 ( 0.000 3.561)
+ 926 L a 0.630 0.000 ( 0.000 3.561)
+ 927 T b 0.630 0.000 ( 0.000 3.561)
+ 928 G c 0.630 0.000 ( 0.000 3.561)
+ 929 S d 0.630 0.000 ( 0.000 3.561)
+ 930 P e 0.630 0.000 ( 0.000 3.561)
+ 931 M a 0.709 0.000 ( 0.000 4.886)
+ 932 Y b 0.709 0.000 ( 0.000 4.886)
+ 933 S c 0.709 0.000 ( 0.000 4.886)
+ 934 P d 0.709 0.000 ( 0.000 4.886)
+ 935 V a 0.728 0.000 ( 0.000 5.131)
+ 936 M b 0.728 0.000 ( 0.000 5.131)
+ 937 R c 0.728 0.000 ( 0.000 5.131)
+ 938 V a 0.979 0.000 ( 0.002 3.392)
+ 939 K b 0.979 0.000 ( 0.002 3.392)
+ 940 R c 0.979 0.000 ( 0.002 3.392)
+ 941 L d 0.979 0.000 ( 0.002 3.392)
+ 942 N e 0.979 0.000 ( 0.002 3.392)
+ 943 V f 0.979 0.000 ( 0.002 3.392)
+ 944 T g 0.979 0.000 ( 0.002 3.392)
+ 945 H a 0.979 0.000 ( 0.002 3.392)
+ 946 A b 0.979 0.000 ( 0.002 3.392)
+ 947 F c 0.979 0.000 ( 0.002 3.392)
+ 948 H d 0.979 0.000 ( 0.002 3.392)
+ 949 S e 0.979 0.000 ( 0.002 3.392)
+ 950 V f 0.979 0.000 ( 0.002 3.392)
+ 951 L g 0.979 0.000 ( 0.002 3.392)
+ 952 V a 0.979 0.000 ( 0.002 3.392)
+ 953 E b 0.979 0.000 ( 0.002 3.392)
+ 954 P c 0.979 0.000 ( 0.002 3.392)
+ 955 L d 0.979 0.000 ( 0.002 3.392)
+ 956 I e 0.979 0.000 ( 0.002 3.392)
+ 957 D f 0.979 0.000 ( 0.002 3.392)
+ 958 E g 0.979 0.000 ( 0.002 3.392)
+ 959 L a 0.979 0.000 ( 0.002 3.392)
+ 960 D b 0.979 0.000 ( 0.002 3.392)
+ 961 A c 0.979 0.000 ( 0.002 3.392)
+ 962 I d 0.979 0.000 ( 0.002 3.392)
+ 963 G e 0.979 0.000 ( 0.002 3.392)
+ 964 R f 0.979 0.000 ( 0.002 3.392)
+ 965 T g 0.979 0.000 ( 0.002 3.392)
+ 966 L d 0.876 0.000 ( 0.000 5.086)
+ 967 T e 0.876 0.000 ( 0.000 5.086)
+ 968 F f 0.876 0.000 ( 0.000 5.086)
+ 969 R g 0.876 0.000 ( 0.000 5.086)
+ 970 E a 0.940 0.000 ( 0.001 4.104)
+ 971 P b 0.940 0.000 ( 0.001 4.104)
+ 972 S c 0.940 0.000 ( 0.001 4.104)
+ 973 I d 0.940 0.000 ( 0.001 4.104)
+ 974 L e 0.940 0.000 ( 0.001 4.104)
+ 975 L f 0.940 0.000 ( 0.001 4.104)
+ 976 E g 0.940 0.000 ( 0.001 4.104)
+ 977 R a 0.940 0.000 ( 0.001 4.104)
+ 978 S b 0.940 0.000 ( 0.001 4.104)
+ 979 T c 0.940 0.000 ( 0.001 4.104)
+ 980 K d 0.940 0.000 ( 0.001 4.104)
+ 981 E e 0.940 0.000 ( 0.001 4.104)
+ 982 L f 0.940 0.000 ( 0.001 4.104)
+ 983 N g 0.940 0.000 ( 0.001 4.104)
+ 984 L a 0.971 0.000 ( 0.002 3.536)
+ 985 E b 0.971 0.000 ( 0.002 3.536)
+ 986 T c 0.971 0.000 ( 0.002 3.536)
+ 987 T d 0.971 0.000 ( 0.002 3.536)
+ 988 S e 0.971 0.000 ( 0.002 3.536)
+ 989 E f 0.971 0.000 ( 0.002 3.536)
+ 990 F g 0.971 0.000 ( 0.002 3.536)
+ 991 V a 0.971 0.000 ( 0.002 3.536)
+ 992 A b 0.971 0.000 ( 0.002 3.536)
+ 993 Q c 0.971 0.000 ( 0.002 3.536)
+ 994 H d 0.971 0.000 ( 0.002 3.536)
+ 995 M e 0.971 0.000 ( 0.002 3.536)
+ 996 R f 0.971 0.000 ( 0.002 3.536)
+ 997 Q g 0.971 0.000 ( 0.002 3.536)
+ 998 P a 0.971 0.000 ( 0.002 3.536)
+ 999 V b 0.971 0.000 ( 0.002 3.536)
+1000 F c 0.971 0.000 ( 0.002 3.536)
+1001 F d 0.971 0.000 ( 0.002 3.536)
+1002 E e 0.971 0.000 ( 0.002 3.536)
+1003 H f 0.971 0.000 ( 0.002 3.536)
+1004 A g 0.971 0.000 ( 0.002 3.536)
+1005 V a 0.971 0.000 ( 0.002 3.536)
+1006 K b 0.971 0.000 ( 0.002 3.536)
+1007 R c 0.971 0.000 ( 0.002 3.536)
+1008 L d 0.971 0.000 ( 0.002 3.536)
+1009 A e 0.971 0.000 ( 0.002 3.536)
+1010 E f 0.971 0.000 ( 0.002 3.536)
+1011 Q g 0.971 0.000 ( 0.002 3.536)
+1012 Y a 0.894 0.000 ( 0.000 4.842)
+1013 P b 0.894 0.000 ( 0.000 4.842)
+1014 D c 0.894 0.000 ( 0.000 4.842)
+1015 A d 0.894 0.000 ( 0.000 4.842)
+1016 A e 0.894 0.000 ( 0.000 4.842)
+1017 W f 0.894 0.000 ( 0.000 4.842)
+1018 I g 0.894 0.000 ( 0.000 4.842)
+1019 E a 0.894 0.000 ( 0.000 4.842)
+1020 A b 0.894 0.000 ( 0.000 4.842)
+1021 G c 0.894 0.000 ( 0.000 4.842)
+1022 S d 0.894 0.000 ( 0.000 4.842)
+1023 A e 0.894 0.000 ( 0.000 4.842)
+1024 S f 0.894 0.000 ( 0.000 4.842)
+1025 T g 0.894 0.000 ( 0.000 4.842)
+1026 I a 0.894 0.000 ( 0.000 4.842)
+1027 T b 0.894 0.000 ( 0.000 4.842)
+1028 N c 0.894 0.000 ( 0.000 4.842)
+1029 M d 0.894 0.000 ( 0.000 4.842)
+1030 A e 0.894 0.000 ( 0.000 4.842)
+1031 S f 0.894 0.000 ( 0.000 4.842)
+1032 R g 0.894 0.000 ( 0.000 4.842)
+1033 A d 0.725 0.000 ( 0.000 5.091)
+1034 L e 0.725 0.000 ( 0.000 5.091)
+1035 G f 0.725 0.000 ( 0.000 5.091)
+1036 S g 0.725 0.000 ( 0.000 5.091)
+1037 P c 0.680 0.000 ( 0.000 4.441)
+1038 S d 0.680 0.000 ( 0.000 4.441)
+1039 T e 0.680 0.000 ( 0.000 4.441)
+1040 Y a 0.742 0.000 ( 0.000 5.275)
+1041 H b 0.742 0.000 ( 0.000 5.275)
+1042 F a 0.936 0.000 ( 0.001 4.182)
+1043 Q b 0.936 0.000 ( 0.001 4.182)
+1044 S c 0.936 0.000 ( 0.001 4.182)
+1045 L d 0.936 0.000 ( 0.001 4.182)
+1046 N e 0.936 0.000 ( 0.001 4.182)
+1047 I f 0.936 0.000 ( 0.001 4.182)
+1048 T g 0.936 0.000 ( 0.001 4.182)
+1049 C a 0.936 0.000 ( 0.001 4.182)
+1050 D b 0.936 0.000 ( 0.001 4.182)
+1051 H c 0.936 0.000 ( 0.001 4.182)
+1052 G d 0.936 0.000 ( 0.001 4.182)
+1053 M e 0.936 0.000 ( 0.001 4.182)
+1054 K f 0.936 0.000 ( 0.001 4.182)
+1055 S g 0.936 0.000 ( 0.001 4.182)
+1056 L a 0.936 0.000 ( 0.001 4.182)
+1057 A b 0.936 0.000 ( 0.001 4.182)
+1058 D c 0.936 0.000 ( 0.001 4.182)
+1059 A d 0.936 0.000 ( 0.001 4.182)
+1060 T e 0.936 0.000 ( 0.001 4.182)
+1061 L f 0.936 0.000 ( 0.001 4.182)
+1062 A g 0.936 0.000 ( 0.001 4.182)
+1063 L a 0.936 0.000 ( 0.001 4.182)
+1064 W b 0.936 0.000 ( 0.001 4.182)
+1065 K c 0.936 0.000 ( 0.001 4.182)
+1066 A d 0.936 0.000 ( 0.001 4.182)
+1067 G e 0.936 0.000 ( 0.001 4.182)
+1068 V f 0.936 0.000 ( 0.001 4.182)
+1069 E g 0.936 0.000 ( 0.001 4.182)
+1070 T a 0.632 0.000 ( 0.000 3.587)
+1071 A b 0.632 0.000 ( 0.000 3.587)
+1072 Y c 0.632 0.000 ( 0.000 3.587)
+1073 W d 0.632 0.000 ( 0.000 3.587)
+1074 P e 0.632 0.000 ( 0.000 3.587)
+1075 H f 0.632 0.000 ( 0.000 3.587)
+1076 H g 0.632 0.000 ( 0.000 3.587)
+1077 P c 0.537 0.000 ( 0.000 1.916)
+1078 G d 0.537 0.000 ( 0.000 1.916)
+1079 Q e 0.537 0.000 ( 0.000 1.916)
+1080 T f 0.537 0.000 ( 0.000 1.916)
+1081 Y g 0.537 0.000 ( 0.000 1.916)
+1082 E b 0.487 0.000 ( 0.000 1.231)
+1083 F c 0.487 0.000 ( 0.000 1.231)
+1084 D d 0.487 0.000 ( 0.000 1.231)
+1085 H e 0.487 0.000 ( 0.000 1.231)
+1086 L f 0.487 0.000 ( 0.000 1.231)
+1087 F g 0.487 0.000 ( 0.000 1.231)
+1088 L a 0.575 0.000 ( 0.000 2.538)
+1089 P b 0.575 0.000 ( 0.000 2.538)
+1090 P c 0.575 0.000 ( 0.000 2.538)
+1091 Y a 0.649 0.000 ( 0.000 3.904)
+1092 Q b 0.649 0.000 ( 0.000 3.904)
+1093 F c 0.649 0.000 ( 0.000 3.904)
+1094 E d 0.649 0.000 ( 0.000 3.904)
+1095 K e 0.649 0.000 ( 0.000 3.904)
+1096 V a 0.803 0.000 ( 0.000 5.555)
+1097 K b 0.803 0.000 ( 0.000 5.555)
+1098 H c 0.803 0.000 ( 0.000 5.555)
+1099 W d 0.803 0.000 ( 0.000 5.555)
+1100 M e 0.803 0.000 ( 0.000 5.555)
+1101 D f 0.803 0.000 ( 0.000 5.555)
+1102 L g 0.803 0.000 ( 0.000 5.555)
+1103 K a 0.803 0.000 ( 0.000 5.555)
+1104 K b 0.803 0.000 ( 0.000 5.555)
+1105 P c 0.803 0.000 ( 0.000 5.555)
+1106 Q d 0.803 0.000 ( 0.000 5.555)
+1107 K e 0.803 0.000 ( 0.000 5.555)
+1108 G f 0.803 0.000 ( 0.000 5.555)
+1109 L g 0.803 0.000 ( 0.000 5.555)
+1110 V a 0.803 0.000 ( 0.000 5.555)
+1111 E b 0.803 0.000 ( 0.000 5.555)
+1112 L c 0.803 0.000 ( 0.000 5.555)
+1113 P d 0.803 0.000 ( 0.000 5.555)
+1114 A e 0.803 0.000 ( 0.000 5.555)
+1115 A f 0.803 0.000 ( 0.000 5.555)
+1116 E g 0.803 0.000 ( 0.000 5.555)
+1117 A a 0.803 0.000 ( 0.000 5.555)
+1118 G b 0.803 0.000 ( 0.000 5.555)
+1119 N c 0.803 0.000 ( 0.000 5.555)
+1120 V d 0.803 0.000 ( 0.000 5.555)
+1121 E e 0.803 0.000 ( 0.000 5.555)
+1122 A f 0.803 0.000 ( 0.000 5.555)
+1123 R g 0.803 0.000 ( 0.000 5.555)
+1124 V a 0.670 0.000 ( 0.000 4.279)
+1125 P b 0.670 0.000 ( 0.000 4.279)
+1126 V c 0.670 0.000 ( 0.000 4.279)
+1127 G d 0.670 0.000 ( 0.000 4.279)
+1128 L e 0.670 0.000 ( 0.000 4.279)
+1129 W f 0.670 0.000 ( 0.000 4.279)
+1130 S g 0.670 0.000 ( 0.000 4.279)
+1131 F a 0.670 0.000 ( 0.000 4.279)
+1132 L b 0.670 0.000 ( 0.000 4.279)
+1133 G c 0.670 0.000 ( 0.000 4.279)
+1134 Y d 0.670 0.000 ( 0.000 4.279)
+1135 D e 0.670 0.000 ( 0.000 4.279)
+1136 D f 0.670 0.000 ( 0.000 4.279)
+1137 S a 0.687 0.000 ( 0.000 4.561)
+1138 K b 0.687 0.000 ( 0.000 4.561)
+1139 E a 0.720 0.000 ( 0.000 5.037)
+1140 Q b 0.720 0.000 ( 0.000 5.037)
+1141 T c 0.720 0.000 ( 0.000 5.037)
+1142 A d 0.720 0.000 ( 0.000 5.037)
+1143 R e 0.720 0.000 ( 0.000 5.037)
+1144 F f 0.720 0.000 ( 0.000 5.037)
+1145 V g 0.720 0.000 ( 0.000 5.037)
+1146 V a 0.720 0.000 ( 0.000 5.037)
+1147 N b 0.720 0.000 ( 0.000 5.037)
+1148 T c 0.720 0.000 ( 0.000 5.037)
+1149 D d 0.720 0.000 ( 0.000 5.037)
+1150 S e 0.720 0.000 ( 0.000 5.037)
+1151 K f 0.720 0.000 ( 0.000 5.037)
+1152 K g 0.720 0.000 ( 0.000 5.037)
+1153 Y a 0.720 0.000 ( 0.000 5.037)
+1154 H b 0.720 0.000 ( 0.000 5.037)
+1155 D c 0.720 0.000 ( 0.000 5.037)
+1156 F d 0.720 0.000 ( 0.000 5.037)
+1157 V e 0.720 0.000 ( 0.000 5.037)
+1158 S f 0.720 0.000 ( 0.000 5.037)
+1159 G g 0.720 0.000 ( 0.000 5.037)
+1160 H a 0.720 0.000 ( 0.000 5.037)
+1161 L b 0.720 0.000 ( 0.000 5.037)
+1162 I c 0.720 0.000 ( 0.000 5.037)
+1163 A d 0.720 0.000 ( 0.000 5.037)
+1164 N e 0.720 0.000 ( 0.000 5.037)
+1165 T f 0.720 0.000 ( 0.000 5.037)
+1166 A g 0.720 0.000 ( 0.000 5.037)
+1167 P c 0.597 0.000 ( 0.000 2.942)
+1168 I a 0.628 0.000 ( 0.000 3.517)
+1169 C b 0.628 0.000 ( 0.000 3.517)
+1170 P c 0.628 0.000 ( 0.000 3.517)
+1171 A d 0.628 0.000 ( 0.000 3.517)
+1172 T a 0.734 0.000 ( 0.000 5.195)
+1173 L b 0.734 0.000 ( 0.000 5.195)
+1174 E c 0.734 0.000 ( 0.000 5.195)
+1175 V d 0.734 0.000 ( 0.000 5.195)
+1176 D e 0.734 0.000 ( 0.000 5.195)
+1177 M f 0.734 0.000 ( 0.000 5.195)
+1178 A g 0.734 0.000 ( 0.000 5.195)
+1179 I a 0.734 0.000 ( 0.000 5.195)
+1180 E b 0.734 0.000 ( 0.000 5.195)
+1181 A c 0.734 0.000 ( 0.000 5.195)
+1182 L d 0.734 0.000 ( 0.000 5.195)
+1183 M e 0.734 0.000 ( 0.000 5.195)
+1184 S f 0.734 0.000 ( 0.000 5.195)
+1185 I g 0.734 0.000 ( 0.000 5.195)
+1186 R a 0.734 0.000 ( 0.000 5.195)
+1187 P b 0.734 0.000 ( 0.000 5.195)
+1188 D c 0.734 0.000 ( 0.000 5.195)
+1189 L d 0.734 0.000 ( 0.000 5.195)
+1190 K e 0.734 0.000 ( 0.000 5.195)
+1191 T f 0.734 0.000 ( 0.000 5.195)
+1192 D g 0.734 0.000 ( 0.000 5.195)
+1193 G a 0.734 0.000 ( 0.000 5.195)
+1194 M b 0.734 0.000 ( 0.000 5.195)
+1195 Q c 0.734 0.000 ( 0.000 5.195)
+1196 P d 0.734 0.000 ( 0.000 5.195)
+1197 T e 0.734 0.000 ( 0.000 5.195)
+1198 I f 0.734 0.000 ( 0.000 5.195)
+1199 Q g 0.734 0.000 ( 0.000 5.195)
+1200 N c 0.677 0.000 ( 0.000 4.401)
+1201 L d 0.677 0.000 ( 0.000 4.401)
+1202 Q e 0.677 0.000 ( 0.000 4.401)
+1203 N f 0.677 0.000 ( 0.000 4.401)
+1204 H g 0.677 0.000 ( 0.000 4.401)
+1205 S a 0.654 0.000 ( 0.000 4.007)
+1206 P b 0.654 0.000 ( 0.000 4.007)
+1207 I c 0.654 0.000 ( 0.000 4.007)
+1208 C d 0.654 0.000 ( 0.000 4.007)
+1209 V e 0.654 0.000 ( 0.000 4.007)
+1210 D f 0.654 0.000 ( 0.000 4.007)
+1211 P g 0.654 0.000 ( 0.000 4.007)
+1212 S a 0.654 0.000 ( 0.000 4.007)
+1213 R b 0.654 0.000 ( 0.000 4.007)
+1214 Q c 0.654 0.000 ( 0.000 4.007)
+1215 V d 0.654 0.000 ( 0.000 4.007)
+1216 F e 0.654 0.000 ( 0.000 4.007)
+1217 I f 0.654 0.000 ( 0.000 4.007)
+1218 V g 0.654 0.000 ( 0.000 4.007)
+1219 Y a 0.654 0.000 ( 0.000 4.007)
+1220 T b 0.654 0.000 ( 0.000 4.007)
+1221 A c 0.654 0.000 ( 0.000 4.007)
+1222 S d 0.654 0.000 ( 0.000 4.007)
+1223 D e 0.654 0.000 ( 0.000 4.007)
+1224 I f 0.654 0.000 ( 0.000 4.007)
+1225 R g 0.654 0.000 ( 0.000 4.007)
+1226 G a 0.607 0.000 ( 0.000 3.134)
+1227 H b 0.607 0.000 ( 0.000 3.134)
+1228 V c 0.607 0.000 ( 0.000 3.134)
+1229 W d 0.607 0.000 ( 0.000 3.134)
+1230 E e 0.607 0.000 ( 0.000 3.134)
+1231 W f 0.607 0.000 ( 0.000 3.134)
+1232 K g 0.607 0.000 ( 0.000 3.134)
+1233 M a 0.607 0.000 ( 0.000 3.134)
+1234 T b 0.607 0.000 ( 0.000 3.134)
+1235 S c 0.607 0.000 ( 0.000 3.134)
+1236 S d 0.607 0.000 ( 0.000 3.134)
+1237 P e 0.607 0.000 ( 0.000 3.134)
+1238 A f 0.607 0.000 ( 0.000 3.134)
+1239 Q g 0.607 0.000 ( 0.000 3.134)
+1240 G f 0.528 0.000 ( 0.000 1.777)
+1241 P g 0.528 0.000 ( 0.000 1.777)
+1242 G a 0.528 0.000 ( 0.000 1.777)
+1243 P b 0.528 0.000 ( 0.000 1.777)
+1244 T c 0.528 0.000 ( 0.000 1.777)
+1245 T a 0.534 0.000 ( 0.000 1.871)
+1246 E b 0.534 0.000 ( 0.000 1.871)
+1247 H c 0.534 0.000 ( 0.000 1.871)
+1248 V d 0.534 0.000 ( 0.000 1.871)
+1249 H e 0.534 0.000 ( 0.000 1.871)
+1250 G f 0.534 0.000 ( 0.000 1.871)
+1251 S g 0.534 0.000 ( 0.000 1.871)
+1252 I a 0.553 0.000 ( 0.000 2.162)
+1253 V b 0.553 0.000 ( 0.000 2.162)
+1254 F c 0.553 0.000 ( 0.000 2.162)
+1255 R d 0.553 0.000 ( 0.000 2.162)
+1256 S e 0.553 0.000 ( 0.000 2.162)
+1257 P f 0.553 0.000 ( 0.000 2.162)
+1258 E g 0.553 0.000 ( 0.000 2.162)
+1259 D a 0.572 0.000 ( 0.000 2.499)
+1260 P b 0.572 0.000 ( 0.000 2.499)
+1261 G a 0.613 0.000 ( 0.000 3.240)
+1262 Y a 0.727 0.000 ( 0.000 5.112)
+1263 Q b 0.727 0.000 ( 0.000 5.112)
+1264 A c 0.727 0.000 ( 0.000 5.112)
+1265 E d 0.727 0.000 ( 0.000 5.112)
+1266 F e 0.727 0.000 ( 0.000 5.112)
+1267 G f 0.727 0.000 ( 0.000 5.112)
+1268 R g 0.727 0.000 ( 0.000 5.112)
+1269 Y a 0.727 0.000 ( 0.000 5.112)
+1270 G b 0.727 0.000 ( 0.000 5.112)
+1271 R c 0.727 0.000 ( 0.000 5.112)
+1272 H a 0.742 0.000 ( 0.000 5.271)
+1273 F b 0.742 0.000 ( 0.000 5.271)
+1274 T c 0.742 0.000 ( 0.000 5.271)
+1275 H a 0.825 0.000 ( 0.000 5.501)
+1276 Q b 0.825 0.000 ( 0.000 5.501)
+1277 R c 0.825 0.000 ( 0.000 5.501)
+1278 C d 0.825 0.000 ( 0.000 5.501)
+1279 L e 0.825 0.000 ( 0.000 5.501)
+1280 D f 0.825 0.000 ( 0.000 5.501)
+1281 V g 0.825 0.000 ( 0.000 5.501)
+1282 L a 0.897 0.000 ( 0.000 4.810)
+1283 N b 0.897 0.000 ( 0.000 4.810)
+1284 A c 0.897 0.000 ( 0.000 4.810)
+1285 V d 0.897 0.000 ( 0.000 4.810)
+1286 E e 0.897 0.000 ( 0.000 4.810)
+1287 A f 0.897 0.000 ( 0.000 4.810)
+1288 D g 0.897 0.000 ( 0.000 4.810)
+1289 D a 0.897 0.000 ( 0.000 4.810)
+1290 I b 0.897 0.000 ( 0.000 4.810)
+1291 I c 0.897 0.000 ( 0.000 4.810)
+1292 Q d 0.897 0.000 ( 0.000 4.810)
+1293 G e 0.897 0.000 ( 0.000 4.810)
+1294 R f 0.897 0.000 ( 0.000 4.810)
+1295 N g 0.897 0.000 ( 0.000 4.810)
+1296 I a 0.897 0.000 ( 0.000 4.810)
+1297 Y b 0.897 0.000 ( 0.000 4.810)
+1298 K c 0.897 0.000 ( 0.000 4.810)
+1299 T d 0.897 0.000 ( 0.000 4.810)
+1300 F e 0.897 0.000 ( 0.000 4.810)
+1301 A f 0.897 0.000 ( 0.000 4.810)
+1302 E g 0.897 0.000 ( 0.000 4.810)
+1303 I a 0.951 0.000 ( 0.001 3.914)
+1304 V b 0.951 0.000 ( 0.001 3.914)
+1305 D c 0.951 0.000 ( 0.001 3.914)
+1306 Y d 0.951 0.000 ( 0.001 3.914)
+1307 G e 0.951 0.000 ( 0.001 3.914)
+1308 E f 0.951 0.000 ( 0.001 3.914)
+1309 Q g 0.951 0.000 ( 0.001 3.914)
+1310 Y a 0.951 0.000 ( 0.001 3.914)
+1311 R b 0.951 0.000 ( 0.001 3.914)
+1312 G c 0.951 0.000 ( 0.001 3.914)
+1313 L d 0.951 0.000 ( 0.001 3.914)
+1314 K e 0.951 0.000 ( 0.001 3.914)
+1315 R f 0.951 0.000 ( 0.001 3.914)
+1316 L g 0.951 0.000 ( 0.001 3.914)
+1317 V a 0.951 0.000 ( 0.001 3.914)
+1318 G b 0.951 0.000 ( 0.001 3.914)
+1319 R c 0.951 0.000 ( 0.001 3.914)
+1320 G d 0.951 0.000 ( 0.001 3.914)
+1321 S e 0.951 0.000 ( 0.001 3.914)
+1322 E f 0.951 0.000 ( 0.001 3.914)
+1323 C g 0.951 0.000 ( 0.001 3.914)
+1324 A a 0.951 0.000 ( 0.001 3.914)
+1325 G b 0.951 0.000 ( 0.001 3.914)
+1326 R c 0.951 0.000 ( 0.001 3.914)
+1327 V d 0.951 0.000 ( 0.001 3.914)
+1328 S e 0.951 0.000 ( 0.001 3.914)
+1329 K f 0.951 0.000 ( 0.001 3.914)
+1330 R g 0.951 0.000 ( 0.001 3.914)
+1331 W d 0.782 0.000 ( 0.000 5.527)
+1332 T e 0.782 0.000 ( 0.000 5.527)
+1333 G f 0.782 0.000 ( 0.000 5.527)
+1334 E g 0.782 0.000 ( 0.000 5.527)
+1335 T e 0.705 0.000 ( 0.000 4.828)
+1336 W f 0.705 0.000 ( 0.000 4.828)
+1337 L g 0.705 0.000 ( 0.000 4.828)
+1338 D d 0.637 0.000 ( 0.000 3.691)
+1339 T e 0.637 0.000 ( 0.000 3.691)
+1340 H f 0.637 0.000 ( 0.000 3.691)
+1341 L g 0.637 0.000 ( 0.000 3.691)
+1342 S a 0.637 0.000 ( 0.000 3.691)
+1343 D b 0.637 0.000 ( 0.000 3.691)
+1344 C c 0.637 0.000 ( 0.000 3.691)
+1345 F d 0.637 0.000 ( 0.000 3.691)
+1346 S e 0.637 0.000 ( 0.000 3.691)
+1347 Q f 0.637 0.000 ( 0.000 3.691)
+1348 V g 0.637 0.000 ( 0.000 3.691)
+1349 G e 0.554 0.000 ( 0.000 2.187)
+1350 G f 0.554 0.000 ( 0.000 2.187)
+1351 I g 0.554 0.000 ( 0.000 2.187)
+1352 W g 0.534 0.000 ( 0.000 1.858)
+1353 V a 0.686 0.000 ( 0.000 4.539)
+1354 N b 0.686 0.000 ( 0.000 4.539)
+1355 C c 0.686 0.000 ( 0.000 4.539)
+1356 M d 0.686 0.000 ( 0.000 4.539)
+1357 T e 0.686 0.000 ( 0.000 4.539)
+1358 N f 0.686 0.000 ( 0.000 4.539)
+1359 R g 0.686 0.000 ( 0.000 4.539)
+1360 A a 0.686 0.000 ( 0.000 4.539)
+1361 P b 0.686 0.000 ( 0.000 4.539)
+1362 D c 0.686 0.000 ( 0.000 4.539)
+1363 D d 0.686 0.000 ( 0.000 4.539)
+1364 M e 0.686 0.000 ( 0.000 4.539)
+1365 Y f 0.686 0.000 ( 0.000 4.539)
+1366 I g 0.686 0.000 ( 0.000 4.539)
+1367 A a 0.686 0.000 ( 0.000 4.539)
+1368 S b 0.686 0.000 ( 0.000 4.539)
+1369 G c 0.686 0.000 ( 0.000 4.539)
+1370 C d 0.686 0.000 ( 0.000 4.539)
+1371 E e 0.686 0.000 ( 0.000 4.539)
+1372 L f 0.686 0.000 ( 0.000 4.539)
+1373 V g 0.686 0.000 ( 0.000 4.539)
+1374 I a 0.686 0.000 ( 0.000 4.539)
+1375 R b 0.686 0.000 ( 0.000 4.539)
+1376 S c 0.686 0.000 ( 0.000 4.539)
+1377 P d 0.686 0.000 ( 0.000 4.539)
+1378 N e 0.686 0.000 ( 0.000 4.539)
+1379 L f 0.686 0.000 ( 0.000 4.539)
+1380 R g 0.686 0.000 ( 0.000 4.539)
+1381 P a 0.471 0.000 ( 0.000 1.045)
+1382 D b 0.471 0.000 ( 0.000 1.045)
+1383 G c 0.471 0.000 ( 0.000 1.045)
+1384 P d 0.471 0.000 ( 0.000 1.045)
+1385 R a 0.521 0.000 ( 0.000 1.667)
+1386 P b 0.521 0.000 ( 0.000 1.667)
+1387 E c 0.521 0.000 ( 0.000 1.667)
+1388 I a 0.530 0.000 ( 0.000 1.806)
+1389 W a 0.592 0.000 ( 0.000 2.841)
+1390 D b 0.592 0.000 ( 0.000 2.841)
+1391 V c 0.592 0.000 ( 0.000 2.841)
+1392 F d 0.592 0.000 ( 0.000 2.841)
+1393 A a 0.676 0.000 ( 0.000 4.379)
+1394 T b 0.676 0.000 ( 0.000 4.379)
+1395 H c 0.676 0.000 ( 0.000 4.379)
+1396 H d 0.676 0.000 ( 0.000 4.379)
+1397 R e 0.676 0.000 ( 0.000 4.379)
+1398 V f 0.676 0.000 ( 0.000 4.379)
+1399 S g 0.676 0.000 ( 0.000 4.379)
+1400 D a 0.676 0.000 ( 0.000 4.379)
+1401 K b 0.676 0.000 ( 0.000 4.379)
+1402 L c 0.676 0.000 ( 0.000 4.379)
+1403 Y a 0.683 0.000 ( 0.000 4.502)
+1404 V b 0.683 0.000 ( 0.000 4.502)
+1405 T c 0.683 0.000 ( 0.000 4.502)
+1406 D d 0.683 0.000 ( 0.000 4.502)
+1407 I e 0.683 0.000 ( 0.000 4.502)
+1408 F f 0.683 0.000 ( 0.000 4.502)
+1409 T g 0.683 0.000 ( 0.000 4.502)
+1410 F a 0.810 0.000 ( 0.000 5.548)
+1411 D b 0.810 0.000 ( 0.000 5.548)
+1412 S c 0.810 0.000 ( 0.000 5.548)
+1413 T d 0.810 0.000 ( 0.000 5.548)
+1414 S e 0.810 0.000 ( 0.000 5.548)
+1415 G f 0.810 0.000 ( 0.000 5.548)
+1416 E g 0.810 0.000 ( 0.000 5.548)
+1417 L a 0.810 0.000 ( 0.000 5.548)
+1418 L b 0.810 0.000 ( 0.000 5.548)
+1419 D c 0.810 0.000 ( 0.000 5.548)
+1420 V d 0.810 0.000 ( 0.000 5.548)
+1421 M e 0.810 0.000 ( 0.000 5.548)
+1422 I f 0.810 0.000 ( 0.000 5.548)
+1423 G g 0.810 0.000 ( 0.000 5.548)
+1424 I a 0.810 0.000 ( 0.000 5.548)
+1425 K b 0.810 0.000 ( 0.000 5.548)
+1426 Y c 0.810 0.000 ( 0.000 5.548)
+1427 A d 0.810 0.000 ( 0.000 5.548)
+1428 K e 0.810 0.000 ( 0.000 5.548)
+1429 I f 0.810 0.000 ( 0.000 5.548)
+1430 S g 0.810 0.000 ( 0.000 5.548)
+1431 K a 0.810 0.000 ( 0.000 5.548)
+1432 P b 0.810 0.000 ( 0.000 5.548)
+1433 S c 0.810 0.000 ( 0.000 5.548)
+1434 M d 0.810 0.000 ( 0.000 5.548)
+1435 Q e 0.810 0.000 ( 0.000 5.548)
+1436 K f 0.810 0.000 ( 0.000 5.548)
+1437 I g 0.810 0.000 ( 0.000 5.548)
+1438 L a 0.697 0.000 ( 0.000 4.720)
+1439 A b 0.697 0.000 ( 0.000 4.720)
+1440 R c 0.697 0.000 ( 0.000 4.720)
+1441 L d 0.697 0.000 ( 0.000 4.720)
+1442 S e 0.697 0.000 ( 0.000 4.720)
+1443 P f 0.697 0.000 ( 0.000 4.720)
+1444 G g 0.697 0.000 ( 0.000 4.720)
+1445 V e 0.514 0.000 ( 0.000 1.578)
+1446 C f 0.514 0.000 ( 0.000 1.578)
+1447 V g 0.514 0.000 ( 0.000 1.578)
+1448 P g 0.439 0.000 ( 0.000 0.745)
+1449 P g 0.346 0.000 ( 0.000 0.230)
+1450 P a 0.359 0.000 ( 0.000 0.278)
+1451 P b 0.359 0.000 ( 0.000 0.278)
+1452 G c 0.359 0.000 ( 0.000 0.278)
+1453 L a 0.454 0.000 ( 0.000 0.872)
+1454 G b 0.454 0.000 ( 0.000 0.872)
+1455 T c 0.454 0.000 ( 0.000 0.872)
+1456 A a 0.552 0.000 ( 0.000 2.153)
+1457 P b 0.552 0.000 ( 0.000 2.153)
+1458 V c 0.552 0.000 ( 0.000 2.153)
+1459 T d 0.552 0.000 ( 0.000 2.153)
+1460 H e 0.552 0.000 ( 0.000 2.153)
+1461 N f 0.552 0.000 ( 0.000 2.153)
+1462 K g 0.552 0.000 ( 0.000 2.153)
+1463 T a 0.552 0.000 ( 0.000 2.153)
+1464 S b 0.552 0.000 ( 0.000 2.153)
+1465 R c 0.552 0.000 ( 0.000 2.153)
+1466 E d 0.552 0.000 ( 0.000 2.153)
+1467 P e 0.552 0.000 ( 0.000 2.153)
+1468 I a 0.574 0.000 ( 0.000 2.520)
+1469 E b 0.574 0.000 ( 0.000 2.520)
+1470 P a 0.596 0.000 ( 0.000 2.932)
+1471 S b 0.596 0.000 ( 0.000 2.932)
+1472 E c 0.596 0.000 ( 0.000 2.932)
+1473 A a 0.633 0.000 ( 0.000 3.609)
+1474 S b 0.633 0.000 ( 0.000 3.609)
+1475 G c 0.633 0.000 ( 0.000 3.609)
+1476 A d 0.633 0.000 ( 0.000 3.609)
+1477 V a 0.696 0.000 ( 0.000 4.696)
+1478 P b 0.696 0.000 ( 0.000 4.696)
+1479 T c 0.696 0.000 ( 0.000 4.696)
+1480 A a 0.746 0.000 ( 0.000 5.310)
+1481 T b 0.746 0.000 ( 0.000 5.310)
+1482 G a 0.775 0.000 ( 0.000 5.500)
+1483 A b 0.775 0.000 ( 0.000 5.500)
+1484 T a 0.858 0.000 ( 0.000 5.273)
+1485 V b 0.858 0.000 ( 0.000 5.273)
+1486 S c 0.858 0.000 ( 0.000 5.273)
+1487 K a 0.862 0.000 ( 0.000 5.237)
+1488 S b 0.862 0.000 ( 0.000 5.237)
+1489 F c 0.862 0.000 ( 0.000 5.237)
+1490 K d 0.862 0.000 ( 0.000 5.237)
+1491 A a 1.142 0.002 ( 0.054 0.919)
+1492 G b 1.142 0.002 ( 0.054 0.919)
+1493 G c 1.142 0.002 ( 0.054 0.919)
+1494 A d 1.142 0.002 ( 0.054 0.919)
+1495 E e 1.142 0.002 ( 0.054 0.919)
+1496 V f 1.142 0.002 ( 0.054 0.919)
+1497 S g 1.142 0.002 ( 0.054 0.919)
+1498 K a 1.142 0.002 ( 0.054 0.919)
+1499 K b 1.142 0.002 ( 0.054 0.919)
+1500 Q c 1.142 0.002 ( 0.054 0.919)
+1501 P d 1.142 0.002 ( 0.054 0.919)
+1502 E e 1.142 0.002 ( 0.054 0.919)
+1503 N f 1.142 0.002 ( 0.054 0.919)
+1504 T g 1.142 0.002 ( 0.054 0.919)
+1505 R a 1.142 0.002 ( 0.054 0.919)
+1506 A b 1.142 0.002 ( 0.054 0.919)
+1507 N c 1.142 0.002 ( 0.054 0.919)
+1508 I d 1.142 0.002 ( 0.054 0.919)
+1509 K e 1.142 0.002 ( 0.054 0.919)
+1510 K f 1.142 0.002 ( 0.054 0.919)
+1511 Q g 1.142 0.002 ( 0.054 0.919)
+1512 V a 1.142 0.002 ( 0.054 0.919)
+1513 R b 1.142 0.002 ( 0.054 0.919)
+1514 D c 1.142 0.002 ( 0.054 0.919)
+1515 L d 1.142 0.002 ( 0.054 0.919)
+1516 L e 1.142 0.002 ( 0.054 0.919)
+1517 A f 1.142 0.002 ( 0.054 0.919)
+1518 N g 1.142 0.002 ( 0.054 0.919)
+1519 V a 1.032 0.000 ( 0.007 2.414)
+1520 A b 1.032 0.000 ( 0.007 2.414)
+1521 G c 1.032 0.000 ( 0.007 2.414)
+1522 V d 1.032 0.000 ( 0.007 2.414)
+1523 E e 1.032 0.000 ( 0.007 2.414)
+1524 P f 1.032 0.000 ( 0.007 2.414)
+1525 A g 1.032 0.000 ( 0.007 2.414)
+1526 D a 0.861 0.000 ( 0.000 5.248)
+1527 I b 0.861 0.000 ( 0.000 5.248)
+1528 S c 0.861 0.000 ( 0.000 5.248)
+1529 E d 0.861 0.000 ( 0.000 5.248)
+1530 S e 0.861 0.000 ( 0.000 5.248)
+1531 T f 0.861 0.000 ( 0.000 5.248)
+1532 V g 0.861 0.000 ( 0.000 5.248)
+1533 L g 0.826 0.000 ( 0.000 5.496)
+1534 S a 0.826 0.000 ( 0.000 5.496)
+1535 D b 0.826 0.000 ( 0.000 5.496)
+1536 I c 0.826 0.000 ( 0.000 5.496)
+1537 G d 0.826 0.000 ( 0.000 5.496)
+1538 I e 0.826 0.000 ( 0.000 5.496)
+1539 D f 0.826 0.000 ( 0.000 5.496)
+1540 S g 0.826 0.000 ( 0.000 5.496)
+1541 L a 0.826 0.000 ( 0.000 5.496)
+1542 M b 0.826 0.000 ( 0.000 5.496)
+1543 G c 0.826 0.000 ( 0.000 5.496)
+1544 M d 0.826 0.000 ( 0.000 5.496)
+1545 E e 0.826 0.000 ( 0.000 5.496)
+1546 L f 0.826 0.000 ( 0.000 5.496)
+1547 A g 0.826 0.000 ( 0.000 5.496)
+1548 R a 0.826 0.000 ( 0.000 5.496)
+1549 E b 0.826 0.000 ( 0.000 5.496)
+1550 A c 0.826 0.000 ( 0.000 5.496)
+1551 E d 0.826 0.000 ( 0.000 5.496)
+1552 T e 0.826 0.000 ( 0.000 5.496)
+1553 V f 0.826 0.000 ( 0.000 5.496)
+1554 M g 0.826 0.000 ( 0.000 5.496)
+1555 K c 0.772 0.000 ( 0.000 5.486)
+1556 C d 0.772 0.000 ( 0.000 5.486)
+1557 T e 0.772 0.000 ( 0.000 5.486)
+1558 L f 0.772 0.000 ( 0.000 5.486)
+1559 S g 0.772 0.000 ( 0.000 5.486)
+1560 P a 0.772 0.000 ( 0.000 5.486)
+1561 D b 0.772 0.000 ( 0.000 5.486)
+1562 K c 0.772 0.000 ( 0.000 5.486)
+1563 L d 0.772 0.000 ( 0.000 5.486)
+1564 M e 0.772 0.000 ( 0.000 5.486)
+1565 E f 0.772 0.000 ( 0.000 5.486)
+1566 A g 0.772 0.000 ( 0.000 5.486)
+1567 F e 0.737 0.000 ( 0.000 5.223)
+1568 D f 0.737 0.000 ( 0.000 5.223)
+1569 F a 0.756 0.000 ( 0.000 5.390)
+1570 P a 0.946 0.000 ( 0.001 4.003)
+1571 S b 0.946 0.000 ( 0.001 4.003)
+1572 F c 0.946 0.000 ( 0.001 4.003)
+1573 V a 0.950 0.000 ( 0.001 3.917)
+1574 D b 0.950 0.000 ( 0.001 3.917)
+1575 C c 0.950 0.000 ( 0.001 3.917)
+1576 V a 1.027 0.000 ( 0.006 2.514)
+1577 I a 1.415 0.781 ( 1.729 0.016)
+1578 S b 1.415 0.781 ( 1.729 0.016)
+1579 A c 1.415 0.781 ( 1.729 0.016)
+1580 L d 1.415 0.781 ( 1.729 0.016)
+1581 G e 1.415 0.781 ( 1.729 0.016)
+1582 I f 1.415 0.781 ( 1.729 0.016)
+1583 T g 1.415 0.781 ( 1.729 0.016)
+1584 A a 1.470 0.941 ( 2.626 0.005)
+1585 D b 1.470 0.941 ( 2.626 0.005)
+1586 G c 1.470 0.941 ( 2.626 0.005)
+1587 Q d 1.470 0.941 ( 2.626 0.005)
+1588 E e 1.470 0.941 ( 2.626 0.005)
+1589 E f 1.470 0.941 ( 2.626 0.005)
+1590 E g 1.470 0.941 ( 2.626 0.005)
+1591 M a 1.470 0.941 ( 2.626 0.005)
+1592 E b 1.470 0.941 ( 2.626 0.005)
+1593 E c 1.470 0.941 ( 2.626 0.005)
+1594 E d 1.470 0.941 ( 2.626 0.005)
+1595 Q e 1.470 0.941 ( 2.626 0.005)
+1596 D f 1.470 0.941 ( 2.626 0.005)
+1597 D g 1.470 0.941 ( 2.626 0.005)
+1598 K a 1.470 0.941 ( 2.626 0.005)
+1599 Q b 1.470 0.941 ( 2.626 0.005)
+1600 E c 1.470 0.941 ( 2.626 0.005)
+1601 K d 1.470 0.941 ( 2.626 0.005)
+1602 E e 1.470 0.941 ( 2.626 0.005)
+1603 E f 1.470 0.941 ( 2.626 0.005)
+1604 G g 1.470 0.941 ( 2.626 0.005)
+1605 A a 1.470 0.941 ( 2.626 0.005)
+1606 R b 1.470 0.941 ( 2.626 0.005)
+1607 Q c 1.470 0.941 ( 2.626 0.005)
+1608 R d 1.470 0.941 ( 2.626 0.005)
+1609 V e 1.470 0.941 ( 2.626 0.005)
+1610 Q f 1.470 0.941 ( 2.626 0.005)
+1611 E g 1.470 0.941 ( 2.626 0.005)
+1612 S d 1.271 0.063 ( 0.368 0.182)
+1613 E e 1.271 0.063 ( 0.368 0.182)
+1614 P f 1.271 0.063 ( 0.368 0.182)
+1615 T g 1.271 0.063 ( 0.368 0.182)
+1616 T e 1.125 0.001 ( 0.041 1.084)
+1617 D f 1.125 0.001 ( 0.041 1.084)
+1618 D g 1.125 0.001 ( 0.041 1.084)
+1619 E g 1.079 0.000 ( 0.018 1.670)
+1620 Q e 1.007 0.000 ( 0.004 2.876)
+1621 Y f 1.007 0.000 ( 0.004 2.876)
+1622 R g 1.007 0.000 ( 0.004 2.876)
+1623 P a 0.761 0.000 ( 0.000 5.430)
+1624 Y b 0.761 0.000 ( 0.000 5.430)
+1625 K c 0.761 0.000 ( 0.000 5.430)
+1626 A d 0.761 0.000 ( 0.000 5.430)
+1627 Q e 0.761 0.000 ( 0.000 5.430)
+1628 D f 0.761 0.000 ( 0.000 5.430)
+1629 A g 0.761 0.000 ( 0.000 5.430)
+1630 S c 0.699 0.000 ( 0.000 4.753)
+1631 W d 0.699 0.000 ( 0.000 4.753)
+1632 S e 0.699 0.000 ( 0.000 4.753)
+1633 Q f 0.699 0.000 ( 0.000 4.753)
+1634 S g 0.699 0.000 ( 0.000 4.753)
+1635 S e 0.574 0.000 ( 0.000 2.519)
+1636 G f 0.574 0.000 ( 0.000 2.519)
+1637 T g 0.574 0.000 ( 0.000 2.519)
+1638 S a 0.574 0.000 ( 0.000 2.519)
+1639 T b 0.574 0.000 ( 0.000 2.519)
+1640 P c 0.574 0.000 ( 0.000 2.519)
+1641 P a 0.700 0.000 ( 0.000 4.754)
+1642 S b 0.700 0.000 ( 0.000 4.754)
+1643 S c 0.700 0.000 ( 0.000 4.754)
+1644 L a 0.776 0.000 ( 0.000 5.508)
+1645 D b 0.776 0.000 ( 0.000 5.508)
+1646 D c 0.776 0.000 ( 0.000 5.508)
+1647 D d 0.776 0.000 ( 0.000 5.508)
+1648 L a 0.840 0.000 ( 0.000 5.420)
+1649 N b 0.840 0.000 ( 0.000 5.420)
+1650 E c 0.840 0.000 ( 0.000 5.420)
+1651 L d 0.840 0.000 ( 0.000 5.420)
+1652 T e 0.840 0.000 ( 0.000 5.420)
+1653 L f 0.840 0.000 ( 0.000 5.420)
+1654 P g 0.840 0.000 ( 0.000 5.420)
+1655 A a 0.840 0.000 ( 0.000 5.420)
+1656 G b 0.840 0.000 ( 0.000 5.420)
+1657 A c 0.840 0.000 ( 0.000 5.420)
+1658 V d 0.840 0.000 ( 0.000 5.420)
+1659 L e 0.840 0.000 ( 0.000 5.420)
+1660 E f 0.840 0.000 ( 0.000 5.420)
+1661 S g 0.840 0.000 ( 0.000 5.420)
+1662 F a 0.840 0.000 ( 0.000 5.420)
+1663 G b 0.840 0.000 ( 0.000 5.420)
+1664 K c 0.840 0.000 ( 0.000 5.420)
+1665 T d 0.840 0.000 ( 0.000 5.420)
+1666 K e 0.840 0.000 ( 0.000 5.420)
+1667 L f 0.840 0.000 ( 0.000 5.420)
+1668 L g 0.840 0.000 ( 0.000 5.420)
+1669 T a 0.840 0.000 ( 0.000 5.420)
+1670 D b 0.840 0.000 ( 0.000 5.420)
+1671 E c 0.840 0.000 ( 0.000 5.420)
+1672 M d 0.840 0.000 ( 0.000 5.420)
+1673 I e 0.840 0.000 ( 0.000 5.420)
+1674 R f 0.840 0.000 ( 0.000 5.420)
+1675 R g 0.840 0.000 ( 0.000 5.420)
+1676 Y a 0.762 0.000 ( 0.000 5.430)
+1677 K b 0.762 0.000 ( 0.000 5.430)
+1678 V c 0.762 0.000 ( 0.000 5.430)
+1679 D d 0.762 0.000 ( 0.000 5.430)
+1680 T e 0.762 0.000 ( 0.000 5.430)
+1681 F f 0.762 0.000 ( 0.000 5.430)
+1682 A g 0.762 0.000 ( 0.000 5.430)
+1683 N d 0.754 0.000 ( 0.000 5.381)
+1684 V e 0.754 0.000 ( 0.000 5.381)
+1685 I f 0.754 0.000 ( 0.000 5.381)
+1686 A a 0.785 0.000 ( 0.000 5.537)
+1687 P b 0.785 0.000 ( 0.000 5.537)
+1688 K c 0.785 0.000 ( 0.000 5.537)
+1689 S d 0.785 0.000 ( 0.000 5.537)
+1690 T e 0.785 0.000 ( 0.000 5.537)
+1691 Q f 0.785 0.000 ( 0.000 5.537)
+1692 L g 0.785 0.000 ( 0.000 5.537)
+1693 C a 0.785 0.000 ( 0.000 5.537)
+1694 I b 0.785 0.000 ( 0.000 5.537)
+1695 A c 0.785 0.000 ( 0.000 5.537)
+1696 L d 0.785 0.000 ( 0.000 5.537)
+1697 T e 0.785 0.000 ( 0.000 5.537)
+1698 L f 0.785 0.000 ( 0.000 5.537)
+1699 E g 0.785 0.000 ( 0.000 5.537)
+1700 A a 0.785 0.000 ( 0.000 5.537)
+1701 F b 0.785 0.000 ( 0.000 5.537)
+1702 E c 0.785 0.000 ( 0.000 5.537)
+1703 K d 0.785 0.000 ( 0.000 5.537)
+1704 L e 0.785 0.000 ( 0.000 5.537)
+1705 G f 0.785 0.000 ( 0.000 5.537)
+1706 V g 0.785 0.000 ( 0.000 5.537)
+1707 S a 0.785 0.000 ( 0.000 5.537)
+1708 I b 0.785 0.000 ( 0.000 5.537)
+1709 R c 0.785 0.000 ( 0.000 5.537)
+1710 A d 0.785 0.000 ( 0.000 5.537)
+1711 T e 0.785 0.000 ( 0.000 5.537)
+1712 K f 0.785 0.000 ( 0.000 5.537)
+1713 A g 0.785 0.000 ( 0.000 5.537)
+1714 G g 0.733 0.000 ( 0.000 5.182)
+1715 Q f 0.732 0.000 ( 0.000 5.172)
+1716 V a 0.743 0.000 ( 0.000 5.283)
+1717 V b 0.743 0.000 ( 0.000 5.283)
+1718 P c 0.743 0.000 ( 0.000 5.283)
+1719 R a 0.832 0.000 ( 0.000 5.470)
+1720 I b 0.832 0.000 ( 0.000 5.470)
+1721 N c 0.832 0.000 ( 0.000 5.470)
+1722 Y a 0.921 0.000 ( 0.001 4.431)
+1723 A a 0.997 0.000 ( 0.003 3.050)
+1724 P b 0.997 0.000 ( 0.003 3.050)
+1725 Q c 0.997 0.000 ( 0.003 3.050)
+1726 H d 0.997 0.000 ( 0.003 3.050)
+1727 Q e 0.997 0.000 ( 0.003 3.050)
+1728 R f 0.997 0.000 ( 0.003 3.050)
+1729 L g 0.997 0.000 ( 0.003 3.050)
+1730 V a 0.997 0.000 ( 0.003 3.050)
+1731 D b 0.997 0.000 ( 0.003 3.050)
+1732 Y c 0.997 0.000 ( 0.003 3.050)
+1733 L d 0.997 0.000 ( 0.003 3.050)
+1734 Y e 0.997 0.000 ( 0.003 3.050)
+1735 R f 0.997 0.000 ( 0.003 3.050)
+1736 L g 0.997 0.000 ( 0.003 3.050)
+1737 L a 0.997 0.000 ( 0.003 3.050)
+1738 E b 0.997 0.000 ( 0.003 3.050)
+1739 N c 0.997 0.000 ( 0.003 3.050)
+1740 E d 0.997 0.000 ( 0.003 3.050)
+1741 A e 0.997 0.000 ( 0.003 3.050)
+1742 R f 0.997 0.000 ( 0.003 3.050)
+1743 L g 0.997 0.000 ( 0.003 3.050)
+1744 I a 0.997 0.000 ( 0.003 3.050)
+1745 D b 0.997 0.000 ( 0.003 3.050)
+1746 S c 0.997 0.000 ( 0.003 3.050)
+1747 T d 0.997 0.000 ( 0.003 3.050)
+1748 D e 0.997 0.000 ( 0.003 3.050)
+1749 R f 0.997 0.000 ( 0.003 3.050)
+1750 G g 0.997 0.000 ( 0.003 3.050)
+1751 E b 0.971 0.000 ( 0.002 3.536)
+1752 H c 0.971 0.000 ( 0.002 3.536)
+1753 V d 0.971 0.000 ( 0.002 3.536)
+1754 R e 0.971 0.000 ( 0.002 3.536)
+1755 T f 0.971 0.000 ( 0.002 3.536)
+1756 A g 0.971 0.000 ( 0.002 3.536)
+1757 V g 0.817 0.000 ( 0.000 5.531)
+1758 S b 0.758 0.000 ( 0.000 5.410)
+1759 P c 0.758 0.000 ( 0.000 5.410)
+1760 P d 0.758 0.000 ( 0.000 5.410)
+1761 K a 0.820 0.000 ( 0.000 5.523)
+1762 K b 0.820 0.000 ( 0.000 5.523)
+1763 A c 0.820 0.000 ( 0.000 5.523)
+1764 S d 0.820 0.000 ( 0.000 5.523)
+1765 V e 0.820 0.000 ( 0.000 5.523)
+1766 A f 0.820 0.000 ( 0.000 5.523)
+1767 L g 0.820 0.000 ( 0.000 5.523)
+1768 L a 0.820 0.000 ( 0.000 5.523)
+1769 Q b 0.820 0.000 ( 0.000 5.523)
+1770 D c 0.820 0.000 ( 0.000 5.523)
+1771 L d 0.820 0.000 ( 0.000 5.523)
+1772 V e 0.820 0.000 ( 0.000 5.523)
+1773 R f 0.820 0.000 ( 0.000 5.523)
+1774 L g 0.820 0.000 ( 0.000 5.523)
+1775 Y a 0.820 0.000 ( 0.000 5.523)
+1776 P b 0.820 0.000 ( 0.000 5.523)
+1777 D c 0.820 0.000 ( 0.000 5.523)
+1778 W d 0.820 0.000 ( 0.000 5.523)
+1779 S e 0.820 0.000 ( 0.000 5.523)
+1780 N f 0.820 0.000 ( 0.000 5.523)
+1781 A g 0.820 0.000 ( 0.000 5.523)
+1782 Q a 0.820 0.000 ( 0.000 5.523)
+1783 K b 0.820 0.000 ( 0.000 5.523)
+1784 L c 0.820 0.000 ( 0.000 5.523)
+1785 T d 0.820 0.000 ( 0.000 5.523)
+1786 H e 0.820 0.000 ( 0.000 5.523)
+1787 F f 0.820 0.000 ( 0.000 5.523)
+1788 A g 0.820 0.000 ( 0.000 5.523)
+1789 G a 0.798 0.000 ( 0.000 5.555)
+1790 S b 0.798 0.000 ( 0.000 5.555)
+1791 R c 0.798 0.000 ( 0.000 5.555)
+1792 L d 0.798 0.000 ( 0.000 5.555)
+1793 A e 0.798 0.000 ( 0.000 5.555)
+1794 D f 0.798 0.000 ( 0.000 5.555)
+1795 V g 0.798 0.000 ( 0.000 5.555)
+1796 L d 0.784 0.000 ( 0.000 5.533)
+1797 E e 0.784 0.000 ( 0.000 5.533)
+1798 G f 0.784 0.000 ( 0.000 5.533)
+1799 K g 0.784 0.000 ( 0.000 5.533)
+1800 T a 0.784 0.000 ( 0.000 5.533)
+1801 D b 0.784 0.000 ( 0.000 5.533)
+1802 G c 0.784 0.000 ( 0.000 5.533)
+1803 I d 0.784 0.000 ( 0.000 5.533)
+1804 K e 0.784 0.000 ( 0.000 5.533)
+1805 I f 0.784 0.000 ( 0.000 5.533)
+1806 I g 0.784 0.000 ( 0.000 5.533)
+1807 F a 0.730 0.000 ( 0.000 5.154)
+1808 G b 0.730 0.000 ( 0.000 5.154)
+1809 S a 0.762 0.000 ( 0.000 5.433)
+1810 D b 0.762 0.000 ( 0.000 5.433)
+1811 E c 0.762 0.000 ( 0.000 5.433)
+1812 G d 0.762 0.000 ( 0.000 5.433)
+1813 R e 0.762 0.000 ( 0.000 5.433)
+1814 A f 0.762 0.000 ( 0.000 5.433)
+1815 L g 0.762 0.000 ( 0.000 5.433)
+1816 V a 0.859 0.000 ( 0.000 5.269)
+1817 G b 0.859 0.000 ( 0.000 5.269)
+1818 G c 0.859 0.000 ( 0.000 5.269)
+1819 L d 0.859 0.000 ( 0.000 5.269)
+1820 Y e 0.859 0.000 ( 0.000 5.269)
+1821 C f 0.859 0.000 ( 0.000 5.269)
+1822 D g 0.859 0.000 ( 0.000 5.269)
+1823 H a 0.859 0.000 ( 0.000 5.269)
+1824 V b 0.859 0.000 ( 0.000 5.269)
+1825 F c 0.859 0.000 ( 0.000 5.269)
+1826 N d 0.859 0.000 ( 0.000 5.269)
+1827 K e 0.859 0.000 ( 0.000 5.269)
+1828 M f 0.859 0.000 ( 0.000 5.269)
+1829 N g 0.859 0.000 ( 0.000 5.269)
+1830 Y a 0.859 0.000 ( 0.000 5.269)
+1831 Q b 0.859 0.000 ( 0.000 5.269)
+1832 Q c 0.859 0.000 ( 0.000 5.269)
+1833 M d 0.859 0.000 ( 0.000 5.269)
+1834 A e 0.859 0.000 ( 0.000 5.269)
+1835 D f 0.859 0.000 ( 0.000 5.269)
+1836 C g 0.859 0.000 ( 0.000 5.269)
+1837 L a 0.859 0.000 ( 0.000 5.269)
+1838 E b 0.859 0.000 ( 0.000 5.269)
+1839 G c 0.859 0.000 ( 0.000 5.269)
+1840 L d 0.859 0.000 ( 0.000 5.269)
+1841 V e 0.859 0.000 ( 0.000 5.269)
+1842 S f 0.859 0.000 ( 0.000 5.269)
+1843 K g 0.859 0.000 ( 0.000 5.269)
+1844 L d 0.844 0.000 ( 0.000 5.395)
+1845 P e 0.844 0.000 ( 0.000 5.395)
+1846 A f 0.844 0.000 ( 0.000 5.395)
+1847 D g 0.844 0.000 ( 0.000 5.395)
+1848 Q a 0.844 0.000 ( 0.000 5.395)
+1849 G b 0.844 0.000 ( 0.000 5.395)
+1850 P c 0.844 0.000 ( 0.000 5.395)
+1851 L d 0.844 0.000 ( 0.000 5.395)
+1852 R e 0.844 0.000 ( 0.000 5.395)
+1853 I f 0.844 0.000 ( 0.000 5.395)
+1854 L g 0.844 0.000 ( 0.000 5.395)
+1855 E e 0.819 0.000 ( 0.000 5.524)
+1856 L f 0.819 0.000 ( 0.000 5.524)
+1857 G g 0.819 0.000 ( 0.000 5.524)
+1858 A a 0.662 0.000 ( 0.000 4.136)
+1859 G b 0.662 0.000 ( 0.000 4.136)
+1860 T c 0.662 0.000 ( 0.000 4.136)
+1861 G d 0.662 0.000 ( 0.000 4.136)
+1862 G e 0.662 0.000 ( 0.000 4.136)
+1863 T f 0.662 0.000 ( 0.000 4.136)
+1864 T g 0.662 0.000 ( 0.000 4.136)
+1865 L f 0.561 0.000 ( 0.000 2.296)
+1866 Y g 0.561 0.000 ( 0.000 2.296)
+1867 V a 0.561 0.000 ( 0.000 2.296)
+1868 A a 0.618 0.000 ( 0.000 3.337)
+1869 P b 0.618 0.000 ( 0.000 3.337)
+1870 M c 0.618 0.000 ( 0.000 3.337)
+1871 L d 0.618 0.000 ( 0.000 3.337)
+1872 E e 0.618 0.000 ( 0.000 3.337)
+1873 R f 0.618 0.000 ( 0.000 3.337)
+1874 L g 0.618 0.000 ( 0.000 3.337)
+1875 Q a 0.618 0.000 ( 0.000 3.337)
+1876 V b 0.618 0.000 ( 0.000 3.337)
+1877 P c 0.618 0.000 ( 0.000 3.337)
+1878 V d 0.618 0.000 ( 0.000 3.337)
+1879 E e 0.618 0.000 ( 0.000 3.337)
+1880 Y f 0.618 0.000 ( 0.000 3.337)
+1881 V g 0.618 0.000 ( 0.000 3.337)
+1882 F a 0.618 0.000 ( 0.000 3.337)
+1883 T b 0.618 0.000 ( 0.000 3.337)
+1884 D c 0.618 0.000 ( 0.000 3.337)
+1885 I d 0.618 0.000 ( 0.000 3.337)
+1886 S a 0.705 0.000 ( 0.000 4.828)
+1887 P b 0.705 0.000 ( 0.000 4.828)
+1888 S c 0.705 0.000 ( 0.000 4.828)
+1889 M d 0.705 0.000 ( 0.000 4.828)
+1890 V a 0.708 0.000 ( 0.000 4.873)
+1891 S b 0.708 0.000 ( 0.000 4.873)
+1892 A c 0.708 0.000 ( 0.000 4.873)
+1893 A a 0.744 0.000 ( 0.000 5.292)
+1894 K b 0.744 0.000 ( 0.000 5.292)
+1895 K c 0.744 0.000 ( 0.000 5.292)
+1896 K d 0.744 0.000 ( 0.000 5.292)
+1897 F e 0.744 0.000 ( 0.000 5.292)
+1898 G f 0.744 0.000 ( 0.000 5.292)
+1899 K g 0.744 0.000 ( 0.000 5.292)
+1900 Y a 0.744 0.000 ( 0.000 5.292)
+1901 A b 0.744 0.000 ( 0.000 5.292)
+1902 F c 0.744 0.000 ( 0.000 5.292)
+1903 M d 0.744 0.000 ( 0.000 5.292)
+1904 K e 0.744 0.000 ( 0.000 5.292)
+1905 Y f 0.744 0.000 ( 0.000 5.292)
+1906 M g 0.744 0.000 ( 0.000 5.292)
+1907 V a 0.744 0.000 ( 0.000 5.292)
+1908 H b 0.744 0.000 ( 0.000 5.292)
+1909 D c 0.744 0.000 ( 0.000 5.292)
+1910 M d 0.744 0.000 ( 0.000 5.292)
+1911 E e 0.744 0.000 ( 0.000 5.292)
+1912 K f 0.744 0.000 ( 0.000 5.292)
+1913 P g 0.744 0.000 ( 0.000 5.292)
+1914 M a 0.744 0.000 ( 0.000 5.292)
+1915 S b 0.744 0.000 ( 0.000 5.292)
+1916 A a 0.896 0.000 ( 0.000 4.822)
+1917 E b 0.896 0.000 ( 0.000 4.822)
+1918 L c 0.896 0.000 ( 0.000 4.822)
+1919 L d 0.896 0.000 ( 0.000 4.822)
+1920 G e 0.896 0.000 ( 0.000 4.822)
+1921 T f 0.896 0.000 ( 0.000 4.822)
+1922 Q g 0.896 0.000 ( 0.000 4.822)
+1923 H a 0.896 0.000 ( 0.000 4.822)
+1924 I b 0.896 0.000 ( 0.000 4.822)
+1925 V c 0.896 0.000 ( 0.000 4.822)
+1926 I d 0.896 0.000 ( 0.000 4.822)
+1927 A e 0.896 0.000 ( 0.000 4.822)
+1928 S f 0.896 0.000 ( 0.000 4.822)
+1929 N g 0.896 0.000 ( 0.000 4.822)
+1930 A a 0.896 0.000 ( 0.000 4.822)
+1931 V b 0.896 0.000 ( 0.000 4.822)
+1932 H c 0.896 0.000 ( 0.000 4.822)
+1933 A d 0.896 0.000 ( 0.000 4.822)
+1934 T e 0.896 0.000 ( 0.000 4.822)
+1935 R f 0.896 0.000 ( 0.000 4.822)
+1936 D g 0.896 0.000 ( 0.000 4.822)
+1937 L a 0.896 0.000 ( 0.000 4.822)
+1938 V b 0.896 0.000 ( 0.000 4.822)
+1939 K c 0.896 0.000 ( 0.000 4.822)
+1940 T d 0.896 0.000 ( 0.000 4.822)
+1941 G e 0.896 0.000 ( 0.000 4.822)
+1942 T f 0.896 0.000 ( 0.000 4.822)
+1943 N g 0.896 0.000 ( 0.000 4.822)
+1944 I g 0.845 0.000 ( 0.000 5.385)
+1945 H a 0.845 0.000 ( 0.000 5.385)
+1946 N b 0.845 0.000 ( 0.000 5.385)
+1947 A c 0.845 0.000 ( 0.000 5.385)
+1948 L d 0.845 0.000 ( 0.000 5.385)
+1949 R e 0.845 0.000 ( 0.000 5.385)
+1950 P f 0.845 0.000 ( 0.000 5.385)
+1951 D g 0.845 0.000 ( 0.000 5.385)
+1952 G b 0.727 0.000 ( 0.000 5.119)
+1953 F c 0.727 0.000 ( 0.000 5.119)
+1954 L d 0.727 0.000 ( 0.000 5.119)
+1955 M e 0.727 0.000 ( 0.000 5.119)
+1956 M f 0.727 0.000 ( 0.000 5.119)
+1957 L g 0.727 0.000 ( 0.000 5.119)
+1958 E g 0.685 0.000 ( 0.000 4.527)
+1959 M d 0.676 0.000 ( 0.000 4.384)
+1960 T e 0.676 0.000 ( 0.000 4.384)
+1961 E f 0.676 0.000 ( 0.000 4.384)
+1962 I g 0.676 0.000 ( 0.000 4.384)
+1963 V a 0.612 0.000 ( 0.000 3.213)
+1964 P b 0.612 0.000 ( 0.000 3.213)
+1965 F c 0.612 0.000 ( 0.000 3.213)
+1966 V d 0.612 0.000 ( 0.000 3.213)
+1967 D e 0.612 0.000 ( 0.000 3.213)
+1968 T f 0.612 0.000 ( 0.000 3.213)
+1969 I g 0.612 0.000 ( 0.000 3.213)
+1970 F a 0.541 0.000 ( 0.000 1.979)
+1971 G b 0.541 0.000 ( 0.000 1.979)
+1972 L c 0.541 0.000 ( 0.000 1.979)
+1973 L d 0.541 0.000 ( 0.000 1.979)
+1974 E e 0.541 0.000 ( 0.000 1.979)
+1975 G f 0.541 0.000 ( 0.000 1.979)
+1976 W g 0.541 0.000 ( 0.000 1.979)
+1977 W a 0.536 0.000 ( 0.000 1.903)
+1978 L b 0.536 0.000 ( 0.000 1.903)
+1979 F c 0.536 0.000 ( 0.000 1.903)
+1980 D d 0.536 0.000 ( 0.000 1.903)
+1981 D e 0.536 0.000 ( 0.000 1.903)
+1982 G f 0.536 0.000 ( 0.000 1.903)
+1983 R a 0.607 0.000 ( 0.000 3.134)
+1984 Q b 0.607 0.000 ( 0.000 3.134)
+1985 H c 0.607 0.000 ( 0.000 3.134)
+1986 A d 0.607 0.000 ( 0.000 3.134)
+1987 I e 0.607 0.000 ( 0.000 3.134)
+1988 T f 0.607 0.000 ( 0.000 3.134)
+1989 G g 0.607 0.000 ( 0.000 3.134)
+1990 P a 0.607 0.000 ( 0.000 3.134)
+1991 E b 0.607 0.000 ( 0.000 3.134)
+1992 G c 0.607 0.000 ( 0.000 3.134)
+1993 W d 0.607 0.000 ( 0.000 3.134)
+1994 E e 0.607 0.000 ( 0.000 3.134)
+1995 K f 0.607 0.000 ( 0.000 3.134)
+1996 A g 0.607 0.000 ( 0.000 3.134)
+1997 M a 0.607 0.000 ( 0.000 3.134)
+1998 H b 0.607 0.000 ( 0.000 3.134)
+1999 S c 0.607 0.000 ( 0.000 3.134)
+2000 A d 0.607 0.000 ( 0.000 3.134)
+2001 G e 0.607 0.000 ( 0.000 3.134)
+2002 F f 0.607 0.000 ( 0.000 3.134)
+2003 G g 0.607 0.000 ( 0.000 3.134)
+2004 H a 0.607 0.000 ( 0.000 3.134)
+2005 V a 0.656 0.000 ( 0.000 4.025)
+2006 D b 0.656 0.000 ( 0.000 4.025)
+2007 W c 0.656 0.000 ( 0.000 4.025)
+2008 T d 0.656 0.000 ( 0.000 4.025)
+2009 D e 0.656 0.000 ( 0.000 4.025)
+2010 G f 0.656 0.000 ( 0.000 4.025)
+2011 H g 0.656 0.000 ( 0.000 4.025)
+2012 L a 0.656 0.000 ( 0.000 4.025)
+2013 P b 0.656 0.000 ( 0.000 4.025)
+2014 E c 0.656 0.000 ( 0.000 4.025)
+2015 S d 0.656 0.000 ( 0.000 4.025)
+2016 K e 0.656 0.000 ( 0.000 4.025)
+2017 I f 0.656 0.000 ( 0.000 4.025)
+2018 Q g 0.656 0.000 ( 0.000 4.025)
+2019 K a 0.656 0.000 ( 0.000 4.025)
+2020 V b 0.656 0.000 ( 0.000 4.025)
+2021 I c 0.656 0.000 ( 0.000 4.025)
+2022 V d 0.656 0.000 ( 0.000 4.025)
+2023 A e 0.656 0.000 ( 0.000 4.025)
+2024 M f 0.656 0.000 ( 0.000 4.025)
+2025 A g 0.656 0.000 ( 0.000 4.025)
+2026 S a 0.656 0.000 ( 0.000 4.025)
+2027 G b 0.656 0.000 ( 0.000 4.025)
+2028 P c 0.656 0.000 ( 0.000 4.025)
+2029 V d 0.656 0.000 ( 0.000 4.025)
+2030 Q e 0.656 0.000 ( 0.000 4.025)
+2031 E f 0.656 0.000 ( 0.000 4.025)
+2032 R g 0.656 0.000 ( 0.000 4.025)
+2033 L g 0.469 0.000 ( 0.000 1.026)
+2034 P g 0.401 0.000 ( 0.000 0.475)
+2035 P g 0.389 0.000 ( 0.000 0.410)
+2036 P a 0.506 0.000 ( 0.000 1.470)
+2037 P b 0.506 0.000 ( 0.000 1.470)
+2038 P c 0.506 0.000 ( 0.000 1.470)
+2039 P a 0.548 0.000 ( 0.000 2.080)
+2040 A a 0.857 0.000 ( 0.000 5.282)
+2041 R b 0.857 0.000 ( 0.000 5.282)
+2042 K c 0.857 0.000 ( 0.000 5.282)
+2043 A d 0.857 0.000 ( 0.000 5.282)
+2044 A e 0.857 0.000 ( 0.000 5.282)
+2045 E f 0.857 0.000 ( 0.000 5.282)
+2046 S g 0.857 0.000 ( 0.000 5.282)
+2047 G a 0.857 0.000 ( 0.000 5.282)
+2048 P b 0.857 0.000 ( 0.000 5.282)
+2049 D c 0.857 0.000 ( 0.000 5.282)
+2050 L d 0.857 0.000 ( 0.000 5.282)
+2051 A e 0.857 0.000 ( 0.000 5.282)
+2052 S f 0.857 0.000 ( 0.000 5.282)
+2053 R g 0.857 0.000 ( 0.000 5.282)
+2054 E a 0.857 0.000 ( 0.000 5.282)
+2055 E b 0.857 0.000 ( 0.000 5.282)
+2056 D c 0.857 0.000 ( 0.000 5.282)
+2057 I d 0.857 0.000 ( 0.000 5.282)
+2058 S e 0.857 0.000 ( 0.000 5.282)
+2059 A f 0.857 0.000 ( 0.000 5.282)
+2060 Y g 0.857 0.000 ( 0.000 5.282)
+2061 V a 0.857 0.000 ( 0.000 5.282)
+2062 Q b 0.857 0.000 ( 0.000 5.282)
+2063 K c 0.857 0.000 ( 0.000 5.282)
+2064 F d 0.857 0.000 ( 0.000 5.282)
+2065 S e 0.857 0.000 ( 0.000 5.282)
+2066 A f 0.857 0.000 ( 0.000 5.282)
+2067 G g 0.857 0.000 ( 0.000 5.282)
+2068 F e 0.761 0.000 ( 0.000 5.428)
+2069 K f 0.761 0.000 ( 0.000 5.428)
+2070 A g 0.761 0.000 ( 0.000 5.428)
+2071 P d 0.621 0.000 ( 0.000 3.393)
+2072 S e 0.621 0.000 ( 0.000 3.393)
+2073 V f 0.621 0.000 ( 0.000 3.393)
+2074 V g 0.621 0.000 ( 0.000 3.393)
+2075 L e 0.610 0.000 ( 0.000 3.191)
+2076 P f 0.610 0.000 ( 0.000 3.191)
+2077 N g 0.610 0.000 ( 0.000 3.191)
+2078 P d 0.538 0.000 ( 0.000 1.919)
+2079 G e 0.538 0.000 ( 0.000 1.919)
+2080 R f 0.538 0.000 ( 0.000 1.919)
+2081 L a 0.714 0.000 ( 0.000 4.956)
+2082 G b 0.714 0.000 ( 0.000 4.956)
+2083 G c 0.714 0.000 ( 0.000 4.956)
+2084 G d 0.714 0.000 ( 0.000 4.956)
+2085 K e 0.714 0.000 ( 0.000 4.956)
+2086 L f 0.714 0.000 ( 0.000 4.956)
+2087 Q g 0.714 0.000 ( 0.000 4.956)
+2088 C a 0.714 0.000 ( 0.000 4.956)
+2089 V b 0.714 0.000 ( 0.000 4.956)
+2090 L c 0.714 0.000 ( 0.000 4.956)
+2091 I a 0.725 0.000 ( 0.000 5.090)
+2092 T b 0.725 0.000 ( 0.000 5.090)
+2093 G c 0.725 0.000 ( 0.000 5.090)
+2094 A d 0.725 0.000 ( 0.000 5.090)
+2095 T e 0.725 0.000 ( 0.000 5.090)
+2096 G f 0.725 0.000 ( 0.000 5.090)
+2097 S g 0.725 0.000 ( 0.000 5.090)
+2098 L a 0.725 0.000 ( 0.000 5.090)
+2099 G b 0.725 0.000 ( 0.000 5.090)
+2100 T c 0.725 0.000 ( 0.000 5.090)
+2101 H d 0.725 0.000 ( 0.000 5.090)
+2102 L e 0.725 0.000 ( 0.000 5.090)
+2103 V f 0.725 0.000 ( 0.000 5.090)
+2104 K g 0.725 0.000 ( 0.000 5.090)
+2105 A a 0.725 0.000 ( 0.000 5.090)
+2106 F b 0.725 0.000 ( 0.000 5.090)
+2107 A c 0.725 0.000 ( 0.000 5.090)
+2108 E d 0.725 0.000 ( 0.000 5.090)
+2109 R e 0.725 0.000 ( 0.000 5.090)
+2110 A f 0.725 0.000 ( 0.000 5.090)
+2111 D g 0.725 0.000 ( 0.000 5.090)
+2112 V a 0.725 0.000 ( 0.000 5.090)
+2113 G b 0.725 0.000 ( 0.000 5.090)
+2114 T c 0.725 0.000 ( 0.000 5.090)
+2115 V d 0.725 0.000 ( 0.000 5.090)
+2116 I e 0.725 0.000 ( 0.000 5.090)
+2117 C f 0.725 0.000 ( 0.000 5.090)
+2118 L g 0.725 0.000 ( 0.000 5.090)
+2119 N f 0.536 0.000 ( 0.000 1.894)
+2120 R a 0.631 0.000 ( 0.000 3.576)
+2121 P b 0.631 0.000 ( 0.000 3.576)
+2122 G c 0.631 0.000 ( 0.000 3.576)
+2123 P d 0.631 0.000 ( 0.000 3.576)
+2124 S a 0.761 0.000 ( 0.000 5.428)
+2125 V b 0.761 0.000 ( 0.000 5.428)
+2126 A c 0.761 0.000 ( 0.000 5.428)
+2127 V d 0.761 0.000 ( 0.000 5.428)
+2128 P e 0.761 0.000 ( 0.000 5.428)
+2129 P f 0.761 0.000 ( 0.000 5.428)
+2130 E a 0.801 0.000 ( 0.000 5.555)
+2131 S a 0.944 0.000 ( 0.001 4.035)
+2132 R b 0.944 0.000 ( 0.001 4.035)
+2133 Q c 0.944 0.000 ( 0.001 4.035)
+2134 L d 0.944 0.000 ( 0.001 4.035)
+2135 E e 0.944 0.000 ( 0.001 4.035)
+2136 A f 0.944 0.000 ( 0.001 4.035)
+2137 M g 0.944 0.000 ( 0.001 4.035)
+2138 A a 0.944 0.000 ( 0.001 4.035)
+2139 A b 0.944 0.000 ( 0.001 4.035)
+2140 R c 0.944 0.000 ( 0.001 4.035)
+2141 G d 0.944 0.000 ( 0.001 4.035)
+2142 V e 0.944 0.000 ( 0.001 4.035)
+2143 T f 0.944 0.000 ( 0.001 4.035)
+2144 I g 0.944 0.000 ( 0.001 4.035)
+2145 N a 0.944 0.000 ( 0.001 4.035)
+2146 D b 0.944 0.000 ( 0.001 4.035)
+2147 E c 0.944 0.000 ( 0.001 4.035)
+2148 A d 0.944 0.000 ( 0.001 4.035)
+2149 R e 0.944 0.000 ( 0.001 4.035)
+2150 A f 0.944 0.000 ( 0.001 4.035)
+2151 K g 0.944 0.000 ( 0.001 4.035)
+2152 L a 0.944 0.000 ( 0.001 4.035)
+2153 C b 0.944 0.000 ( 0.001 4.035)
+2154 F c 0.944 0.000 ( 0.001 4.035)
+2155 I d 0.944 0.000 ( 0.001 4.035)
+2156 E e 0.944 0.000 ( 0.001 4.035)
+2157 T f 0.944 0.000 ( 0.001 4.035)
+2158 D g 0.944 0.000 ( 0.001 4.035)
+2159 S c 0.931 0.000 ( 0.001 4.255)
+2160 S d 0.931 0.000 ( 0.001 4.255)
+2161 K e 0.931 0.000 ( 0.001 4.255)
+2162 A f 0.931 0.000 ( 0.001 4.255)
+2163 R g 0.931 0.000 ( 0.001 4.255)
+2164 L a 0.931 0.000 ( 0.001 4.255)
+2165 G b 0.931 0.000 ( 0.001 4.255)
+2166 L c 0.931 0.000 ( 0.001 4.255)
+2167 G d 0.931 0.000 ( 0.001 4.255)
+2168 E e 0.931 0.000 ( 0.001 4.255)
+2169 E f 0.931 0.000 ( 0.001 4.255)
+2170 E g 0.931 0.000 ( 0.001 4.255)
+2171 Y a 0.931 0.000 ( 0.001 4.255)
+2172 A b 0.931 0.000 ( 0.001 4.255)
+2173 S c 0.931 0.000 ( 0.001 4.255)
+2174 L d 0.931 0.000 ( 0.001 4.255)
+2175 A e 0.931 0.000 ( 0.001 4.255)
+2176 G f 0.931 0.000 ( 0.001 4.255)
+2177 S g 0.931 0.000 ( 0.001 4.255)
+2178 V a 0.931 0.000 ( 0.001 4.255)
+2179 T b 0.931 0.000 ( 0.001 4.255)
+2180 G c 0.931 0.000 ( 0.001 4.255)
+2181 I d 0.931 0.000 ( 0.001 4.255)
+2182 L e 0.931 0.000 ( 0.001 4.255)
+2183 H f 0.931 0.000 ( 0.001 4.255)
+2184 N g 0.931 0.000 ( 0.001 4.255)
+2185 A a 0.738 0.000 ( 0.000 5.237)
+2186 W b 0.738 0.000 ( 0.000 5.237)
+2187 P c 0.738 0.000 ( 0.000 5.237)
+2188 M d 0.738 0.000 ( 0.000 5.237)
+2189 S e 0.738 0.000 ( 0.000 5.237)
+2190 G f 0.738 0.000 ( 0.000 5.237)
+2191 N g 0.738 0.000 ( 0.000 5.237)
+2192 R c 0.733 0.000 ( 0.000 5.182)
+2193 P d 0.733 0.000 ( 0.000 5.182)
+2194 L a 1.020 0.000 ( 0.005 2.630)
+2195 K b 1.020 0.000 ( 0.005 2.630)
+2196 A c 1.020 0.000 ( 0.005 2.630)
+2197 F d 1.020 0.000 ( 0.005 2.630)
+2198 E e 1.020 0.000 ( 0.005 2.630)
+2199 P f 1.020 0.000 ( 0.005 2.630)
+2200 A g 1.020 0.000 ( 0.005 2.630)
+2201 F a 1.033 0.000 ( 0.007 2.399)
+2202 H b 1.033 0.000 ( 0.007 2.399)
+2203 S c 1.033 0.000 ( 0.007 2.399)
+2204 L d 1.033 0.000 ( 0.007 2.399)
+2205 R e 1.033 0.000 ( 0.007 2.399)
+2206 N f 1.033 0.000 ( 0.007 2.399)
+2207 L g 1.033 0.000 ( 0.007 2.399)
+2208 I a 1.033 0.000 ( 0.007 2.399)
+2209 D b 1.033 0.000 ( 0.007 2.399)
+2210 L c 1.033 0.000 ( 0.007 2.399)
+2211 A d 1.033 0.000 ( 0.007 2.399)
+2212 R e 1.033 0.000 ( 0.007 2.399)
+2213 E f 1.033 0.000 ( 0.007 2.399)
+2214 A g 1.033 0.000 ( 0.007 2.399)
+2215 A a 1.033 0.000 ( 0.007 2.399)
+2216 G b 1.033 0.000 ( 0.007 2.399)
+2217 R c 1.033 0.000 ( 0.007 2.399)
+2218 Q d 1.033 0.000 ( 0.007 2.399)
+2219 Q e 1.033 0.000 ( 0.007 2.399)
+2220 K f 1.033 0.000 ( 0.007 2.399)
+2221 I g 1.033 0.000 ( 0.007 2.399)
+2222 R a 1.033 0.000 ( 0.007 2.399)
+2223 F b 1.033 0.000 ( 0.007 2.399)
+2224 Q c 1.033 0.000 ( 0.007 2.399)
+2225 L d 1.033 0.000 ( 0.007 2.399)
+2226 I e 1.033 0.000 ( 0.007 2.399)
+2227 S f 1.033 0.000 ( 0.007 2.399)
+2228 S g 1.033 0.000 ( 0.007 2.399)
+2229 I e 0.966 0.000 ( 0.002 3.630)
+2230 G f 0.966 0.000 ( 0.002 3.630)
+2231 V g 0.966 0.000 ( 0.002 3.630)
+2232 V e 0.815 0.000 ( 0.000 5.536)
+2233 G f 0.815 0.000 ( 0.000 5.536)
+2234 H g 0.815 0.000 ( 0.000 5.536)
+2235 Y g 0.791 0.000 ( 0.000 5.548)
+2236 P b 0.640 0.000 ( 0.000 3.745)
+2237 L c 0.640 0.000 ( 0.000 3.745)
+2238 W d 0.640 0.000 ( 0.000 3.745)
+2239 S e 0.640 0.000 ( 0.000 3.745)
+2240 G f 0.640 0.000 ( 0.000 3.745)
+2241 K a 0.670 0.000 ( 0.000 4.282)
+2242 I b 0.670 0.000 ( 0.000 4.282)
+2243 R c 0.670 0.000 ( 0.000 4.282)
+2244 V d 0.670 0.000 ( 0.000 4.282)
+2245 P e 0.670 0.000 ( 0.000 4.282)
+2246 E f 0.670 0.000 ( 0.000 4.282)
+2247 E g 0.670 0.000 ( 0.000 4.282)
+2248 R a 0.696 0.000 ( 0.000 4.708)
+2249 M b 0.696 0.000 ( 0.000 4.708)
+2250 E c 0.696 0.000 ( 0.000 4.708)
+2251 V d 0.696 0.000 ( 0.000 4.708)
+2252 R e 0.696 0.000 ( 0.000 4.708)
+2253 S f 0.696 0.000 ( 0.000 4.708)
+2254 V g 0.696 0.000 ( 0.000 4.708)
+2255 L a 0.696 0.000 ( 0.000 4.708)
+2256 P b 0.696 0.000 ( 0.000 4.708)
+2257 N c 0.696 0.000 ( 0.000 4.708)
+2258 G d 0.696 0.000 ( 0.000 4.708)
+2259 Y e 0.696 0.000 ( 0.000 4.708)
+2260 C f 0.696 0.000 ( 0.000 4.708)
+2261 D g 0.696 0.000 ( 0.000 4.708)
+2262 G a 0.696 0.000 ( 0.000 4.708)
+2263 K a 0.803 0.000 ( 0.000 5.555)
+2264 F b 0.803 0.000 ( 0.000 5.555)
+2265 T c 0.803 0.000 ( 0.000 5.555)
+2266 C d 0.803 0.000 ( 0.000 5.555)
+2267 E e 0.803 0.000 ( 0.000 5.555)
+2268 R f 0.803 0.000 ( 0.000 5.555)
+2269 I g 0.803 0.000 ( 0.000 5.555)
+2270 L a 0.840 0.000 ( 0.000 5.419)
+2271 D b 0.840 0.000 ( 0.000 5.419)
+2272 E c 0.840 0.000 ( 0.000 5.419)
+2273 T d 0.840 0.000 ( 0.000 5.419)
+2274 L e 0.840 0.000 ( 0.000 5.419)
+2275 H f 0.840 0.000 ( 0.000 5.419)
+2276 R g 0.840 0.000 ( 0.000 5.419)
+2277 Y a 0.840 0.000 ( 0.000 5.419)
+2278 P b 0.840 0.000 ( 0.000 5.419)
+2279 E c 0.840 0.000 ( 0.000 5.419)
+2280 Y d 0.840 0.000 ( 0.000 5.419)
+2281 F e 0.840 0.000 ( 0.000 5.419)
+2282 H f 0.840 0.000 ( 0.000 5.419)
+2283 T g 0.840 0.000 ( 0.000 5.419)
+2284 M a 0.840 0.000 ( 0.000 5.419)
+2285 S b 0.840 0.000 ( 0.000 5.419)
+2286 A c 0.840 0.000 ( 0.000 5.419)
+2287 R d 0.840 0.000 ( 0.000 5.419)
+2288 L e 0.840 0.000 ( 0.000 5.419)
+2289 G f 0.840 0.000 ( 0.000 5.419)
+2290 Q g 0.840 0.000 ( 0.000 5.419)
+2291 V a 0.840 0.000 ( 0.000 5.419)
+2292 A b 0.840 0.000 ( 0.000 5.419)
+2293 G c 0.840 0.000 ( 0.000 5.419)
+2294 S d 0.840 0.000 ( 0.000 5.419)
+2295 K e 0.840 0.000 ( 0.000 5.419)
+2296 T f 0.840 0.000 ( 0.000 5.419)
+2297 S g 0.840 0.000 ( 0.000 5.419)
+2298 G d 0.634 0.000 ( 0.000 3.633)
+2299 Y e 0.634 0.000 ( 0.000 3.633)
+2300 W f 0.634 0.000 ( 0.000 3.633)
+2301 N g 0.634 0.000 ( 0.000 3.633)
+2302 P g 0.532 0.000 ( 0.000 1.832)
+2303 V a 0.532 0.000 ( 0.000 1.832)
+2304 E b 0.532 0.000 ( 0.000 1.832)
+2305 H a 0.603 0.000 ( 0.000 3.059)
+2306 F b 0.603 0.000 ( 0.000 3.059)
+2307 C c 0.603 0.000 ( 0.000 3.059)
+2308 F d 0.603 0.000 ( 0.000 3.059)
+2309 M e 0.603 0.000 ( 0.000 3.059)
+2310 V f 0.603 0.000 ( 0.000 3.059)
+2311 K g 0.603 0.000 ( 0.000 3.059)
+2312 S a 0.603 0.000 ( 0.000 3.059)
+2313 S b 0.603 0.000 ( 0.000 3.059)
+2314 Q c 0.603 0.000 ( 0.000 3.059)
+2315 N d 0.603 0.000 ( 0.000 3.059)
+2316 L e 0.603 0.000 ( 0.000 3.059)
+2317 R f 0.603 0.000 ( 0.000 3.059)
+2318 V g 0.603 0.000 ( 0.000 3.059)
+2319 L a 0.603 0.000 ( 0.000 3.059)
+2320 P b 0.603 0.000 ( 0.000 3.059)
+2321 Q c 0.603 0.000 ( 0.000 3.059)
+2322 L d 0.603 0.000 ( 0.000 3.059)
+2323 E e 0.603 0.000 ( 0.000 3.059)
+2324 G f 0.603 0.000 ( 0.000 3.059)
+2325 N g 0.603 0.000 ( 0.000 3.059)
+2326 L a 0.603 0.000 ( 0.000 3.059)
+2327 T b 0.603 0.000 ( 0.000 3.059)
+2328 W c 0.603 0.000 ( 0.000 3.059)
+2329 C d 0.603 0.000 ( 0.000 3.059)
+2330 P e 0.603 0.000 ( 0.000 3.059)
+2331 V f 0.603 0.000 ( 0.000 3.059)
+2332 N g 0.603 0.000 ( 0.000 3.059)
+2333 D a 0.590 0.000 ( 0.000 2.805)
+2334 M b 0.590 0.000 ( 0.000 2.805)
+2335 A c 0.590 0.000 ( 0.000 2.805)
+2336 S d 0.590 0.000 ( 0.000 2.805)
+2337 A e 0.590 0.000 ( 0.000 2.805)
+2338 L f 0.590 0.000 ( 0.000 2.805)
+2339 S g 0.590 0.000 ( 0.000 2.805)
+2340 D g 0.565 0.000 ( 0.000 2.367)
+2341 L d 0.527 0.000 ( 0.000 1.752)
+2342 L e 0.527 0.000 ( 0.000 1.752)
+2343 L f 0.527 0.000 ( 0.000 1.752)
+2344 L g 0.527 0.000 ( 0.000 1.752)
+2345 P e 0.438 0.000 ( 0.000 0.738)
+2346 F f 0.438 0.000 ( 0.000 0.738)
+2347 R g 0.438 0.000 ( 0.000 0.738)
+2348 P a 0.440 0.000 ( 0.000 0.755)
+2349 Q b 0.440 0.000 ( 0.000 0.755)
+2350 P c 0.440 0.000 ( 0.000 0.755)
+2351 I a 0.528 0.000 ( 0.000 1.776)
+2352 Y a 0.579 0.000 ( 0.000 2.612)
+2353 H b 0.579 0.000 ( 0.000 2.612)
+2354 I c 0.579 0.000 ( 0.000 2.612)
+2355 D d 0.579 0.000 ( 0.000 2.612)
+2356 N e 0.579 0.000 ( 0.000 2.612)
+2357 P f 0.579 0.000 ( 0.000 2.612)
+2358 V g 0.579 0.000 ( 0.000 2.612)
+2359 Q a 0.579 0.000 ( 0.000 2.612)
+2360 Q b 0.579 0.000 ( 0.000 2.612)
+2361 P c 0.579 0.000 ( 0.000 2.612)
+2362 W a 0.594 0.000 ( 0.000 2.895)
+2363 S b 0.594 0.000 ( 0.000 2.895)
+2364 E c 0.594 0.000 ( 0.000 2.895)
+2365 M d 0.594 0.000 ( 0.000 2.895)
+2366 V a 0.719 0.000 ( 0.000 5.017)
+2367 R b 0.719 0.000 ( 0.000 5.017)
+2368 M c 0.719 0.000 ( 0.000 5.017)
+2369 L d 0.719 0.000 ( 0.000 5.017)
+2370 A e 0.719 0.000 ( 0.000 5.017)
+2371 K f 0.719 0.000 ( 0.000 5.017)
+2372 A g 0.719 0.000 ( 0.000 5.017)
+2373 L a 0.719 0.000 ( 0.000 5.017)
+2374 D b 0.719 0.000 ( 0.000 5.017)
+2375 I c 0.719 0.000 ( 0.000 5.017)
+2376 P d 0.719 0.000 ( 0.000 5.017)
+2377 Q e 0.719 0.000 ( 0.000 5.017)
+2378 S f 0.719 0.000 ( 0.000 5.017)
+2379 N g 0.719 0.000 ( 0.000 5.017)
+2380 I a 0.719 0.000 ( 0.000 5.017)
+2381 I b 0.719 0.000 ( 0.000 5.017)
+2382 P c 0.719 0.000 ( 0.000 5.017)
+2383 F d 0.719 0.000 ( 0.000 5.017)
+2384 D e 0.719 0.000 ( 0.000 5.017)
+2385 D f 0.719 0.000 ( 0.000 5.017)
+2386 W g 0.719 0.000 ( 0.000 5.017)
+2387 V a 0.719 0.000 ( 0.000 5.017)
+2388 A b 0.719 0.000 ( 0.000 5.017)
+2389 R c 0.719 0.000 ( 0.000 5.017)
+2390 V d 0.719 0.000 ( 0.000 5.017)
+2391 R e 0.719 0.000 ( 0.000 5.017)
+2392 R f 0.719 0.000 ( 0.000 5.017)
+2393 S g 0.719 0.000 ( 0.000 5.017)
+2394 P f 0.579 0.000 ( 0.000 2.616)
+2395 L g 0.579 0.000 ( 0.000 2.616)
+2396 A a 0.643 0.000 ( 0.000 3.804)
+2397 P b 0.643 0.000 ( 0.000 3.804)
+2398 E c 0.643 0.000 ( 0.000 3.804)
+2399 T d 0.643 0.000 ( 0.000 3.804)
+2400 D e 0.643 0.000 ( 0.000 3.804)
+2401 N f 0.643 0.000 ( 0.000 3.804)
+2402 P g 0.643 0.000 ( 0.000 3.804)
+2403 A a 0.746 0.000 ( 0.000 5.315)
+2404 A b 0.746 0.000 ( 0.000 5.315)
+2405 R c 0.746 0.000 ( 0.000 5.315)
+2406 L d 0.746 0.000 ( 0.000 5.315)
+2407 I e 0.746 0.000 ( 0.000 5.315)
+2408 D f 0.746 0.000 ( 0.000 5.315)
+2409 F g 0.746 0.000 ( 0.000 5.315)
+2410 L a 0.746 0.000 ( 0.000 5.315)
+2411 E b 0.746 0.000 ( 0.000 5.315)
+2412 F c 0.746 0.000 ( 0.000 5.315)
+2413 H d 0.746 0.000 ( 0.000 5.315)
+2414 F e 0.746 0.000 ( 0.000 5.315)
+2415 R f 0.746 0.000 ( 0.000 5.315)
+2416 R g 0.746 0.000 ( 0.000 5.315)
+2417 M a 0.746 0.000 ( 0.000 5.315)
+2418 S b 0.746 0.000 ( 0.000 5.315)
+2419 C c 0.746 0.000 ( 0.000 5.315)
+2420 G d 0.746 0.000 ( 0.000 5.315)
+2421 G e 0.746 0.000 ( 0.000 5.315)
+2422 L f 0.746 0.000 ( 0.000 5.315)
+2423 L g 0.746 0.000 ( 0.000 5.315)
+2424 L a 0.746 0.000 ( 0.000 5.315)
+2425 D b 0.746 0.000 ( 0.000 5.315)
+2426 L c 0.746 0.000 ( 0.000 5.315)
+2427 S d 0.746 0.000 ( 0.000 5.315)
+2428 K e 0.746 0.000 ( 0.000 5.315)
+2429 A f 0.746 0.000 ( 0.000 5.315)
+2430 C g 0.746 0.000 ( 0.000 5.315)
+2431 H f 0.712 0.000 ( 0.000 4.925)
+2432 D g 0.712 0.000 ( 0.000 4.925)
+2433 S a 0.712 0.000 ( 0.000 4.925)
+2434 P b 0.712 0.000 ( 0.000 4.925)
+2435 A c 0.712 0.000 ( 0.000 4.925)
+2436 L d 0.712 0.000 ( 0.000 4.925)
+2437 A e 0.712 0.000 ( 0.000 4.925)
+2438 A f 0.712 0.000 ( 0.000 4.925)
+2439 V g 0.712 0.000 ( 0.000 4.925)
+2440 G a 0.712 0.000 ( 0.000 4.925)
+2441 P b 0.712 0.000 ( 0.000 4.925)
+2442 V c 0.712 0.000 ( 0.000 4.925)
+2443 N d 0.712 0.000 ( 0.000 4.925)
+2444 E e 0.712 0.000 ( 0.000 4.925)
+2445 D f 0.712 0.000 ( 0.000 4.925)
+2446 M g 0.712 0.000 ( 0.000 4.925)
+2447 V a 0.712 0.000 ( 0.000 4.925)
+2448 R b 0.712 0.000 ( 0.000 4.925)
+2449 K c 0.712 0.000 ( 0.000 4.925)
+2450 Y d 0.712 0.000 ( 0.000 4.925)
+2451 V e 0.712 0.000 ( 0.000 4.925)
+2452 S f 0.712 0.000 ( 0.000 4.925)
+2453 S g 0.712 0.000 ( 0.000 4.925)
+2454 W e 0.645 0.000 ( 0.000 3.834)
+2455 K f 0.645 0.000 ( 0.000 3.834)
+2456 K g 0.645 0.000 ( 0.000 3.834)
+2457 M a 0.645 0.000 ( 0.000 3.834)
+2458 G b 0.645 0.000 ( 0.000 3.834)
+2459 F c 0.645 0.000 ( 0.000 3.834)
+2460 L d 0.645 0.000 ( 0.000 3.834)
+2461 A e 0.645 0.000 ( 0.000 3.834)
+2462 Q f 0.645 0.000 ( 0.000 3.834)
+2463 G g 0.645 0.000 ( 0.000 3.834)
+2464 N g 0.596 0.000 ( 0.000 2.914)
+2465 R g 0.431 0.000 ( 0.000 0.679)
Added: trunk/packages/norsp/trunk/example/query.fasta
===================================================================
--- trunk/packages/norsp/trunk/example/query.fasta (rev 0)
+++ trunk/packages/norsp/trunk/example/query.fasta 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,51 @@
+>query
+VSELPARWHE LAKQFPKLER IPGERLLNDL RDWFHNDDPD KRDKITSQLP
+NTLLTPLVVL TQLAHFARYL SYNPSGGSVH ADDLFRALAQ RGVETVGLCT
+GLLSASAVSS ASDAATFRQY GAVAAYISVL FDENRATVTT AEATAPLMLQ
+QIRQKGIKAA EVRLRGRFHS EVHNEDLRRV LQFCDLDPAF QFPETSALAF
+PIHLGKGGCR AKRLHHAVLG MILAEQAAWY ETLSGALPAH PQAVIVTFGP
+DSGVPPSLLR KMGSRLVHAS DLNWAPTLLS PKDGALNPPG SYTAWSAARG
+NENDSDIVVV GMSCRVAGAD DLDEFWKILC AGKSQHIEVP GERFGVETQW
+RDVDSSRKWY GNFIRDHDTF DHKFFKKSPR EMTSSDPQQR LMLQCAYQAV
+EQSGYFHQAK VDTKNLSGAS FLSPTGQCKP WDQGADGYCR GEAAAVVFLK
+RRADAVADGN RILGCISSTA VYQNENCTPV FVPNSPSLTY LFKDVLDRAK
+LEPRDISVVE AHGTGTPVGD PAEYLSVLQA LGGSLRDKPL ALGSVKGLIG
+HTEGASGVVS LIKIILMMQH GYVPPQASFQ SLAHNIAASP SDKIEIVTKL
+RSWDADYRAA LINNYGASGS NASMVVTPPP QPNRAALSPI HAPGIKHPFW
+LCGLDDKALI AYSKRLRHFI AHKTSSYSST ATISLANLSF NVCRQSNRHL
+DRALMFSCSS LGELDEKLAL FIDGDAKLGS TSTKTITKRR PVIMCFGGQV
+SSFVGLDRQV YDSVKIVRDY LDQCNAVFLS IGLEGIFPAV FQREPIEDPV
+RLQTALFAVQ YACAKSWMDS GIQAEAVVGH SFGELTALCV SGVLSLLDAS
+KMIVARAKLV RDTWGSDRGA MAAVEADLDM VRSAIESHNR AMVDDELPVT
+IACYNGPRSF TLAGPTKSMD KFVETLTGSP MYSPVMRVKR LNVTHAFHSV
+LVEPLIDELD AIGRTLTFRE PSILLERSTK ELNLETTSEF VAQHMRQPVF
+FEHAVKRLAE QYPDAAWIEA GSASTITNMA SRALGSPSTY HFQSLNITCD
+HGMKSLADAT LALWKAGVET AYWPHHPGQT YEFDHLFLPP YQFEKVKHWM
+DLKKPQKGLV ELPAAEAGNV EARVPVGLWS FLGYDDSKEQ TARFVVNTDS
+KKYHDFVSGH LIANTAPICP ATLEVDMAIE ALMSIRPDLK TDGMQPTIQN
+LQNHSPICVD PSRQVFIVYT ASDIRGHVWE WKMTSSPAQG PGPTTEHVHG
+SIVFRSPEDP GYQAEFGRYG RHFTHQRCLD VLNAVEADDI IQGRNIYKTF
+AEIVDYGEQY RGLKRLVGRG SECAGRVSKR WTGETWLDTH LSDCFSQVGG
+IWVNCMTNRA PDDMYIASGC ELVIRSPNLR PDGPRPEIWD VFATHHRVSD
+KLYVTDIFTF DSTSGELLDV MIGIKYAKIS KPSMQKILAR LSPGVCVPPP
+PGLGTAPVTH NKTSREPIEP SEASGAVPTA TGATVSKSFK AGGAEVSKKQ
+PENTRANIKK QVRDLLANVA GVEPADISES TVLSDIGIDS LMGMELAREA
+ETVMKCTLSP DKLMEAFDFP SFVDCVISAL GITADGQEEE MEEEQDDKQE
+KEEGARQRVQ ESEPTTDDEQ YRPYKAQDAS WSQSSGTSTP PSSLDDDLNE
+LTLPAGAVLE SFGKTKLLTD EMIRRYKVDT FANVIAPKST QLCIALTLEA
+FEKLGVSIRA TKAGQVVPRI NYAPQHQRLV DYLYRLLENE ARLIDSTDRG
+EHVRTAVSPP KKASVALLQD LVRLYPDWSN AQKLTHFAGS RLADVLEGKT
+DGIKIIFGSD EGRALVGGLY CDHVFNKMNY QQMADCLEGL VSKLPADQGP
+LRILELGAGT GGTTLYVAPM LERLQVPVEY VFTDISPSMV SAAKKKFGKY
+AFMKYMVHDM EKPMSAELLG TQHIVIASNA VHATRDLVKT GTNIHNALRP
+DGFLMMLEMT EIVPFVDTIF GLLEGWWLFD DGRQHAITGP EGWEKAMHSA
+GFGHVDWTDG HLPESKIQKV IVAMASGPVQ ERLPPPPPPA RKAAESGPDL
+ASREEDISAY VQKFSAGFKA PSVVLPNPGR LGGGKLQCVL ITGATGSLGT
+HLVKAFAERA DVGTVICLNR PGPSVAVPPE SRQLEAMAAR GVTINDEARA
+KLCFIETDSS KARLGLGEEE YASLAGSVTG ILHNAWPMSG NRPLKAFEPA
+FHSLRNLIDL AREAAGRQQK IRFQLISSIG VVGHYPLWSG KIRVPEERME
+VRSVLPNGYC DGKFTCERIL DETLHRYPEY FHTMSARLGQ VAGSKTSGYW
+NPVEHFCFMV KSSQNLRVLP QLEGNLTWCP VNDMASALSD LLLLPFRPQP
+IYHIDNPVQQ PWSEMVRMLA KALDIPQSNI IPFDDWVARV RRSPLAPETD
+NPAARLIDFL EFHFRRMSCG GLLLDLSKAC HDSPALAAVG PVNEDMVRKY
+VSSWKKMGFL AQGNR
Added: trunk/packages/norsp/trunk/example/query.hssp
===================================================================
--- trunk/packages/norsp/trunk/example/query.hssp (rev 0)
+++ trunk/packages/norsp/trunk/example/query.hssp 2012-07-13 12:02:04 UTC (rev 11778)
@@ -0,0 +1,103994 @@
+HSSP HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 1.0 1991
+PDBID query
+DATE file generated on 22-Dec-10
+SEQBASE /tmp/yAG8JouWL1/COPF-tmp28126.msf_tmp
+PARAMETER CONVERTSEQ of query
+THRESHOLD according to: ALL
+REFERENCE Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
+CONTACT e-mail (INTERNET) Schneider at EMBL-Heidelberg.DE or Sander at EMBL-Heidelberg.DE