[med-svn] [toppred] 01/02: Imported Upstream version 1.10

Andreas Tille tille at debian.org
Sat Jan 31 11:56:36 UTC 2015


This is an automated email from the git hooks/post-receive script.

tille pushed a commit to branch master
in repository toppred.

commit 54df7def0373cf31c097bf1866acf368fb1faf48
Author: Andreas Tille <tille at debian.org>
Date:   Sat Jan 31 12:49:37 2015 +0100

    Imported Upstream version 1.10
---
 AUTHORS                   |    4 +
 COPYING                   |  340 +++
 ChangeLog                 |  287 +++
 INSTALL                   |  236 ++
 LICENSE                   |  340 +++
 Makefile.am               |    5 +
 Makefile.in               |  557 +++++
 NEWS                      |    1 +
 README                    |   28 +
 TODO                      |    7 +
 aclocal.m4                | 1045 ++++++++
 config.guess              | 1463 ++++++++++++
 config.sub                | 1579 ++++++++++++
 configure                 | 5792 +++++++++++++++++++++++++++++++++++++++++++++
 configure.in              |   48 +
 data/CYTEXT-scale         |   24 +
 data/GES-scale            |   25 +
 data/GVH-scale            |   25 +
 data/KD-scale             |   25 +
 data/Makefile.am          |    3 +
 data/Makefile.in          |  319 +++
 data/toppred.dtd          |  101 +
 depcomp                   |  530 +++++
 doc/Makefile.am           |   14 +
 doc/Makefile.in           |  352 +++
 doc/toppred.1             |  341 +++
 doc/toppred.pod           |  257 ++
 install-sh                |  323 +++
 m4/Makefile.am            |    2 +
 m4/Makefile.in            |  290 +++
 m4/aclibgd.m4             |   92 +
 missing                   |  360 +++
 mkinstalldirs             |  158 ++
 src/Makefile.am           |   27 +
 src/Makefile.in           |  465 ++++
 src/charge.c              |  296 +++
 src/charge.h              |   41 +
 src/config.h.in           |   96 +
 src/error.c               |   44 +
 src/error.h               |   10 +
 src/graph.c               |  439 ++++
 src/graph.h               |   33 +
 src/loop.c                |  300 +++
 src/loop.h                |   55 +
 src/main.c                |  556 +++++
 src/main.h                |   26 +
 src/mloutput.c            |  161 ++
 src/mloutput.h            |   26 +
 src/output.c              |  132 ++
 src/output.h              |   19 +
 src/params.h              |   49 +
 src/profile.c             |  368 +++
 src/profile.h             |   38 +
 src/seq-reader.c          |  245 ++
 src/seq-reader.h          |   45 +
 src/topology.c            |  181 ++
 src/topology.h            |   41 +
 src/topoprint.c           |  296 +++
 src/topoprint.h           |   68 +
 src/usage.c               |  116 +
 src/usage.h               |   30 +
 test/Makefile.am          |   26 +
 test/Makefile.in          |  385 +++
 test/construct_topos.test |   31 +
 test/detect_segments.test |   31 +
 test/first_seg.err        |    0
 test/first_seg.fasta      |    4 +
 test/first_seg.out        |   67 +
 test/hydro.test           |   18 +
 test/last_seg.err         |    0
 test/last_seg.fasta       |    2 +
 test/last_seg.out         |   36 +
 test/math.test            |   15 +
 test/min_seqlen.err       |    0
 test/min_seqlen.fasta     |    2 +
 test/min_seqlen.out       |   35 +
 test/more_calc.err        |    1 +
 test/more_calc.fasta      |    8 +
 test/more_calc.out        |  256 ++
 test/naming.test          |   23 +
 test/no_error.err         |    0
 test/no_seg.err           |    0
 test/no_seg.fasta         |    2 +
 test/no_seg.out           |   23 +
 test/only_put.err         |    0
 test/only_put.fasta       |    2 +
 test/only_put.out         |   55 +
 test/seq-test             |   12 +
 test/seq_anonymous.err    |    1 +
 test/seq_anonymous.fasta  |    3 +
 test/seq_zero_div.fasta   |    2 +
 test/seqlen.test          |   17 +
 test/too_many_put.err     |    1 +
 test/too_many_put.fasta   |   24 +
 test/too_many_put.out     |   63 +
 test/toppred.test         |   15 +
 96 files changed, 20336 insertions(+)

diff --git a/AUTHORS b/AUTHORS
new file mode 100644
index 0000000..98fc7a3
--- /dev/null
+++ b/AUTHORS
@@ -0,0 +1,4 @@
+
+Eric Deveaud   <edeveaud at pasteur.fr>  
+Katja Schuerer
+
diff --git a/COPYING b/COPYING
new file mode 100644
index 0000000..d60c31a
--- /dev/null
+++ b/COPYING
@@ -0,0 +1,340 @@
+		    GNU GENERAL PUBLIC LICENSE
+		       Version 2, June 1991
+
+ Copyright (C) 1989, 1991 Free Software Foundation, Inc.
+     59 Temple Place, Suite 330, Boston, MA  02111-1307  USA
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+
+			    Preamble
+
+  The licenses for most software are designed to take away your
+freedom to share and change it.  By contrast, the GNU General Public
+License is intended to guarantee your freedom to share and change free
+software--to make sure the software is free for all its users.  This
+General Public License applies to most of the Free Software
+Foundation's software and to any other program whose authors commit to
+using it.  (Some other Free Software Foundation software is covered by
+the GNU Library General Public License instead.)  You can apply it to
+your programs, too.
+
+  When we speak of free software, we are referring to freedom, not
+price.  Our General Public Licenses are designed to make sure that you
+have the freedom to distribute copies of free software (and charge for
+this service if you wish), that you receive source code or can get it
+if you want it, that you can change the software or use pieces of it
+in new free programs; and that you know you can do these things.
+
+  To protect your rights, we need to make restrictions that forbid
+anyone to deny you these rights or to ask you to surrender the rights.
+These restrictions translate to certain responsibilities for you if you
+distribute copies of the software, or if you modify it.
+
+  For example, if you distribute copies of such a program, whether
+gratis or for a fee, you must give the recipients all the rights that
+you have.  You must make sure that they, too, receive or can get the
+source code.  And you must show them these terms so they know their
+rights.
+
+  We protect your rights with two steps: (1) copyright the software, and
+(2) offer you this license which gives you legal permission to copy,
+distribute and/or modify the software.
+
+  Also, for each author's protection and ours, we want to make certain
+that everyone understands that there is no warranty for this free
+software.  If the software is modified by someone else and passed on, we
+want its recipients to know that what they have is not the original, so
+that any problems introduced by others will not reflect on the original
+authors' reputations.
+
+  Finally, any free program is threatened constantly by software
+patents.  We wish to avoid the danger that redistributors of a free
+program will individually obtain patent licenses, in effect making the
+program proprietary.  To prevent this, we have made it clear that any
+patent must be licensed for everyone's free use or not licensed at all.
+
+  The precise terms and conditions for copying, distribution and
+modification follow.
+

+		    GNU GENERAL PUBLIC LICENSE
+   TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
+
+  0. This License applies to any program or other work which contains
+a notice placed by the copyright holder saying it may be distributed
+under the terms of this General Public License.  The "Program", below,
+refers to any such program or work, and a "work based on the Program"
+means either the Program or any derivative work under copyright law:
+that is to say, a work containing the Program or a portion of it,
+either verbatim or with modifications and/or translated into another
+language.  (Hereinafter, translation is included without limitation in
+the term "modification".)  Each licensee is addressed as "you".
+
+Activities other than copying, distribution and modification are not
+covered by this License; they are outside its scope.  The act of
+running the Program is not restricted, and the output from the Program
+is covered only if its contents constitute a work based on the
+Program (independent of having been made by running the Program).
+Whether that is true depends on what the Program does.
+
+  1. You may copy and distribute verbatim copies of the Program's
+source code as you receive it, in any medium, provided that you
+conspicuously and appropriately publish on each copy an appropriate
+copyright notice and disclaimer of warranty; keep intact all the
+notices that refer to this License and to the absence of any warranty;
+and give any other recipients of the Program a copy of this License
+along with the Program.
+
+You may charge a fee for the physical act of transferring a copy, and
+you may at your option offer warranty protection in exchange for a fee.
+
+  2. You may modify your copy or copies of the Program or any portion
+of it, thus forming a work based on the Program, and copy and
+distribute such modifications or work under the terms of Section 1
+above, provided that you also meet all of these conditions:
+
+    a) You must cause the modified files to carry prominent notices
+    stating that you changed the files and the date of any change.
+
+    b) You must cause any work that you distribute or publish, that in
+    whole or in part contains or is derived from the Program or any
+    part thereof, to be licensed as a whole at no charge to all third
+    parties under the terms of this License.
+
+    c) If the modified program normally reads commands interactively
+    when run, you must cause it, when started running for such
+    interactive use in the most ordinary way, to print or display an
+    announcement including an appropriate copyright notice and a
+    notice that there is no warranty (or else, saying that you provide
+    a warranty) and that users may redistribute the program under
+    these conditions, and telling the user how to view a copy of this
+    License.  (Exception: if the Program itself is interactive but
+    does not normally print such an announcement, your work based on
+    the Program is not required to print an announcement.)
+

+These requirements apply to the modified work as a whole.  If
+identifiable sections of that work are not derived from the Program,
+and can be reasonably considered independent and separate works in
+themselves, then this License, and its terms, do not apply to those
+sections when you distribute them as separate works.  But when you
+distribute the same sections as part of a whole which is a work based
+on the Program, the distribution of the whole must be on the terms of
+this License, whose permissions for other licensees extend to the
+entire whole, and thus to each and every part regardless of who wrote it.
+
+Thus, it is not the intent of this section to claim rights or contest
+your rights to work written entirely by you; rather, the intent is to
+exercise the right to control the distribution of derivative or
+collective works based on the Program.
+
+In addition, mere aggregation of another work not based on the Program
+with the Program (or with a work based on the Program) on a volume of
+a storage or distribution medium does not bring the other work under
+the scope of this License.
+
+  3. You may copy and distribute the Program (or a work based on it,
+under Section 2) in object code or executable form under the terms of
+Sections 1 and 2 above provided that you also do one of the following:
+
+    a) Accompany it with the complete corresponding machine-readable
+    source code, which must be distributed under the terms of Sections
+    1 and 2 above on a medium customarily used for software interchange; or,
+
+    b) Accompany it with a written offer, valid for at least three
+    years, to give any third party, for a charge no more than your
+    cost of physically performing source distribution, a complete
+    machine-readable copy of the corresponding source code, to be
+    distributed under the terms of Sections 1 and 2 above on a medium
+    customarily used for software interchange; or,
+
+    c) Accompany it with the information you received as to the offer
+    to distribute corresponding source code.  (This alternative is
+    allowed only for noncommercial distribution and only if you
+    received the program in object code or executable form with such
+    an offer, in accord with Subsection b above.)
+
+The source code for a work means the preferred form of the work for
+making modifications to it.  For an executable work, complete source
+code means all the source code for all modules it contains, plus any
+associated interface definition files, plus the scripts used to
+control compilation and installation of the executable.  However, as a
+special exception, the source code distributed need not include
+anything that is normally distributed (in either source or binary
+form) with the major components (compiler, kernel, and so on) of the
+operating system on which the executable runs, unless that component
+itself accompanies the executable.
+
+If distribution of executable or object code is made by offering
+access to copy from a designated place, then offering equivalent
+access to copy the source code from the same place counts as
+distribution of the source code, even though third parties are not
+compelled to copy the source along with the object code.
+

+  4. You may not copy, modify, sublicense, or distribute the Program
+except as expressly provided under this License.  Any attempt
+otherwise to copy, modify, sublicense or distribute the Program is
+void, and will automatically terminate your rights under this License.
+However, parties who have received copies, or rights, from you under
+this License will not have their licenses terminated so long as such
+parties remain in full compliance.
+
+  5. You are not required to accept this License, since you have not
+signed it.  However, nothing else grants you permission to modify or
+distribute the Program or its derivative works.  These actions are
+prohibited by law if you do not accept this License.  Therefore, by
+modifying or distributing the Program (or any work based on the
+Program), you indicate your acceptance of this License to do so, and
+all its terms and conditions for copying, distributing or modifying
+the Program or works based on it.
+
+  6. Each time you redistribute the Program (or any work based on the
+Program), the recipient automatically receives a license from the
+original licensor to copy, distribute or modify the Program subject to
+these terms and conditions.  You may not impose any further
+restrictions on the recipients' exercise of the rights granted herein.
+You are not responsible for enforcing compliance by third parties to
+this License.
+
+  7. If, as a consequence of a court judgment or allegation of patent
+infringement or for any other reason (not limited to patent issues),
+conditions are imposed on you (whether by court order, agreement or
+otherwise) that contradict the conditions of this License, they do not
+excuse you from the conditions of this License.  If you cannot
+distribute so as to satisfy simultaneously your obligations under this
+License and any other pertinent obligations, then as a consequence you
+may not distribute the Program at all.  For example, if a patent
+license would not permit royalty-free redistribution of the Program by
+all those who receive copies directly or indirectly through you, then
+the only way you could satisfy both it and this License would be to
+refrain entirely from distribution of the Program.
+
+If any portion of this section is held invalid or unenforceable under
+any particular circumstance, the balance of the section is intended to
+apply and the section as a whole is intended to apply in other
+circumstances.
+
+It is not the purpose of this section to induce you to infringe any
+patents or other property right claims or to contest validity of any
+such claims; this section has the sole purpose of protecting the
+integrity of the free software distribution system, which is
+implemented by public license practices.  Many people have made
+generous contributions to the wide range of software distributed
+through that system in reliance on consistent application of that
+system; it is up to the author/donor to decide if he or she is willing
+to distribute software through any other system and a licensee cannot
+impose that choice.
+
+This section is intended to make thoroughly clear what is believed to
+be a consequence of the rest of this License.
+

+  8. If the distribution and/or use of the Program is restricted in
+certain countries either by patents or by copyrighted interfaces, the
+original copyright holder who places the Program under this License
+may add an explicit geographical distribution limitation excluding
+those countries, so that distribution is permitted only in or among
+countries not thus excluded.  In such case, this License incorporates
+the limitation as if written in the body of this License.
+
+  9. The Free Software Foundation may publish revised and/or new versions
+of the General Public License from time to time.  Such new versions will
+be similar in spirit to the present version, but may differ in detail to
+address new problems or concerns.
+
+Each version is given a distinguishing version number.  If the Program
+specifies a version number of this License which applies to it and "any
+later version", you have the option of following the terms and conditions
+either of that version or of any later version published by the Free
+Software Foundation.  If the Program does not specify a version number of
+this License, you may choose any version ever published by the Free Software
+Foundation.
+
+  10. If you wish to incorporate parts of the Program into other free
+programs whose distribution conditions are different, write to the author
+to ask for permission.  For software which is copyrighted by the Free
+Software Foundation, write to the Free Software Foundation; we sometimes
+make exceptions for this.  Our decision will be guided by the two goals
+of preserving the free status of all derivatives of our free software and
+of promoting the sharing and reuse of software generally.
+
+			    NO WARRANTY
+
+  11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY
+FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW.  EXCEPT WHEN
+OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES
+PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED
+OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
+MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE.  THE ENTIRE RISK AS
+TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU.  SHOULD THE
+PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING,
+REPAIR OR CORRECTION.
+
+  12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
+WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR
+REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES,
+INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING
+OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED
+TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY
+YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER
+PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
+POSSIBILITY OF SUCH DAMAGES.
+
+		     END OF TERMS AND CONDITIONS
+

+	    How to Apply These Terms to Your New Programs
+
+  If you develop a new program, and you want it to be of the greatest
+possible use to the public, the best way to achieve this is to make it
+free software which everyone can redistribute and change under these terms.
+
+  To do so, attach the following notices to the program.  It is safest
+to attach them to the start of each source file to most effectively
+convey the exclusion of warranty; and each file should have at least
+the "copyright" line and a pointer to where the full notice is found.
+
+    <one line to give the program's name and a brief idea of what it does.>
+    Copyright (C) <year>  <name of author>
+
+    This program is free software; you can redistribute it and/or modify
+    it under the terms of the GNU General Public License as published by
+    the Free Software Foundation; either version 2 of the License, or
+    (at your option) any later version.
+
+    This program is distributed in the hope that it will be useful,
+    but WITHOUT ANY WARRANTY; without even the implied warranty of
+    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+    GNU General Public License for more details.
+
+    You should have received a copy of the GNU General Public License
+    along with this program; if not, write to the Free Software
+    Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA  02111-1307  USA
+
+
+Also add information on how to contact you by electronic and paper mail.
+
+If the program is interactive, make it output a short notice like this
+when it starts in an interactive mode:
+
+    Gnomovision version 69, Copyright (C) year  name of author
+    Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'.
+    This is free software, and you are welcome to redistribute it
+    under certain conditions; type `show c' for details.
+
+The hypothetical commands `show w' and `show c' should show the appropriate
+parts of the General Public License.  Of course, the commands you use may
+be called something other than `show w' and `show c'; they could even be
+mouse-clicks or menu items--whatever suits your program.
+
+You should also get your employer (if you work as a programmer) or your
+school, if any, to sign a "copyright disclaimer" for the program, if
+necessary.  Here is a sample; alter the names:
+
+  Yoyodyne, Inc., hereby disclaims all copyright interest in the program
+  `Gnomovision' (which makes passes at compilers) written by James Hacker.
+
+  <signature of Ty Coon>, 1 April 1989
+  Ty Coon, President of Vice
+
+This General Public License does not permit incorporating your program into
+proprietary programs.  If your program is a subroutine library, you may
+consider it more useful to permit linking proprietary applications with the
+library.  If this is what you want to do, use the GNU Library General
+Public License instead of this License.
diff --git a/ChangeLog b/ChangeLog
new file mode 100644
index 0000000..6684d9d
--- /dev/null
+++ b/ChangeLog
@@ -0,0 +1,287 @@
+2008-10-22  Eric  Deveaud  <edeveaud at raclette-tete1.calcul.pasteur.fr>
+
+	* configure.in: Changed version to 1.10
+
+2008-05-06  Nicolas Joly  <njoly at pasteur.fr>
+
+	* doc/toppred.pod: Add missing option `-t none' in example
+	command.
+
+	* src/*.[ch]: Remove XML output, which was unused and broken too
+	often without notice ...
+	* doc/toppred.pod: Adjust.
+
+2008-04-18  Nicolas Joly  <njoly at pasteur.fr>
+
+	* test/*.test: Enforce correct status value on success.
+
+2008-03-06  Eric  Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq-reader.c: Allow starting blank lines on fasta formated
+	files.
+
+2008-02-19  Nicolas Joly  <njoly at pasteur.fr>
+
+	* src/main.c: Remove unneeded newlines from fatal error messages.
+
+2008-02-01  Eric  Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq-reader.c: Allow `*' (stop codon representation) while
+	sequence reading.
+
+2006-06-06  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq-reader.c: Fix anonymous detection and sequence name
+	parsing with pipes.
+
+2006-05-31  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* doc/toppred.pod: Man page update and correction.
+
+2006-05-31  Nicolas Joly  <njoly at pasteur.fr>
+
+	* test/hydro.test: New file that checks all hydrophobicity scales.
+
+2006-05-30  Nicolas Joly  <njoly at pasteur.fr>
+
+	* src/seq-reader.c: Do not push characters back on stream if
+	nothing was read previously.
+
+	* src/main.c: Do not close output file in sequence file processing
+	loop.
+
+2006-05-30  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/*.c, src/*.h: time stamp cleanup.
+
+	* src/main.c: Optional options `-g' and `-t' no more silently
+	ignored if needed support is missing.
+
+	* src/usage.c: gnuplot png color definition fix.
+
+	* src/seq-reader.c: Fix anonymous detection and related memory
+	overflow.
+
+	* src/profile.c: Fix file descriptor leak induced by mkstemp.
+
+2006-05-29  Nicolas Joly  <njoly at pasteur.fr>
+
+	* doc/toppred.pod: Small spelling/formatting fixes.
+
+	* src/mloutput.c: Remove trailing space in XML output.
+	* src/main.c: Fix incorrect XML generation, by moving `toppreds'
+	end tag, out of file process loop.
+
+	* src/mloutput.c: Make HTML header looks a little better (no
+	functional change).
+
+	* src/output.[ch]: Remove local `dirname()' function, and prefer
+	the one from the system.
+	* src/main.c: Adjust accordingly.
+
+	* src/graph.c, src/mloutput.c, src/profile.c: Do not assume
+	`dirname()' return value has a trailing `/' character.
+
+2006-05-25  Nicolas Joly  <njoly at pasteur.fr>
+
+	* src/main.c: Move cleanup outside of the processing loop to avoid
+	use of freed memory (data files and output dir) with multiple
+	input files.
+	* test/toppred.test: Exercize more than one input file.
+
+2004-05-17  Nicolas Joly  <njoly at pasteur.fr>
+
+ 	* src/profile.c: hide gplot() function if gnuplot is missing.
+	* src/topology.c, src/loop.c: Use const where appropriate.
+
+2004-05-17  Katja Schuerer  <schuerer at pasteur.fr>
+
+	* src/topology.c: Fix off by one index error in topologies
+	construction.
+
+2004-05-14  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/main.c: memory leak while freeing KS structures corrected in
+	case of too many topologies.
+	* src/main.c: memory liberation in case of no libgd.
+	NB: free(NULL) is allowed by the C iso guidelines.
+	* src/main.c: added internal -y flag in order to disable .hydro
+	file generation. (not documented).
+	* src/seq-reader.c: a bunch of header processing bugs correction.
+
+2004-05-03  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/graph.c: topologies graphic production code completly
+	rewrote.
+	* src/topology.c: removing the warning when no segment found.
+	* test/last_seg.err: modified to be coherent with no segment found
+	warning modification.
+	* test/more_calc.err: modified to be coherent with no segment
+	found warning modification.
+	* test/only_put.err: modified to be coherent with no segment found
+	warning modification.
+	* test/seq_float.err: modified to be coherent with no segment
+	found warning modification.
+
+2004-04-29  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/graph.c: correction of the graph representation. no longer
+	crash.
+
+2003-12-12  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/topology.c: modified warning message when no segment found
+	to be more accurate.
+
+2003-12-12  Nicolas Joly  <njoly at pasteur.fr>
+
+	* test/*.test: New verbose mode (VERBOSE=x).
+
+2003-12-10  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/profile.c: changed aa2H from function to macro,
+	optimisation.
+	* src/seq-reader.c: modified sequence reading function.
+
+2003-12-09  Nicolas Joly  <njoly at pasteur.fr>
+
+	* src/topoprint.c: Do not call `strlen()' on the same object 5
+	times.
+
+2001-11-21  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* configure.in: toppred is now in version 1.00.
+	* src/seq-reader.c: non ascii characters on sequences not more
+	allowed.
+	* src/*.c: corrected the -o result_file option behaviour. All
+	files are stored to the same directory than result_file.
+
+2001-10-15  Katja Schuerer  <schuerer at pasteur.fr>
+
+	* test/detect_segments.test: test if all segments are detected.
+	* test/seqlen.test: test of sequences of critical lengths.
+	* test/construct_topos.test: test to verify the calculation of all
+	toplogies.
+	* src/topology.c: correct topology calculation -- skip topologies
+	without any segment.
+
+2001-10-05  Katja Schuerer  <schuerer at pasteur.fr>
+
+	* data/toppred.dtd: add DTD file for xml output.
+	* src/mloutput.c: add function for xml output and transfer html
+	output functions to this file.
+	* src/output.c: transfer general output functions to this file.
+
+2001-09-12  Katja Schuerer  <schuerer at pasteur.fr>
+
+	* src/loop.c: modify get_segment to allow a segment at beginning
+	of the sequence.
+	* src/loop.c: correct bug while translation of old segment
+	sructure to new segment structure (detection of segment at
+	beginning of the sequence).
+	* src/charge.c: correct floating point exceptions caused by zero
+	division in distance function.
+
+2001-09-10  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq-reader.c: corrected bug while reading long comments. id
+	and comment are now dynamically handled, anonymous sequence are
+	tagged as anonymous, and empty sequence causes program exit.
+
+2001-08-30  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq-reader.c: modified sequence aquisition, sequence is not
+	systematicaly converted to upcase.
+
+	* src/main.c: added web output format via -w option.
+
+2001-08-28  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/loop.c: corrected a Hplot reading values, that causes a
+	segmentation fault on some systems.
+
+2001-08-03  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq-reader.c: seq reader upcase the sequence, as donwcase
+	sequences are not useable.
+
+2001-07-26  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* doc/toppred.pod: manpage looks like a manpage now.
+
+2001-07-24  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq-reader.c: corrected a seq-reader bug.
+
+	* src/*.[ch] corrected the include localisation.
+
+2001-07-23  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/graph.c: corrected a bug in graph representation.
+
+2001-07-19  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/graph.c: added graphic topos output choice (-d option).
+
+2001-07-18  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* configure.in: the graphic topology representation is now
+	depending on the use/presence of the libgd.
+
+2001-07-18  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/graph.c: adapted graphic topos output to KS structs.
+
+2001-07-05  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/loop.c (calc_loop): added the penultimate aa checking.
+
+2001-06-27  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/loop.h: introduced loop_t and seg_t structures.
+
+	* src/loop.c : modified the loop / segments structure to fit for
+	the Katja topology calcul.
+
+2001-06-21  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/loop.c: modified calc_segments to take in account segments
+	in position 0 and segments inside a "plateau".
+
+2001-06-19  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/seq_reader.c: sequence reader corrected, now handle
+	correctly incorect format sequence files.
+
+2001-06-13  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/profile.c: added region drawing in produced plot.
+
+2001-06-12  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/profile.c: changed /tmp/gnuplot-file-definition, is now
+	unique. Added some cosmetics in seq.hydro file.
+
+2001-05-14  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* doc/toppred.pod: added documentation.
+
+2001-05-11  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/main.c: modified a bunch of tests.
+
+2001-05-10  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/main.c: added hydrophobic gnu-plotting routine supported
+	format are ps, ppm, and x11.
+
+2001-05-03  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/loop.c: some code cleanning.
+	* src/main.c: some code cleanning.
+
+2001-04-20  Eric Deveaud  <edeveaud at pasteur.fr>
+
+	* src/main.c (main): beginning of work. Added hydrophobic values
+	load from file added sequence load from file
+
diff --git a/INSTALL b/INSTALL
new file mode 100644
index 0000000..23e5f25
--- /dev/null
+++ b/INSTALL
@@ -0,0 +1,236 @@
+Installation Instructions
+*************************
+
+Copyright (C) 1994, 1995, 1996, 1999, 2000, 2001, 2002, 2004, 2005 Free
+Software Foundation, Inc.
+
+This file is free documentation; the Free Software Foundation gives
+unlimited permission to copy, distribute and modify it.
+
+Basic Installation
+==================
+
+These are generic installation instructions.
+
+   The `configure' shell script attempts to guess correct values for
+various system-dependent variables used during compilation.  It uses
+those values to create a `Makefile' in each directory of the package.
+It may also create one or more `.h' files containing system-dependent
+definitions.  Finally, it creates a shell script `config.status' that
+you can run in the future to recreate the current configuration, and a
+file `config.log' containing compiler output (useful mainly for
+debugging `configure').
+
+   It can also use an optional file (typically called `config.cache'
+and enabled with `--cache-file=config.cache' or simply `-C') that saves
+the results of its tests to speed up reconfiguring.  (Caching is
+disabled by default to prevent problems with accidental use of stale
+cache files.)
+
+   If you need to do unusual things to compile the package, please try
+to figure out how `configure' could check whether to do them, and mail
+diffs or instructions to the address given in the `README' so they can
+be considered for the next release.  If you are using the cache, and at
+some point `config.cache' contains results you don't want to keep, you
+may remove or edit it.
+
+   The file `configure.ac' (or `configure.in') is used to create
+`configure' by a program called `autoconf'.  You only need
+`configure.ac' if you want to change it or regenerate `configure' using
+a newer version of `autoconf'.
+
+The simplest way to compile this package is:
+
+  1. `cd' to the directory containing the package's source code and type
+     `./configure' to configure the package for your system.  If you're
+     using `csh' on an old version of System V, you might need to type
+     `sh ./configure' instead to prevent `csh' from trying to execute
+     `configure' itself.
+
+     Running `configure' takes awhile.  While running, it prints some
+     messages telling which features it is checking for.
+
+  2. Type `make' to compile the package.
+
+  3. Optionally, type `make check' to run any self-tests that come with
+     the package.
+
+  4. Type `make install' to install the programs and any data files and
+     documentation.
+
+  5. You can remove the program binaries and object files from the
+     source code directory by typing `make clean'.  To also remove the
+     files that `configure' created (so you can compile the package for
+     a different kind of computer), type `make distclean'.  There is
+     also a `make maintainer-clean' target, but that is intended mainly
+     for the package's developers.  If you use it, you may have to get
+     all sorts of other programs in order to regenerate files that came
+     with the distribution.
+
+Compilers and Options
+=====================
+
+Some systems require unusual options for compilation or linking that the
+`configure' script does not know about.  Run `./configure --help' for
+details on some of the pertinent environment variables.
+
+   You can give `configure' initial values for configuration parameters
+by setting variables in the command line or in the environment.  Here
+is an example:
+
+     ./configure CC=c89 CFLAGS=-O2 LIBS=-lposix
+
+   *Note Defining Variables::, for more details.
+
+Compiling For Multiple Architectures
+====================================
+
+You can compile the package for more than one kind of computer at the
+same time, by placing the object files for each architecture in their
+own directory.  To do this, you must use a version of `make' that
+supports the `VPATH' variable, such as GNU `make'.  `cd' to the
+directory where you want the object files and executables to go and run
+the `configure' script.  `configure' automatically checks for the
+source code in the directory that `configure' is in and in `..'.
+
+   If you have to use a `make' that does not support the `VPATH'
+variable, you have to compile the package for one architecture at a
+time in the source code directory.  After you have installed the
+package for one architecture, use `make distclean' before reconfiguring
+for another architecture.
+
+Installation Names
+==================
+
+By default, `make install' installs the package's commands under
+`/usr/local/bin', include files under `/usr/local/include', etc.  You
+can specify an installation prefix other than `/usr/local' by giving
+`configure' the option `--prefix=PREFIX'.
+
+   You can specify separate installation prefixes for
+architecture-specific files and architecture-independent files.  If you
+pass the option `--exec-prefix=PREFIX' to `configure', the package uses
+PREFIX as the prefix for installing programs and libraries.
+Documentation and other data files still use the regular prefix.
+
+   In addition, if you use an unusual directory layout you can give
+options like `--bindir=DIR' to specify different values for particular
+kinds of files.  Run `configure --help' for a list of the directories
+you can set and what kinds of files go in them.
+
+   If the package supports it, you can cause programs to be installed
+with an extra prefix or suffix on their names by giving `configure' the
+option `--program-prefix=PREFIX' or `--program-suffix=SUFFIX'.
+
+Optional Features
+=================
+
+Some packages pay attention to `--enable-FEATURE' options to
+`configure', where FEATURE indicates an optional part of the package.
+They may also pay attention to `--with-PACKAGE' options, where PACKAGE
+is something like `gnu-as' or `x' (for the X Window System).  The
+`README' should mention any `--enable-' and `--with-' options that the
+package recognizes.
+
+   For packages that use the X Window System, `configure' can usually
+find the X include and library files automatically, but if it doesn't,
+you can use the `configure' options `--x-includes=DIR' and
+`--x-libraries=DIR' to specify their locations.
+
+Specifying the System Type
+==========================
+
+There may be some features `configure' cannot figure out automatically,
+but needs to determine by the type of machine the package will run on.
+Usually, assuming the package is built to be run on the _same_
+architectures, `configure' can figure that out, but if it prints a
+message saying it cannot guess the machine type, give it the
+`--build=TYPE' option.  TYPE can either be a short name for the system
+type, such as `sun4', or a canonical name which has the form:
+
+     CPU-COMPANY-SYSTEM
+
+where SYSTEM can have one of these forms:
+
+     OS KERNEL-OS
+
+   See the file `config.sub' for the possible values of each field.  If
+`config.sub' isn't included in this package, then this package doesn't
+need to know the machine type.
+
+   If you are _building_ compiler tools for cross-compiling, you should
+use the option `--target=TYPE' to select the type of system they will
+produce code for.
+
+   If you want to _use_ a cross compiler, that generates code for a
+platform different from the build platform, you should specify the
+"host" platform (i.e., that on which the generated programs will
+eventually be run) with `--host=TYPE'.
+
+Sharing Defaults
+================
+
+If you want to set default values for `configure' scripts to share, you
+can create a site shell script called `config.site' that gives default
+values for variables like `CC', `cache_file', and `prefix'.
+`configure' looks for `PREFIX/share/config.site' if it exists, then
+`PREFIX/etc/config.site' if it exists.  Or, you can set the
+`CONFIG_SITE' environment variable to the location of the site script.
+A warning: not all `configure' scripts look for a site script.
+
+Defining Variables
+==================
+
+Variables not defined in a site shell script can be set in the
+environment passed to `configure'.  However, some packages may run
+configure again during the build, and the customized values of these
+variables may be lost.  In order to avoid this problem, you should set
+them in the `configure' command line, using `VAR=value'.  For example:
+
+     ./configure CC=/usr/local2/bin/gcc
+
+causes the specified `gcc' to be used as the C compiler (unless it is
+overridden in the site shell script).  Here is a another example:
+
+     /bin/bash ./configure CONFIG_SHELL=/bin/bash
+
+Here the `CONFIG_SHELL=/bin/bash' operand causes subsequent
+configuration-related scripts to be executed by `/bin/bash'.
+
+`configure' Invocation
+======================
+
+`configure' recognizes the following options to control how it operates.
+
+`--help'
+`-h'
+     Print a summary of the options to `configure', and exit.
+
+`--version'
+`-V'
+     Print the version of Autoconf used to generate the `configure'
+     script, and exit.
+
+`--cache-file=FILE'
+     Enable the cache: use and save the results of the tests in FILE,
+     traditionally `config.cache'.  FILE defaults to `/dev/null' to
+     disable caching.
+
+`--config-cache'
+`-C'
+     Alias for `--cache-file=config.cache'.
+
+`--quiet'
+`--silent'
+`-q'
+     Do not print messages saying which checks are being made.  To
+     suppress all normal output, redirect it to `/dev/null' (any error
+     messages will still be shown).
+
+`--srcdir=DIR'
+     Look for the package's source code in directory DIR.  Usually
+     `configure' can determine that directory automatically.
+
+`configure' also accepts some other, not widely useful, options.  Run
+`configure --help' for more details.
+
diff --git a/LICENSE b/LICENSE
new file mode 100644
index 0000000..d6a9326
--- /dev/null
+++ b/LICENSE
@@ -0,0 +1,340 @@
+GNU GENERAL PUBLIC LICENSE
+                       Version 2, June 1991
+
+ Copyright (C) 1989, 1991 Free Software Foundation, Inc., <http://fsf.org/>
+ 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+
+                            Preamble
+
+  The licenses for most software are designed to take away your
+freedom to share and change it.  By contrast, the GNU General Public
+License is intended to guarantee your freedom to share and change free
+software--to make sure the software is free for all its users.  This
+General Public License applies to most of the Free Software
+Foundation's software and to any other program whose authors commit to
+using it.  (Some other Free Software Foundation software is covered by
+the GNU Lesser General Public License instead.)  You can apply it to
+your programs, too.
+
+  When we speak of free software, we are referring to freedom, not
+price.  Our General Public Licenses are designed to make sure that you
+have the freedom to distribute copies of free software (and charge for
+this service if you wish), that you receive source code or can get it
+if you want it, that you can change the software or use pieces of it
+in new free programs; and that you know you can do these things.
+
+  To protect your rights, we need to make restrictions that forbid
+anyone to deny you these rights or to ask you to surrender the rights.
+These restrictions translate to certain responsibilities for you if you
+distribute copies of the software, or if you modify it.
+
+  For example, if you distribute copies of such a program, whether
+gratis or for a fee, you must give the recipients all the rights that
+you have.  You must make sure that they, too, receive or can get the
+source code.  And you must show them these terms so they know their
+rights.
+
+  We protect your rights with two steps: (1) copyright the software, and
+(2) offer you this license which gives you legal permission to copy,
+distribute and/or modify the software.
+
+  Also, for each author's protection and ours, we want to make certain
+that everyone understands that there is no warranty for this free
+software.  If the software is modified by someone else and passed on, we
+want its recipients to know that what they have is not the original, so
+that any problems introduced by others will not reflect on the original
+authors' reputations.
+
+  Finally, any free program is threatened constantly by software
+patents.  We wish to avoid the danger that redistributors of a free
+program will individually obtain patent licenses, in effect making the
+program proprietary.  To prevent this, we have made it clear that any
+patent must be licensed for everyone's free use or not licensed at all.
+
+  The precise terms and conditions for copying, distribution and
+modification follow.
+
+                    GNU GENERAL PUBLIC LICENSE
+   TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
+
+  0. This License applies to any program or other work which contains
+a notice placed by the copyright holder saying it may be distributed
+under the terms of this General Public License.  The "Program", below,
+refers to any such program or work, and a "work based on the Program"
+means either the Program or any derivative work under copyright law:
+that is to say, a work containing the Program or a portion of it,
+either verbatim or with modifications and/or translated into another
+language.  (Hereinafter, translation is included without limitation in
+the term "modification".)  Each licensee is addressed as "you".
+
+Activities other than copying, distribution and modification are not
+covered by this License; they are outside its scope.  The act of
+running the Program is not restricted, and the output from the Program
+is covered only if its contents constitute a work based on the
+Program (independent of having been made by running the Program).
+Whether that is true depends on what the Program does.
+
+  1. You may copy and distribute verbatim copies of the Program's
+source code as you receive it, in any medium, provided that you
+conspicuously and appropriately publish on each copy an appropriate
+copyright notice and disclaimer of warranty; keep intact all the
+notices that refer to this License and to the absence of any warranty;
+and give any other recipients of the Program a copy of this License
+along with the Program.
+
+You may charge a fee for the physical act of transferring a copy, and
+you may at your option offer warranty protection in exchange for a fee.
+
+  2. You may modify your copy or copies of the Program or any portion
+of it, thus forming a work based on the Program, and copy and
+distribute such modifications or work under the terms of Section 1
+above, provided that you also meet all of these conditions:
+
+    a) You must cause the modified files to carry prominent notices
+    stating that you changed the files and the date of any change.
+
+    b) You must cause any work that you distribute or publish, that in
+    whole or in part contains or is derived from the Program or any
+    part thereof, to be licensed as a whole at no charge to all third
+    parties under the terms of this License.
+
+    c) If the modified program normally reads commands interactively
+    when run, you must cause it, when started running for such
+    interactive use in the most ordinary way, to print or display an
+    announcement including an appropriate copyright notice and a
+    notice that there is no warranty (or else, saying that you provide
+    a warranty) and that users may redistribute the program under
+    these conditions, and telling the user how to view a copy of this
+    License.  (Exception: if the Program itself is interactive but
+    does not normally print such an announcement, your work based on
+    the Program is not required to print an announcement.)
+
+These requirements apply to the modified work as a whole.  If
+identifiable sections of that work are not derived from the Program,
+and can be reasonably considered independent and separate works in
+themselves, then this License, and its terms, do not apply to those
+sections when you distribute them as separate works.  But when you
+distribute the same sections as part of a whole which is a work based
+on the Program, the distribution of the whole must be on the terms of
+this License, whose permissions for other licensees extend to the
+entire whole, and thus to each and every part regardless of who wrote it.
+
+Thus, it is not the intent of this section to claim rights or contest
+your rights to work written entirely by you; rather, the intent is to
+exercise the right to control the distribution of derivative or
+collective works based on the Program.
+
+In addition, mere aggregation of another work not based on the Program
+with the Program (or with a work based on the Program) on a volume of
+a storage or distribution medium does not bring the other work under
+the scope of this License.
+
+  3. You may copy and distribute the Program (or a work based on it,
+under Section 2) in object code or executable form under the terms of
+Sections 1 and 2 above provided that you also do one of the following:
+
+    a) Accompany it with the complete corresponding machine-readable
+    source code, which must be distributed under the terms of Sections
+    1 and 2 above on a medium customarily used for software interchange; or,
+
+    b) Accompany it with a written offer, valid for at least three
+    years, to give any third party, for a charge no more than your
+    cost of physically performing source distribution, a complete
+    machine-readable copy of the corresponding source code, to be
+    distributed under the terms of Sections 1 and 2 above on a medium
+    customarily used for software interchange; or,
+
+    c) Accompany it with the information you received as to the offer
+    to distribute corresponding source code.  (This alternative is
+    allowed only for noncommercial distribution and only if you
+    received the program in object code or executable form with such
+    an offer, in accord with Subsection b above.)
+
+The source code for a work means the preferred form of the work for
+making modifications to it.  For an executable work, complete source
+code means all the source code for all modules it contains, plus any
+associated interface definition files, plus the scripts used to
+control compilation and installation of the executable.  However, as a
+special exception, the source code distributed need not include
+anything that is normally distributed (in either source or binary
+form) with the major components (compiler, kernel, and so on) of the
+operating system on which the executable runs, unless that component
+itself accompanies the executable.
+
+If distribution of executable or object code is made by offering
+access to copy from a designated place, then offering equivalent
+access to copy the source code from the same place counts as
+distribution of the source code, even though third parties are not
+compelled to copy the source along with the object code.
+
+  4. You may not copy, modify, sublicense, or distribute the Program
+except as expressly provided under this License.  Any attempt
+otherwise to copy, modify, sublicense or distribute the Program is
+void, and will automatically terminate your rights under this License.
+However, parties who have received copies, or rights, from you under
+this License will not have their licenses terminated so long as such
+parties remain in full compliance.
+
+  5. You are not required to accept this License, since you have not
+signed it.  However, nothing else grants you permission to modify or
+distribute the Program or its derivative works.  These actions are
+prohibited by law if you do not accept this License.  Therefore, by
+modifying or distributing the Program (or any work based on the
+Program), you indicate your acceptance of this License to do so, and
+all its terms and conditions for copying, distributing or modifying
+the Program or works based on it.
+
+  6. Each time you redistribute the Program (or any work based on the
+Program), the recipient automatically receives a license from the
+original licensor to copy, distribute or modify the Program subject to
+these terms and conditions.  You may not impose any further
+restrictions on the recipients' exercise of the rights granted herein.
+You are not responsible for enforcing compliance by third parties to
+this License.
+
+  7. If, as a consequence of a court judgment or allegation of patent
+infringement or for any other reason (not limited to patent issues),
+conditions are imposed on you (whether by court order, agreement or
+otherwise) that contradict the conditions of this License, they do not
+excuse you from the conditions of this License.  If you cannot
+distribute so as to satisfy simultaneously your obligations under this
+License and any other pertinent obligations, then as a consequence you
+may not distribute the Program at all.  For example, if a patent
+license would not permit royalty-free redistribution of the Program by
+all those who receive copies directly or indirectly through you, then
+the only way you could satisfy both it and this License would be to
+refrain entirely from distribution of the Program.
+
+If any portion of this section is held invalid or unenforceable under
+any particular circumstance, the balance of the section is intended to
+apply and the section as a whole is intended to apply in other
+circumstances.
+
+It is not the purpose of this section to induce you to infringe any
+patents or other property right claims or to contest validity of any
+such claims; this section has the sole purpose of protecting the
+integrity of the free software distribution system, which is
+implemented by public license practices.  Many people have made
+generous contributions to the wide range of software distributed
+through that system in reliance on consistent application of that
+system; it is up to the author/donor to decide if he or she is willing
+to distribute software through any other system and a licensee cannot
+impose that choice.
+
+This section is intended to make thoroughly clear what is believed to
+be a consequence of the rest of this License.
+
+  8. If the distribution and/or use of the Program is restricted in
+certain countries either by patents or by copyrighted interfaces, the
+original copyright holder who places the Program under this License
+may add an explicit geographical distribution limitation excluding
+those countries, so that distribution is permitted only in or among
+countries not thus excluded.  In such case, this License incorporates
+the limitation as if written in the body of this License.
+
+  9. The Free Software Foundation may publish revised and/or new versions
+of the General Public License from time to time.  Such new versions will
+be similar in spirit to the present version, but may differ in detail to
+address new problems or concerns.
+
+Each version is given a distinguishing version number.  If the Program
+specifies a version number of this License which applies to it and "any
+later version", you have the option of following the terms and conditions
+either of that version or of any later version published by the Free
+Software Foundation.  If the Program does not specify a version number of
+this License, you may choose any version ever published by the Free Software
+Foundation.
+
+  10. If you wish to incorporate parts of the Program into other free
+programs whose distribution conditions are different, write to the author
+to ask for permission.  For software which is copyrighted by the Free
+Software Foundation, write to the Free Software Foundation; we sometimes
+make exceptions for this.  Our decision will be guided by the two goals
+of preserving the free status of all derivatives of our free software and
+of promoting the sharing and reuse of software generally.
+
+                            NO WARRANTY
+
+  11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY
+FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW.  EXCEPT WHEN
+OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES
+PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED
+OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF
+MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE.  THE ENTIRE RISK AS
+TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU.  SHOULD THE
+PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING,
+REPAIR OR CORRECTION.
+
+  12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
+WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR
+REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES,
+INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING
+OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED
+TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY
+YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER
+PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
+POSSIBILITY OF SUCH DAMAGES.
+
+                     END OF TERMS AND CONDITIONS
+
+            How to Apply These Terms to Your New Programs
+
+  If you develop a new program, and you want it to be of the greatest
+possible use to the public, the best way to achieve this is to make it
+free software which everyone can redistribute and change under these terms.
+
+  To do so, attach the following notices to the program.  It is safest
+to attach them to the start of each source file to most effectively
+convey the exclusion of warranty; and each file should have at least
+the "copyright" line and a pointer to where the full notice is found.
+
+    {description}
+    Copyright (C) {year}  {fullname}
+
+    This program is free software; you can redistribute it and/or modify
+    it under the terms of the GNU General Public License as published by
+    the Free Software Foundation; either version 2 of the License, or
+    (at your option) any later version.
+
+    This program is distributed in the hope that it will be useful,
+    but WITHOUT ANY WARRANTY; without even the implied warranty of
+    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+    GNU General Public License for more details.
+
+    You should have received a copy of the GNU General Public License along
+    with this program; if not, write to the Free Software Foundation, Inc.,
+    51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA.
+
+Also add information on how to contact you by electronic and paper mail.
+
+If the program is interactive, make it output a short notice like this
+when it starts in an interactive mode:
+
+    Gnomovision version 69, Copyright (C) year name of author
+    Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'.
+    This is free software, and you are welcome to redistribute it
+    under certain conditions; type `show c' for details.
+
+The hypothetical commands `show w' and `show c' should show the appropriate
+parts of the General Public License.  Of course, the commands you use may
+be called something other than `show w' and `show c'; they could even be
+mouse-clicks or menu items--whatever suits your program.
+
+You should also get your employer (if you work as a programmer) or your
+school, if any, to sign a "copyright disclaimer" for the program, if
+necessary.  Here is a sample; alter the names:
+
+  Yoyodyne, Inc., hereby disclaims all copyright interest in the program
+  `Gnomovision' (which makes passes at compilers) written by James Hacker.
+
+  {signature of Ty Coon}, 1 April 1989
+  Ty Coon, President of Vice
+
+This General Public License does not permit incorporating your program into
+proprietary programs.  If your program is a subroutine library, you may
+consider it more useful to permit linking proprietary applications with the
+library.  If this is what you want to do, use the GNU Lesser General
+Public License instead of this License.
+
diff --git a/Makefile.am b/Makefile.am
new file mode 100644
index 0000000..90aa1ba
--- /dev/null
+++ b/Makefile.am
@@ -0,0 +1,5 @@
+SUBDIRS = . m4 src data doc test
+
+## Add m4 dir for autoconf extra definitions
+ACLOCAL_AMFLAGS = -I m4
+
diff --git a/Makefile.in b/Makefile.in
new file mode 100644
index 0000000..230e9a0
--- /dev/null
+++ b/Makefile.in
@@ -0,0 +1,557 @@
+# Makefile.in generated by automake 1.9.2 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004  Free Software Foundation, Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+srcdir = @srcdir@
+top_srcdir = @top_srcdir@
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+top_builddir = .
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+INSTALL = @INSTALL@
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+build_triplet = @build@
+host_triplet = @host@
+DIST_COMMON = README $(am__configure_deps) $(srcdir)/Makefile.am \
+	$(srcdir)/Makefile.in $(top_srcdir)/configure AUTHORS COPYING \
+	ChangeLog INSTALL NEWS TODO config.guess config.sub depcomp \
+	install-sh missing mkinstalldirs
+subdir = .
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/m4/aclibgd.m4 \
+	$(top_srcdir)/configure.in
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \
+ configure.lineno configure.status.lineno
+mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs
+CONFIG_HEADER = $(top_builddir)/src/config.h
+CONFIG_CLEAN_FILES =
+SOURCES =
+DIST_SOURCES =
+RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \
+	html-recursive info-recursive install-data-recursive \
+	install-exec-recursive install-info-recursive \
+	install-recursive installcheck-recursive installdirs-recursive \
+	pdf-recursive ps-recursive uninstall-info-recursive \
+	uninstall-recursive
+ETAGS = etags
+CTAGS = ctags
+DIST_SUBDIRS = $(SUBDIRS)
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+distdir = $(PACKAGE)-$(VERSION)
+top_distdir = $(distdir)
+am__remove_distdir = \
+  { test ! -d $(distdir) \
+    || { find $(distdir) -type d ! -perm -200 -exec chmod u+w {} ';' \
+         && rm -fr $(distdir); }; }
+DIST_ARCHIVES = $(distdir).tar.gz
+GZIP_ENV = --best
+distuninstallcheck_listfiles = find . -type f -print
+distcleancheck_listfiles = find . -type f -print
+ACLOCAL = @ACLOCAL@
+AMDEP_FALSE = @AMDEP_FALSE@
+AMDEP_TRUE = @AMDEP_TRUE@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CC = @CC@
+CCDEPMODE = @CCDEPMODE@
+CFLAGS = @CFLAGS@
+CPP = @CPP@
+CPPFLAGS = @CPPFLAGS@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+DEPDIR = @DEPDIR@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+EGREP = @EGREP@
+EXEEXT = @EXEEXT@
+GNUPLOT = @GNUPLOT@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LDFLAGS = @LDFLAGS@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+OBJEXT = @OBJEXT@
+OS_CPPFLAGS = @OS_CPPFLAGS@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+POD2MAN = @POD2MAN@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+USE_GD_LIB_SRC_FALSE = @USE_GD_LIB_SRC_FALSE@
+USE_GD_LIB_SRC_TRUE = @USE_GD_LIB_SRC_TRUE@
+VERSION = @VERSION@
+ac_ct_CC = @ac_ct_CC@
+ac_ct_STRIP = @ac_ct_STRIP@
+am__fastdepCC_FALSE = @am__fastdepCC_FALSE@
+am__fastdepCC_TRUE = @am__fastdepCC_TRUE@
+am__include = @am__include@
+am__leading_dot = @am__leading_dot@
+am__quote = @am__quote@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build = @build@
+build_alias = @build_alias@
+build_cpu = @build_cpu@
+build_os = @build_os@
+build_vendor = @build_vendor@
+datadir = @datadir@
+exec_prefix = @exec_prefix@
+host = @host@
+host_alias = @host_alias@
+host_cpu = @host_cpu@
+host_os = @host_os@
+host_vendor = @host_vendor@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+SUBDIRS = . m4 src data doc test
+ACLOCAL_AMFLAGS = -I m4
+all: all-recursive
+
+.SUFFIXES:
+am--refresh:
+	@:
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      echo ' cd $(srcdir) && $(AUTOMAKE) --gnu '; \
+	      cd $(srcdir) && $(AUTOMAKE) --gnu  \
+		&& exit 0; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu  Makefile'; \
+	cd $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu  Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    echo ' $(SHELL) ./config.status'; \
+	    $(SHELL) ./config.status;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	$(SHELL) ./config.status --recheck
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(srcdir) && $(AUTOCONF)
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS)
+uninstall-info-am:
+
+# This directory's subdirectories are mostly independent; you can cd
+# into them and run `make' without going through this Makefile.
+# To change the values of `make' variables: instead of editing Makefiles,
+# (1) if the variable is set in `config.status', edit `config.status'
+#     (which will cause the Makefiles to be regenerated when you run `make');
+# (2) otherwise, pass the desired values on the `make' command line.
+$(RECURSIVE_TARGETS):
+	@set fnord $$MAKEFLAGS; amf=$$2; \
+	dot_seen=no; \
+	target=`echo $@ | sed s/-recursive//`; \
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  echo "Making $$target in $$subdir"; \
+	  if test "$$subdir" = "."; then \
+	    dot_seen=yes; \
+	    local_target="$$target-am"; \
+	  else \
+	    local_target="$$target"; \
+	  fi; \
+	  (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \
+	   || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \
+	done; \
+	if test "$$dot_seen" = "no"; then \
+	  $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \
+	fi; test -z "$$fail"
+
+mostlyclean-recursive clean-recursive distclean-recursive \
+maintainer-clean-recursive:
+	@set fnord $$MAKEFLAGS; amf=$$2; \
+	dot_seen=no; \
+	case "$@" in \
+	  distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \
+	  *) list='$(SUBDIRS)' ;; \
+	esac; \
+	rev=''; for subdir in $$list; do \
+	  if test "$$subdir" = "."; then :; else \
+	    rev="$$subdir $$rev"; \
+	  fi; \
+	done; \
+	rev="$$rev ."; \
+	target=`echo $@ | sed s/-recursive//`; \
+	for subdir in $$rev; do \
+	  echo "Making $$target in $$subdir"; \
+	  if test "$$subdir" = "."; then \
+	    local_target="$$target-am"; \
+	  else \
+	    local_target="$$target"; \
+	  fi; \
+	  (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \
+	   || case "$$amf" in *=*) exit 1;; *k*) fail=yes;; *) exit 1;; esac; \
+	done && test -z "$$fail"
+tags-recursive:
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \
+	done
+ctags-recursive:
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  test "$$subdir" = . || (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \
+	done
+
+ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES)
+	list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '    { files[$$0] = 1; } \
+	       END { for (i in files) print i; }'`; \
+	mkid -fID $$unique
+tags: TAGS
+
+TAGS: tags-recursive $(HEADERS) $(SOURCES)  $(TAGS_DEPENDENCIES) \
+		$(TAGS_FILES) $(LISP)
+	tags=; \
+	here=`pwd`; \
+	if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \
+	  include_option=--etags-include; \
+	  empty_fix=.; \
+	else \
+	  include_option=--include; \
+	  empty_fix=; \
+	fi; \
+	list='$(SUBDIRS)'; for subdir in $$list; do \
+	  if test "$$subdir" = .; then :; else \
+	    test ! -f $$subdir/TAGS || \
+	      tags="$$tags $$include_option=$$here/$$subdir/TAGS"; \
+	  fi; \
+	done; \
+	list='$(SOURCES) $(HEADERS)  $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '    { files[$$0] = 1; } \
+	       END { for (i in files) print i; }'`; \
+	if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \
+	  test -n "$$unique" || unique=$$empty_fix; \
+	  $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \
+	    $$tags $$unique; \
+	fi
+ctags: CTAGS
+CTAGS: ctags-recursive $(HEADERS) $(SOURCES)  $(TAGS_DEPENDENCIES) \
+		$(TAGS_FILES) $(LISP)
+	tags=; \
+	here=`pwd`; \
+	list='$(SOURCES) $(HEADERS)  $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '    { files[$$0] = 1; } \
+	       END { for (i in files) print i; }'`; \
+	test -z "$(CTAGS_ARGS)$$tags$$unique" \
+	  || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \
+	     $$tags $$unique
+
+GTAGS:
+	here=`$(am__cd) $(top_builddir) && pwd` \
+	  && cd $(top_srcdir) \
+	  && gtags -i $(GTAGS_ARGS) $$here
+
+distclean-tags:
+	-rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags
+
+distdir: $(DISTFILES)
+	$(am__remove_distdir)
+	mkdir $(distdir)
+	$(mkdir_p) $(distdir)/m4
+	@srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \
+	list='$(DISTFILES)'; for file in $$list; do \
+	  case $$file in \
+	    $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \
+	    $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \
+	  esac; \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \
+	  if test "$$dir" != "$$file" && test "$$dir" != "."; then \
+	    dir="/$$dir"; \
+	    $(mkdir_p) "$(distdir)$$dir"; \
+	  else \
+	    dir=''; \
+	  fi; \
+	  if test -d $$d/$$file; then \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \
+	    fi; \
+	    cp -pR $$d/$$file $(distdir)$$dir || exit 1; \
+	  else \
+	    test -f $(distdir)/$$file \
+	    || cp -p $$d/$$file $(distdir)/$$file \
+	    || exit 1; \
+	  fi; \
+	done
+	list='$(DIST_SUBDIRS)'; for subdir in $$list; do \
+	  if test "$$subdir" = .; then :; else \
+	    test -d "$(distdir)/$$subdir" \
+	    || $(mkdir_p) "$(distdir)/$$subdir" \
+	    || exit 1; \
+	    distdir=`$(am__cd) $(distdir) && pwd`; \
+	    top_distdir=`$(am__cd) $(top_distdir) && pwd`; \
+	    (cd $$subdir && \
+	      $(MAKE) $(AM_MAKEFLAGS) \
+	        top_distdir="$$top_distdir" \
+	        distdir="$$distdir/$$subdir" \
+	        distdir) \
+	      || exit 1; \
+	  fi; \
+	done
+	-find $(distdir) -type d ! -perm -777 -exec chmod a+rwx {} \; -o \
+	  ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \
+	  ! -type d ! -perm -400 -exec chmod a+r {} \; -o \
+	  ! -type d ! -perm -444 -exec $(SHELL) $(install_sh) -c -m a+r {} {} \; \
+	|| chmod -R a+r $(distdir)
+dist-gzip: distdir
+	tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz
+	$(am__remove_distdir)
+
+dist-bzip2: distdir
+	tardir=$(distdir) && $(am__tar) | bzip2 -9 -c >$(distdir).tar.bz2
+	$(am__remove_distdir)
+
+dist-tarZ: distdir
+	tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z
+	$(am__remove_distdir)
+
+dist-shar: distdir
+	shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz
+	$(am__remove_distdir)
+
+dist-zip: distdir
+	-rm -f $(distdir).zip
+	zip -rq $(distdir).zip $(distdir)
+	$(am__remove_distdir)
+
+dist dist-all: distdir
+	tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz
+	$(am__remove_distdir)
+
+# This target untars the dist file and tries a VPATH configuration.  Then
+# it guarantees that the distribution is self-contained by making another
+# tarfile.
+distcheck: dist
+	case '$(DIST_ARCHIVES)' in \
+	*.tar.gz*) \
+	  GZIP=$(GZIP_ENV) gunzip -c $(distdir).tar.gz | $(am__untar) ;;\
+	*.tar.bz2*) \
+	  bunzip2 -c $(distdir).tar.bz2 | $(am__untar) ;;\
+	*.tar.Z*) \
+	  uncompress -c $(distdir).tar.Z | $(am__untar) ;;\
+	*.shar.gz*) \
+	  GZIP=$(GZIP_ENV) gunzip -c $(distdir).shar.gz | unshar ;;\
+	*.zip*) \
+	  unzip $(distdir).zip ;;\
+	esac
+	chmod -R a-w $(distdir); chmod a+w $(distdir)
+	mkdir $(distdir)/_build
+	mkdir $(distdir)/_inst
+	chmod a-w $(distdir)
+	dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \
+	  && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \
+	  && cd $(distdir)/_build \
+	  && ../configure --srcdir=.. --prefix="$$dc_install_base" \
+	    $(DISTCHECK_CONFIGURE_FLAGS) \
+	  && $(MAKE) $(AM_MAKEFLAGS) \
+	  && $(MAKE) $(AM_MAKEFLAGS) dvi \
+	  && $(MAKE) $(AM_MAKEFLAGS) check \
+	  && $(MAKE) $(AM_MAKEFLAGS) install \
+	  && $(MAKE) $(AM_MAKEFLAGS) installcheck \
+	  && $(MAKE) $(AM_MAKEFLAGS) uninstall \
+	  && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \
+	        distuninstallcheck \
+	  && chmod -R a-w "$$dc_install_base" \
+	  && ({ \
+	       (cd ../.. && umask 077 && mkdir "$$dc_destdir") \
+	       && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \
+	       && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \
+	       && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \
+	            distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \
+	      } || { rm -rf "$$dc_destdir"; exit 1; }) \
+	  && rm -rf "$$dc_destdir" \
+	  && $(MAKE) $(AM_MAKEFLAGS) dist \
+	  && rm -rf $(DIST_ARCHIVES) \
+	  && $(MAKE) $(AM_MAKEFLAGS) distcleancheck
+	$(am__remove_distdir)
+	@(echo "$(distdir) archives ready for distribution: "; \
+	  list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \
+	  sed -e '1{h;s/./=/g;p;x;}' -e '$${p;x;}'
+distuninstallcheck:
+	@cd $(distuninstallcheck_dir) \
+	&& test `$(distuninstallcheck_listfiles) | wc -l` -le 1 \
+	   || { echo "ERROR: files left after uninstall:" ; \
+	        if test -n "$(DESTDIR)"; then \
+	          echo "  (check DESTDIR support)"; \
+	        fi ; \
+	        $(distuninstallcheck_listfiles) ; \
+	        exit 1; } >&2
+distcleancheck: distclean
+	@if test '$(srcdir)' = . ; then \
+	  echo "ERROR: distcleancheck can only run from a VPATH build" ; \
+	  exit 1 ; \
+	fi
+	@test `$(distcleancheck_listfiles) | wc -l` -eq 0 \
+	  || { echo "ERROR: files left in build directory after distclean:" ; \
+	       $(distcleancheck_listfiles) ; \
+	       exit 1; } >&2
+check-am: all-am
+check: check-recursive
+all-am: Makefile
+installdirs: installdirs-recursive
+installdirs-am:
+install: install-recursive
+install-exec: install-exec-recursive
+install-data: install-data-recursive
+uninstall: uninstall-recursive
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-recursive
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-recursive
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-recursive
+	-rm -f $(am__CONFIG_DISTCLEAN_FILES)
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic distclean-tags
+
+dvi: dvi-recursive
+
+dvi-am:
+
+html: html-recursive
+
+info: info-recursive
+
+info-am:
+
+install-data-am:
+
+install-exec-am:
+
+install-info: install-info-recursive
+
+install-man:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-recursive
+	-rm -f $(am__CONFIG_DISTCLEAN_FILES)
+	-rm -rf $(top_srcdir)/autom4te.cache
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-recursive
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-recursive
+
+pdf-am:
+
+ps: ps-recursive
+
+ps-am:
+
+uninstall-am: uninstall-info-am
+
+uninstall-info: uninstall-info-recursive
+
+.PHONY: $(RECURSIVE_TARGETS) CTAGS GTAGS all all-am am--refresh check \
+	check-am clean clean-generic clean-recursive ctags \
+	ctags-recursive dist dist-all dist-bzip2 dist-gzip dist-shar \
+	dist-tarZ dist-zip distcheck distclean distclean-generic \
+	distclean-recursive distclean-tags distcleancheck distdir \
+	distuninstallcheck dvi dvi-am html html-am info info-am \
+	install install-am install-data install-data-am install-exec \
+	install-exec-am install-info install-info-am install-man \
+	install-strip installcheck installcheck-am installdirs \
+	installdirs-am maintainer-clean maintainer-clean-generic \
+	maintainer-clean-recursive mostlyclean mostlyclean-generic \
+	mostlyclean-recursive pdf pdf-am ps ps-am tags tags-recursive \
+	uninstall uninstall-am uninstall-info-am
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:
diff --git a/NEWS b/NEWS
new file mode 100644
index 0000000..6edf1a1
--- /dev/null
+++ b/NEWS
@@ -0,0 +1 @@
+no news is good news !
diff --git a/README b/README
new file mode 100644
index 0000000..44e3e41
--- /dev/null
+++ b/README
@@ -0,0 +1,28 @@
+
+TOPPRED - Transmembrane topology prediction.
+
+This program is a new implementation of the original toppred program,
+based on G. von Heijne algorithm :
+
+"Membrane protein structure prediction. Hydrophobicity analysis and
+the positive-inside rule." J Mol Biol 1992 May 20;225(2):487-94.
+
+"TopPred II: an improved software for membrane protein structure
+predictions." CABIOS 10(6):685-6, 1994 Dec.
+
+This implementation can use 2 optionals programs in order to 
+display graphical results:
+
+	- gnuplot version 3.7 patchlevel 1 or more
+            `gnuplot' can be used in order to display the
+	    hydrophobicity profile of a given sequence.
+	    see <http://www.gnuplot.info/>
+	- libgd with png support
+	    `gd' library can be used in order to produce a
+	    graphical representation of the calculated topologies.
+	    see <http://www.boutell.com/gd>
+
+For installation, please see INSTALL note.
+
+Please report bugs, comments or suggestions to:
+Eric Deveaud:    edeveaud at pasteur.fr
diff --git a/TODO b/TODO
new file mode 100644
index 0000000..49ab647
--- /dev/null
+++ b/TODO
@@ -0,0 +1,7 @@
+
+Assorted ToDo items :
+
+* Add tests to exercise `-g' and `-t' formats.
+* Cleanup Text/HTML output functions.
+* Unhandled conflict between `-O html' and `-o outfile'.
+
diff --git a/aclocal.m4 b/aclocal.m4
new file mode 100644
index 0000000..567b9fc
--- /dev/null
+++ b/aclocal.m4
@@ -0,0 +1,1045 @@
+# generated automatically by aclocal 1.9.2 -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004
+# Free Software Foundation, Inc.
+# This file is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+#                                                        -*- Autoconf -*-
+# Copyright (C) 2002, 2003  Free Software Foundation, Inc.
+# Generated from amversion.in; do not edit by hand.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+
+# AM_AUTOMAKE_VERSION(VERSION)
+# ----------------------------
+# Automake X.Y traces this macro to ensure aclocal.m4 has been
+# generated from the m4 files accompanying Automake X.Y.
+AC_DEFUN([AM_AUTOMAKE_VERSION], [am__api_version="1.9"])
+
+# AM_SET_CURRENT_AUTOMAKE_VERSION
+# -------------------------------
+# Call AM_AUTOMAKE_VERSION so it can be traced.
+# This function is AC_REQUIREd by AC_INIT_AUTOMAKE.
+AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION],
+	 [AM_AUTOMAKE_VERSION([1.9.2])])
+
+# AM_AUX_DIR_EXPAND
+
+# Copyright (C) 2001, 2003 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets
+# $ac_aux_dir to `$srcdir/foo'.  In other projects, it is set to
+# `$srcdir', `$srcdir/..', or `$srcdir/../..'.
+#
+# Of course, Automake must honor this variable whenever it calls a
+# tool from the auxiliary directory.  The problem is that $srcdir (and
+# therefore $ac_aux_dir as well) can be either absolute or relative,
+# depending on how configure is run.  This is pretty annoying, since
+# it makes $ac_aux_dir quite unusable in subdirectories: in the top
+# source directory, any form will work fine, but in subdirectories a
+# relative path needs to be adjusted first.
+#
+# $ac_aux_dir/missing
+#    fails when called from a subdirectory if $ac_aux_dir is relative
+# $top_srcdir/$ac_aux_dir/missing
+#    fails if $ac_aux_dir is absolute,
+#    fails when called from a subdirectory in a VPATH build with
+#          a relative $ac_aux_dir
+#
+# The reason of the latter failure is that $top_srcdir and $ac_aux_dir
+# are both prefixed by $srcdir.  In an in-source build this is usually
+# harmless because $srcdir is `.', but things will broke when you
+# start a VPATH build or use an absolute $srcdir.
+#
+# So we could use something similar to $top_srcdir/$ac_aux_dir/missing,
+# iff we strip the leading $srcdir from $ac_aux_dir.  That would be:
+#   am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"`
+# and then we would define $MISSING as
+#   MISSING="\${SHELL} $am_aux_dir/missing"
+# This will work as long as MISSING is not called from configure, because
+# unfortunately $(top_srcdir) has no meaning in configure.
+# However there are other variables, like CC, which are often used in
+# configure, and could therefore not use this "fixed" $ac_aux_dir.
+#
+# Another solution, used here, is to always expand $ac_aux_dir to an
+# absolute PATH.  The drawback is that using absolute paths prevent a
+# configured tree to be moved without reconfiguration.
+
+AC_DEFUN([AM_AUX_DIR_EXPAND],
+[dnl Rely on autoconf to set up CDPATH properly.
+AC_PREREQ([2.50])dnl
+# expand $ac_aux_dir to an absolute path
+am_aux_dir=`cd $ac_aux_dir && pwd`
+])
+
+# AM_CONDITIONAL                                              -*- Autoconf -*-
+
+# Copyright (C) 1997, 2000, 2001, 2003, 2004 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 6
+
+# AM_CONDITIONAL(NAME, SHELL-CONDITION)
+# -------------------------------------
+# Define a conditional.
+AC_DEFUN([AM_CONDITIONAL],
+[AC_PREREQ(2.52)dnl
+ ifelse([$1], [TRUE],  [AC_FATAL([$0: invalid condition: $1])],
+	[$1], [FALSE], [AC_FATAL([$0: invalid condition: $1])])dnl
+AC_SUBST([$1_TRUE])
+AC_SUBST([$1_FALSE])
+if $2; then
+  $1_TRUE=
+  $1_FALSE='#'
+else
+  $1_TRUE='#'
+  $1_FALSE=
+fi
+AC_CONFIG_COMMANDS_PRE(
+[if test -z "${$1_TRUE}" && test -z "${$1_FALSE}"; then
+  AC_MSG_ERROR([[conditional "$1" was never defined.
+Usually this means the macro was only invoked conditionally.]])
+fi])])
+
+# serial 7						-*- Autoconf -*-
+
+# Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004
+# Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+
+# There are a few dirty hacks below to avoid letting `AC_PROG_CC' be
+# written in clear, in which case automake, when reading aclocal.m4,
+# will think it sees a *use*, and therefore will trigger all it's
+# C support machinery.  Also note that it means that autoscan, seeing
+# CC etc. in the Makefile, will ask for an AC_PROG_CC use...
+
+
+
+# _AM_DEPENDENCIES(NAME)
+# ----------------------
+# See how the compiler implements dependency checking.
+# NAME is "CC", "CXX", "GCJ", or "OBJC".
+# We try a few techniques and use that to set a single cache variable.
+#
+# We don't AC_REQUIRE the corresponding AC_PROG_CC since the latter was
+# modified to invoke _AM_DEPENDENCIES(CC); we would have a circular
+# dependency, and given that the user is not expected to run this macro,
+# just rely on AC_PROG_CC.
+AC_DEFUN([_AM_DEPENDENCIES],
+[AC_REQUIRE([AM_SET_DEPDIR])dnl
+AC_REQUIRE([AM_OUTPUT_DEPENDENCY_COMMANDS])dnl
+AC_REQUIRE([AM_MAKE_INCLUDE])dnl
+AC_REQUIRE([AM_DEP_TRACK])dnl
+
+ifelse([$1], CC,   [depcc="$CC"   am_compiler_list=],
+       [$1], CXX,  [depcc="$CXX"  am_compiler_list=],
+       [$1], OBJC, [depcc="$OBJC" am_compiler_list='gcc3 gcc'],
+       [$1], GCJ,  [depcc="$GCJ"  am_compiler_list='gcc3 gcc'],
+                   [depcc="$$1"   am_compiler_list=])
+
+AC_CACHE_CHECK([dependency style of $depcc],
+               [am_cv_$1_dependencies_compiler_type],
+[if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then
+  # We make a subdir and do the tests there.  Otherwise we can end up
+  # making bogus files that we don't know about and never remove.  For
+  # instance it was reported that on HP-UX the gcc test will end up
+  # making a dummy file named `D' -- because `-MD' means `put the output
+  # in D'.
+  mkdir conftest.dir
+  # Copy depcomp to subdir because otherwise we won't find it if we're
+  # using a relative directory.
+  cp "$am_depcomp" conftest.dir
+  cd conftest.dir
+  # We will build objects and dependencies in a subdirectory because
+  # it helps to detect inapplicable dependency modes.  For instance
+  # both Tru64's cc and ICC support -MD to output dependencies as a
+  # side effect of compilation, but ICC will put the dependencies in
+  # the current directory while Tru64 will put them in the object
+  # directory.
+  mkdir sub
+
+  am_cv_$1_dependencies_compiler_type=none
+  if test "$am_compiler_list" = ""; then
+     am_compiler_list=`sed -n ['s/^#*\([a-zA-Z0-9]*\))$/\1/p'] < ./depcomp`
+  fi
+  for depmode in $am_compiler_list; do
+    # Setup a source with many dependencies, because some compilers
+    # like to wrap large dependency lists on column 80 (with \), and
+    # we should not choose a depcomp mode which is confused by this.
+    #
+    # We need to recreate these files for each test, as the compiler may
+    # overwrite some of them when testing with obscure command lines.
+    # This happens at least with the AIX C compiler.
+    : > sub/conftest.c
+    for i in 1 2 3 4 5 6; do
+      echo '#include "conftst'$i'.h"' >> sub/conftest.c
+      # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with
+      # Solaris 8's {/usr,}/bin/sh.
+      touch sub/conftst$i.h
+    done
+    echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf
+
+    case $depmode in
+    nosideeffect)
+      # after this tag, mechanisms are not by side-effect, so they'll
+      # only be used when explicitly requested
+      if test "x$enable_dependency_tracking" = xyes; then
+	continue
+      else
+	break
+      fi
+      ;;
+    none) break ;;
+    esac
+    # We check with `-c' and `-o' for the sake of the "dashmstdout"
+    # mode.  It turns out that the SunPro C++ compiler does not properly
+    # handle `-M -o', and we need to detect this.
+    if depmode=$depmode \
+       source=sub/conftest.c object=sub/conftest.${OBJEXT-o} \
+       depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \
+       $SHELL ./depcomp $depcc -c -o sub/conftest.${OBJEXT-o} sub/conftest.c \
+         >/dev/null 2>conftest.err &&
+       grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 &&
+       grep sub/conftest.${OBJEXT-o} sub/conftest.Po > /dev/null 2>&1 &&
+       ${MAKE-make} -s -f confmf > /dev/null 2>&1; then
+      # icc doesn't choke on unknown options, it will just issue warnings
+      # or remarks (even with -Werror).  So we grep stderr for any message
+      # that says an option was ignored or not supported.
+      # When given -MP, icc 7.0 and 7.1 complain thusly:
+      #   icc: Command line warning: ignoring option '-M'; no argument required
+      # The diagnosis changed in icc 8.0:
+      #   icc: Command line remark: option '-MP' not supported
+      if (grep 'ignoring option' conftest.err ||
+          grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else
+        am_cv_$1_dependencies_compiler_type=$depmode
+        break
+      fi
+    fi
+  done
+
+  cd ..
+  rm -rf conftest.dir
+else
+  am_cv_$1_dependencies_compiler_type=none
+fi
+])
+AC_SUBST([$1DEPMODE], [depmode=$am_cv_$1_dependencies_compiler_type])
+AM_CONDITIONAL([am__fastdep$1], [
+  test "x$enable_dependency_tracking" != xno \
+  && test "$am_cv_$1_dependencies_compiler_type" = gcc3])
+])
+
+
+# AM_SET_DEPDIR
+# -------------
+# Choose a directory name for dependency files.
+# This macro is AC_REQUIREd in _AM_DEPENDENCIES
+AC_DEFUN([AM_SET_DEPDIR],
+[AC_REQUIRE([AM_SET_LEADING_DOT])dnl
+AC_SUBST([DEPDIR], ["${am__leading_dot}deps"])dnl
+])
+
+
+# AM_DEP_TRACK
+# ------------
+AC_DEFUN([AM_DEP_TRACK],
+[AC_ARG_ENABLE(dependency-tracking,
+[  --disable-dependency-tracking  speeds up one-time build
+  --enable-dependency-tracking   do not reject slow dependency extractors])
+if test "x$enable_dependency_tracking" != xno; then
+  am_depcomp="$ac_aux_dir/depcomp"
+  AMDEPBACKSLASH='\'
+fi
+AM_CONDITIONAL([AMDEP], [test "x$enable_dependency_tracking" != xno])
+AC_SUBST([AMDEPBACKSLASH])
+])
+
+# Generate code to set up dependency tracking.   -*- Autoconf -*-
+
+# Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004
+#   Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+#serial 2
+
+# _AM_OUTPUT_DEPENDENCY_COMMANDS
+# ------------------------------
+AC_DEFUN([_AM_OUTPUT_DEPENDENCY_COMMANDS],
+[for mf in $CONFIG_FILES; do
+  # Strip MF so we end up with the name of the file.
+  mf=`echo "$mf" | sed -e 's/:.*$//'`
+  # Check whether this is an Automake generated Makefile or not.
+  # We used to match only the files named `Makefile.in', but
+  # some people rename them; so instead we look at the file content.
+  # Grep'ing the first line is not enough: some people post-process
+  # each Makefile.in and add a new line on top of each file to say so.
+  # So let's grep whole file.
+  if grep '^#.*generated by automake' $mf > /dev/null 2>&1; then
+    dirpart=`AS_DIRNAME("$mf")`
+  else
+    continue
+  fi
+  # Extract the definition of DEPDIR, am__include, and am__quote
+  # from the Makefile without running `make'.
+  DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"`
+  test -z "$DEPDIR" && continue
+  am__include=`sed -n 's/^am__include = //p' < "$mf"`
+  test -z "am__include" && continue
+  am__quote=`sed -n 's/^am__quote = //p' < "$mf"`
+  # When using ansi2knr, U may be empty or an underscore; expand it
+  U=`sed -n 's/^U = //p' < "$mf"`
+  # Find all dependency output files, they are included files with
+  # $(DEPDIR) in their names.  We invoke sed twice because it is the
+  # simplest approach to changing $(DEPDIR) to its actual value in the
+  # expansion.
+  for file in `sed -n "
+    s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \
+       sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do
+    # Make sure the directory exists.
+    test -f "$dirpart/$file" && continue
+    fdir=`AS_DIRNAME(["$file"])`
+    AS_MKDIR_P([$dirpart/$fdir])
+    # echo "creating $dirpart/$file"
+    echo '# dummy' > "$dirpart/$file"
+  done
+done
+])# _AM_OUTPUT_DEPENDENCY_COMMANDS
+
+
+# AM_OUTPUT_DEPENDENCY_COMMANDS
+# -----------------------------
+# This macro should only be invoked once -- use via AC_REQUIRE.
+#
+# This code is only required when automatic dependency tracking
+# is enabled.  FIXME.  This creates each `.P' file that we will
+# need in order to bootstrap the dependency handling code.
+AC_DEFUN([AM_OUTPUT_DEPENDENCY_COMMANDS],
+[AC_CONFIG_COMMANDS([depfiles],
+     [test x"$AMDEP_TRUE" != x"" || _AM_OUTPUT_DEPENDENCY_COMMANDS],
+     [AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir"])
+])
+
+# Like AC_CONFIG_HEADER, but automatically create stamp file. -*- Autoconf -*-
+
+# Copyright (C) 1996, 1997, 2000, 2001, 2003 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 7
+
+# AM_CONFIG_HEADER is obsolete.  It has been replaced by AC_CONFIG_HEADERS.
+AU_DEFUN([AM_CONFIG_HEADER], [AC_CONFIG_HEADERS($@)])
+
+# Do all the work for Automake.                            -*- Autoconf -*-
+
+# This macro actually does too much some checks are only needed if
+# your package does certain things.  But this isn't really a big deal.
+
+# Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004
+# Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 11
+
+# AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE])
+# AM_INIT_AUTOMAKE([OPTIONS])
+# -----------------------------------------------
+# The call with PACKAGE and VERSION arguments is the old style
+# call (pre autoconf-2.50), which is being phased out.  PACKAGE
+# and VERSION should now be passed to AC_INIT and removed from
+# the call to AM_INIT_AUTOMAKE.
+# We support both call styles for the transition.  After
+# the next Automake release, Autoconf can make the AC_INIT
+# arguments mandatory, and then we can depend on a new Autoconf
+# release and drop the old call support.
+AC_DEFUN([AM_INIT_AUTOMAKE],
+[AC_PREREQ([2.58])dnl
+dnl Autoconf wants to disallow AM_ names.  We explicitly allow
+dnl the ones we care about.
+m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl
+AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl
+AC_REQUIRE([AC_PROG_INSTALL])dnl
+# test to see if srcdir already configured
+if test "`cd $srcdir && pwd`" != "`pwd`" &&
+   test -f $srcdir/config.status; then
+  AC_MSG_ERROR([source directory already configured; run "make distclean" there first])
+fi
+
+# test whether we have cygpath
+if test -z "$CYGPATH_W"; then
+  if (cygpath --version) >/dev/null 2>/dev/null; then
+    CYGPATH_W='cygpath -w'
+  else
+    CYGPATH_W=echo
+  fi
+fi
+AC_SUBST([CYGPATH_W])
+
+# Define the identity of the package.
+dnl Distinguish between old-style and new-style calls.
+m4_ifval([$2],
+[m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl
+ AC_SUBST([PACKAGE], [$1])dnl
+ AC_SUBST([VERSION], [$2])],
+[_AM_SET_OPTIONS([$1])dnl
+ AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl
+ AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl
+
+_AM_IF_OPTION([no-define],,
+[AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package])
+ AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl
+
+# Some tools Automake needs.
+AC_REQUIRE([AM_SANITY_CHECK])dnl
+AC_REQUIRE([AC_ARG_PROGRAM])dnl
+AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version})
+AM_MISSING_PROG(AUTOCONF, autoconf)
+AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version})
+AM_MISSING_PROG(AUTOHEADER, autoheader)
+AM_MISSING_PROG(MAKEINFO, makeinfo)
+AM_PROG_INSTALL_SH
+AM_PROG_INSTALL_STRIP
+AC_REQUIRE([AM_PROG_MKDIR_P])dnl
+# We need awk for the "check" target.  The system "awk" is bad on
+# some platforms.
+AC_REQUIRE([AC_PROG_AWK])dnl
+AC_REQUIRE([AC_PROG_MAKE_SET])dnl
+AC_REQUIRE([AM_SET_LEADING_DOT])dnl
+_AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])],
+              [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])],
+	      		     [_AM_PROG_TAR([v7])])])
+_AM_IF_OPTION([no-dependencies],,
+[AC_PROVIDE_IFELSE([AC_PROG_CC],
+                  [_AM_DEPENDENCIES(CC)],
+                  [define([AC_PROG_CC],
+                          defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl
+AC_PROVIDE_IFELSE([AC_PROG_CXX],
+                  [_AM_DEPENDENCIES(CXX)],
+                  [define([AC_PROG_CXX],
+                          defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl
+])
+])
+
+
+# When config.status generates a header, we must update the stamp-h file.
+# This file resides in the same directory as the config header
+# that is generated.  The stamp files are numbered to have different names.
+
+# Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the
+# loop where config.status creates the headers, so we can generate
+# our stamp files there.
+AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK],
+[# Compute $1's index in $config_headers.
+_am_stamp_count=1
+for _am_header in $config_headers :; do
+  case $_am_header in
+    $1 | $1:* )
+      break ;;
+    * )
+      _am_stamp_count=`expr $_am_stamp_count + 1` ;;
+  esac
+done
+echo "timestamp for $1" >`AS_DIRNAME([$1])`/stamp-h[]$_am_stamp_count])
+
+# AM_PROG_INSTALL_SH
+# ------------------
+# Define $install_sh.
+
+# Copyright (C) 2001, 2003 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+AC_DEFUN([AM_PROG_INSTALL_SH],
+[AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl
+install_sh=${install_sh-"$am_aux_dir/install-sh"}
+AC_SUBST(install_sh)])
+
+#                                                          -*- Autoconf -*-
+# Copyright (C) 2003  Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 1
+
+# Check whether the underlying file-system supports filenames
+# with a leading dot.  For instance MS-DOS doesn't.
+AC_DEFUN([AM_SET_LEADING_DOT],
+[rm -rf .tst 2>/dev/null
+mkdir .tst 2>/dev/null
+if test -d .tst; then
+  am__leading_dot=.
+else
+  am__leading_dot=_
+fi
+rmdir .tst 2>/dev/null
+AC_SUBST([am__leading_dot])])
+
+# Check to see how 'make' treats includes.	-*- Autoconf -*-
+
+# Copyright (C) 2001, 2002, 2003 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 2
+
+# AM_MAKE_INCLUDE()
+# -----------------
+# Check to see how make treats includes.
+AC_DEFUN([AM_MAKE_INCLUDE],
+[am_make=${MAKE-make}
+cat > confinc << 'END'
+am__doit:
+	@echo done
+.PHONY: am__doit
+END
+# If we don't find an include directive, just comment out the code.
+AC_MSG_CHECKING([for style of include used by $am_make])
+am__include="#"
+am__quote=
+_am_result=none
+# First try GNU make style include.
+echo "include confinc" > confmf
+# We grep out `Entering directory' and `Leaving directory'
+# messages which can occur if `w' ends up in MAKEFLAGS.
+# In particular we don't look at `^make:' because GNU make might
+# be invoked under some other name (usually "gmake"), in which
+# case it prints its new name instead of `make'.
+if test "`$am_make -s -f confmf 2> /dev/null | grep -v 'ing directory'`" = "done"; then
+   am__include=include
+   am__quote=
+   _am_result=GNU
+fi
+# Now try BSD make style include.
+if test "$am__include" = "#"; then
+   echo '.include "confinc"' > confmf
+   if test "`$am_make -s -f confmf 2> /dev/null`" = "done"; then
+      am__include=.include
+      am__quote="\""
+      _am_result=BSD
+   fi
+fi
+AC_SUBST([am__include])
+AC_SUBST([am__quote])
+AC_MSG_RESULT([$_am_result])
+rm -f confinc confmf
+])
+
+#  -*- Autoconf -*-
+
+
+# Copyright (C) 1997, 1999, 2000, 2001, 2003 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 3
+
+# AM_MISSING_PROG(NAME, PROGRAM)
+# ------------------------------
+AC_DEFUN([AM_MISSING_PROG],
+[AC_REQUIRE([AM_MISSING_HAS_RUN])
+$1=${$1-"${am_missing_run}$2"}
+AC_SUBST($1)])
+
+
+# AM_MISSING_HAS_RUN
+# ------------------
+# Define MISSING if not defined so far and test if it supports --run.
+# If it does, set am_missing_run to use it, otherwise, to nothing.
+AC_DEFUN([AM_MISSING_HAS_RUN],
+[AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl
+test x"${MISSING+set}" = xset || MISSING="\${SHELL} $am_aux_dir/missing"
+# Use eval to expand $SHELL
+if eval "$MISSING --run true"; then
+  am_missing_run="$MISSING --run "
+else
+  am_missing_run=
+  AC_MSG_WARN([`missing' script is too old or missing])
+fi
+])
+
+# AM_PROG_MKDIR_P
+# ---------------
+# Check whether `mkdir -p' is supported, fallback to mkinstalldirs otherwise.
+
+# Copyright (C) 2003, 2004 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# Automake 1.8 used `mkdir -m 0755 -p --' to ensure that directories
+# created by `make install' are always world readable, even if the
+# installer happens to have an overly restrictive umask (e.g. 077).
+# This was a mistake.  There are at least two reasons why we must not
+# use `-m 0755':
+#   - it causes special bits like SGID to be ignored,
+#   - it may be too restrictive (some setups expect 775 directories).
+#
+# Do not use -m 0755 and let people choose whatever they expect by
+# setting umask.
+#
+# We cannot accept any implementation of `mkdir' that recognizes `-p'.
+# Some implementations (such as Solaris 8's) are not thread-safe: if a
+# parallel make tries to run `mkdir -p a/b' and `mkdir -p a/c'
+# concurrently, both version can detect that a/ is missing, but only
+# one can create it and the other will error out.  Consequently we
+# restrict ourselves to GNU make (using the --version option ensures
+# this.)
+AC_DEFUN([AM_PROG_MKDIR_P],
+[if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then
+  # We used to keeping the `.' as first argument, in order to
+  # allow $(mkdir_p) to be used without argument.  As in
+  #   $(mkdir_p) $(somedir)
+  # where $(somedir) is conditionally defined.  However this is wrong
+  # for two reasons:
+  #  1. if the package is installed by a user who cannot write `.'
+  #     make install will fail,
+  #  2. the above comment should most certainly read
+  #     $(mkdir_p) $(DESTDIR)$(somedir)
+  #     so it does not work when $(somedir) is undefined and
+  #     $(DESTDIR) is not.
+  #  To support the latter case, we have to write
+  #     test -z "$(somedir)" || $(mkdir_p) $(DESTDIR)$(somedir),
+  #  so the `.' trick is pointless.
+  mkdir_p='mkdir -p --'
+else
+  # On NextStep and OpenStep, the `mkdir' command does not
+  # recognize any option.  It will interpret all options as
+  # directories to create, and then abort because `.' already
+  # exists.
+  for d in ./-p ./--version;
+  do
+    test -d $d && rmdir $d
+  done
+  # $(mkinstalldirs) is defined by Automake if mkinstalldirs exists.
+  if test -f "$ac_aux_dir/mkinstalldirs"; then
+    mkdir_p='$(mkinstalldirs)'
+  else
+    mkdir_p='$(install_sh) -d'
+  fi
+fi
+AC_SUBST([mkdir_p])])
+
+# Helper functions for option handling.                    -*- Autoconf -*-
+
+# Copyright (C) 2001, 2002, 2003  Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 2
+
+# _AM_MANGLE_OPTION(NAME)
+# -----------------------
+AC_DEFUN([_AM_MANGLE_OPTION],
+[[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])])
+
+# _AM_SET_OPTION(NAME)
+# ------------------------------
+# Set option NAME.  Presently that only means defining a flag for this option.
+AC_DEFUN([_AM_SET_OPTION],
+[m4_define(_AM_MANGLE_OPTION([$1]), 1)])
+
+# _AM_SET_OPTIONS(OPTIONS)
+# ----------------------------------
+# OPTIONS is a space-separated list of Automake options.
+AC_DEFUN([_AM_SET_OPTIONS],
+[AC_FOREACH([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])])
+
+# _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET])
+# -------------------------------------------
+# Execute IF-SET if OPTION is set, IF-NOT-SET otherwise.
+AC_DEFUN([_AM_IF_OPTION],
+[m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])])
+
+#
+# Check to make sure that the build environment is sane.
+#
+
+# Copyright (C) 1996, 1997, 2000, 2001, 2003 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 3
+
+# AM_SANITY_CHECK
+# ---------------
+AC_DEFUN([AM_SANITY_CHECK],
+[AC_MSG_CHECKING([whether build environment is sane])
+# Just in case
+sleep 1
+echo timestamp > conftest.file
+# Do `set' in a subshell so we don't clobber the current shell's
+# arguments.  Must try -L first in case configure is actually a
+# symlink; some systems play weird games with the mod time of symlinks
+# (eg FreeBSD returns the mod time of the symlink's containing
+# directory).
+if (
+   set X `ls -Lt $srcdir/configure conftest.file 2> /dev/null`
+   if test "$[*]" = "X"; then
+      # -L didn't work.
+      set X `ls -t $srcdir/configure conftest.file`
+   fi
+   rm -f conftest.file
+   if test "$[*]" != "X $srcdir/configure conftest.file" \
+      && test "$[*]" != "X conftest.file $srcdir/configure"; then
+
+      # If neither matched, then we have a broken ls.  This can happen
+      # if, for instance, CONFIG_SHELL is bash and it inherits a
+      # broken ls alias from the environment.  This has actually
+      # happened.  Such a system could not be considered "sane".
+      AC_MSG_ERROR([ls -t appears to fail.  Make sure there is not a broken
+alias in your environment])
+   fi
+
+   test "$[2]" = conftest.file
+   )
+then
+   # Ok.
+   :
+else
+   AC_MSG_ERROR([newly created file is older than distributed files!
+Check your system clock])
+fi
+AC_MSG_RESULT(yes)])
+
+# AM_PROG_INSTALL_STRIP
+
+# Copyright (C) 2001, 2003 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# One issue with vendor `install' (even GNU) is that you can't
+# specify the program used to strip binaries.  This is especially
+# annoying in cross-compiling environments, where the build's strip
+# is unlikely to handle the host's binaries.
+# Fortunately install-sh will honor a STRIPPROG variable, so we
+# always use install-sh in `make install-strip', and initialize
+# STRIPPROG with the value of the STRIP variable (set by the user).
+AC_DEFUN([AM_PROG_INSTALL_STRIP],
+[AC_REQUIRE([AM_PROG_INSTALL_SH])dnl
+# Installed binaries are usually stripped using `strip' when the user
+# run `make install-strip'.  However `strip' might not be the right
+# tool to use in cross-compilation environments, therefore Automake
+# will honor the `STRIP' environment variable to overrule this program.
+dnl Don't test for $cross_compiling = yes, because it might be `maybe'.
+if test "$cross_compiling" != no; then
+  AC_CHECK_TOOL([STRIP], [strip], :)
+fi
+INSTALL_STRIP_PROGRAM="\${SHELL} \$(install_sh) -c -s"
+AC_SUBST([INSTALL_STRIP_PROGRAM])])
+
+# Check how to create a tarball.                            -*- Autoconf -*-
+
+# Copyright (C) 2004  Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA
+# 02111-1307, USA.
+
+# serial 1
+
+
+# _AM_PROG_TAR(FORMAT)
+# --------------------
+# Check how to create a tarball in format FORMAT.
+# FORMAT should be one of `v7', `ustar', or `pax'.
+#
+# Substitute a variable $(am__tar) that is a command
+# writing to stdout a FORMAT-tarball containing the directory
+# $tardir.
+#     tardir=directory && $(am__tar) > result.tar
+#
+# Substitute a variable $(am__untar) that extract such
+# a tarball read from stdin.
+#     $(am__untar) < result.tar
+AC_DEFUN([_AM_PROG_TAR],
+[# Always define AMTAR for backward compatibility.
+AM_MISSING_PROG([AMTAR], [tar])
+m4_if([$1], [v7],
+     [am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'],
+     [m4_case([$1], [ustar],, [pax],,
+              [m4_fatal([Unknown tar format])])
+AC_MSG_CHECKING([how to create a $1 tar archive])
+# Loop over all known methods to create a tar archive until one works.
+_am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none'
+_am_tools=${am_cv_prog_tar_$1-$_am_tools}
+# Do not fold the above two line into one, because Tru64 sh and
+# Solaris sh will not grok spaces in the rhs of `-'.
+for _am_tool in $_am_tools
+do
+  case $_am_tool in
+  gnutar)
+    for _am_tar in tar gnutar gtar;
+    do
+      AM_RUN_LOG([$_am_tar --version]) && break
+    done
+    am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"'
+    am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"'
+    am__untar="$_am_tar -xf -"
+    ;;
+  plaintar)
+    # Must skip GNU tar: if it does not support --format= it doesn't create
+    # ustar tarball either.
+    (tar --version) >/dev/null 2>&1 && continue
+    am__tar='tar chf - "$$tardir"'
+    am__tar_='tar chf - "$tardir"'
+    am__untar='tar xf -'
+    ;;
+  pax)
+    am__tar='pax -L -x $1 -w "$$tardir"'
+    am__tar_='pax -L -x $1 -w "$tardir"'
+    am__untar='pax -r'
+    ;;
+  cpio)
+    am__tar='find "$$tardir" -print | cpio -o -H $1 -L'
+    am__tar_='find "$tardir" -print | cpio -o -H $1 -L'
+    am__untar='cpio -i -H $1 -d'
+    ;;
+  none)
+    am__tar=false
+    am__tar_=false
+    am__untar=false
+    ;;
+  esac
+
+  # If the value was cached, stop now.  We just wanted to have am__tar
+  # and am__untar set.
+  test -n "${am_cv_prog_tar_$1}" && break
+
+  # tar/untar a dummy directory, and stop if the command works
+  rm -rf conftest.dir
+  mkdir conftest.dir
+  echo GrepMe > conftest.dir/file
+  AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar])
+  rm -rf conftest.dir
+  if test -s conftest.tar; then
+    AM_RUN_LOG([$am__untar <conftest.tar])
+    grep GrepMe conftest.dir/file >/dev/null 2>&1 && break
+  fi
+done
+rm -rf conftest.dir
+
+AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool])
+AC_MSG_RESULT([$am_cv_prog_tar_$1])])
+AC_SUBST([am__tar])
+AC_SUBST([am__untar])
+]) # _AM_PROG_TAR
+
+m4_include([m4/aclibgd.m4])
diff --git a/config.guess b/config.guess
new file mode 100755
index 0000000..917bbc5
--- /dev/null
+++ b/config.guess
@@ -0,0 +1,1463 @@
+#! /bin/sh
+# Attempt to guess a canonical system name.
+#   Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999,
+#   2000, 2001, 2002, 2003, 2004, 2005 Free Software Foundation, Inc.
+
+timestamp='2005-07-08'
+
+# This file is free software; you can redistribute it and/or modify it
+# under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2 of the License, or
+# (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful, but
+# WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
+# General Public License for more details.
+#
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA
+# 02110-1301, USA.
+#
+# As a special exception to the GNU General Public License, if you
+# distribute this file as part of a program that contains a
+# configuration script generated by Autoconf, you may include it under
+# the same distribution terms that you use for the rest of that program.
+
+
+# Originally written by Per Bothner <per at bothner.com>.
+# Please send patches to <config-patches at gnu.org>.  Submit a context
+# diff and a properly formatted ChangeLog entry.
+#
+# This script attempts to guess a canonical system name similar to
+# config.sub.  If it succeeds, it prints the system name on stdout, and
+# exits with 0.  Otherwise, it exits with 1.
+#
+# The plan is that this can be called by configure scripts if you
+# don't specify an explicit build system type.
+
+me=`echo "$0" | sed -e 's,.*/,,'`
+
+usage="\
+Usage: $0 [OPTION]
+
+Output the configuration name of the system \`$me' is run on.
+
+Operation modes:
+  -h, --help         print this help, then exit
+  -t, --time-stamp   print date of last modification, then exit
+  -v, --version      print version number, then exit
+
+Report bugs and patches to <config-patches at gnu.org>."
+
+version="\
+GNU config.guess ($timestamp)
+
+Originally written by Per Bothner.
+Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005
+Free Software Foundation, Inc.
+
+This is free software; see the source for copying conditions.  There is NO
+warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE."
+
+help="
+Try \`$me --help' for more information."
+
+# Parse command line
+while test $# -gt 0 ; do
+  case $1 in
+    --time-stamp | --time* | -t )
+       echo "$timestamp" ; exit ;;
+    --version | -v )
+       echo "$version" ; exit ;;
+    --help | --h* | -h )
+       echo "$usage"; exit ;;
+    -- )     # Stop option processing
+       shift; break ;;
+    - )	# Use stdin as input.
+       break ;;
+    -* )
+       echo "$me: invalid option $1$help" >&2
+       exit 1 ;;
+    * )
+       break ;;
+  esac
+done
+
+if test $# != 0; then
+  echo "$me: too many arguments$help" >&2
+  exit 1
+fi
+
+trap 'exit 1' 1 2 15
+
+# CC_FOR_BUILD -- compiler used by this script. Note that the use of a
+# compiler to aid in system detection is discouraged as it requires
+# temporary files to be created and, as you can see below, it is a
+# headache to deal with in a portable fashion.
+
+# Historically, `CC_FOR_BUILD' used to be named `HOST_CC'. We still
+# use `HOST_CC' if defined, but it is deprecated.
+
+# Portable tmp directory creation inspired by the Autoconf team.
+
+set_cc_for_build='
+trap "exitcode=\$?; (rm -f \$tmpfiles 2>/dev/null; rmdir \$tmp 2>/dev/null) && exit \$exitcode" 0 ;
+trap "rm -f \$tmpfiles 2>/dev/null; rmdir \$tmp 2>/dev/null; exit 1" 1 2 13 15 ;
+: ${TMPDIR=/tmp} ;
+ { tmp=`(umask 077 && mktemp -d -q "$TMPDIR/cgXXXXXX") 2>/dev/null` && test -n "$tmp" && test -d "$tmp" ; } ||
+ { test -n "$RANDOM" && tmp=$TMPDIR/cg$$-$RANDOM && (umask 077 && mkdir $tmp) ; } ||
+ { tmp=$TMPDIR/cg-$$ && (umask 077 && mkdir $tmp) && echo "Warning: creating insecure temp directory" >&2 ; } ||
+ { echo "$me: cannot create a temporary directory in $TMPDIR" >&2 ; exit 1 ; } ;
+dummy=$tmp/dummy ;
+tmpfiles="$dummy.c $dummy.o $dummy.rel $dummy" ;
+case $CC_FOR_BUILD,$HOST_CC,$CC in
+ ,,)    echo "int x;" > $dummy.c ;
+	for c in cc gcc c89 c99 ; do
+	  if ($c -c -o $dummy.o $dummy.c) >/dev/null 2>&1 ; then
+	     CC_FOR_BUILD="$c"; break ;
+	  fi ;
+	done ;
+	if test x"$CC_FOR_BUILD" = x ; then
+	  CC_FOR_BUILD=no_compiler_found ;
+	fi
+	;;
+ ,,*)   CC_FOR_BUILD=$CC ;;
+ ,*,*)  CC_FOR_BUILD=$HOST_CC ;;
+esac ; set_cc_for_build= ;'
+
+# This is needed to find uname on a Pyramid OSx when run in the BSD universe.
+# (ghazi at noc.rutgers.edu 1994-08-24)
+if (test -f /.attbin/uname) >/dev/null 2>&1 ; then
+	PATH=$PATH:/.attbin ; export PATH
+fi
+
+UNAME_MACHINE=`(uname -m) 2>/dev/null` || UNAME_MACHINE=unknown
+UNAME_RELEASE=`(uname -r) 2>/dev/null` || UNAME_RELEASE=unknown
+UNAME_SYSTEM=`(uname -s) 2>/dev/null`  || UNAME_SYSTEM=unknown
+UNAME_VERSION=`(uname -v) 2>/dev/null` || UNAME_VERSION=unknown
+
+# Note: order is significant - the case branches are not exclusive.
+
+case "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" in
+    *:NetBSD:*:*)
+	# NetBSD (nbsd) targets should (where applicable) match one or
+	# more of the tupples: *-*-netbsdelf*, *-*-netbsdaout*,
+	# *-*-netbsdecoff* and *-*-netbsd*.  For targets that recently
+	# switched to ELF, *-*-netbsd* would select the old
+	# object file format.  This provides both forward
+	# compatibility and a consistent mechanism for selecting the
+	# object file format.
+	#
+	# Note: NetBSD doesn't particularly care about the vendor
+	# portion of the name.  We always set it to "unknown".
+	sysctl="sysctl -n hw.machine_arch"
+	UNAME_MACHINE_ARCH=`(/sbin/$sysctl 2>/dev/null || \
+	    /usr/sbin/$sysctl 2>/dev/null || echo unknown)`
+	case "${UNAME_MACHINE_ARCH}" in
+	    armeb) machine=armeb-unknown ;;
+	    arm*) machine=arm-unknown ;;
+	    sh3el) machine=shl-unknown ;;
+	    sh3eb) machine=sh-unknown ;;
+	    *) machine=${UNAME_MACHINE_ARCH}-unknown ;;
+	esac
+	# The Operating System including object format, if it has switched
+	# to ELF recently, or will in the future.
+	case "${UNAME_MACHINE_ARCH}" in
+	    arm*|i386|m68k|ns32k|sh3*|sparc|vax)
+		eval $set_cc_for_build
+		if echo __ELF__ | $CC_FOR_BUILD -E - 2>/dev/null \
+			| grep __ELF__ >/dev/null
+		then
+		    # Once all utilities can be ECOFF (netbsdecoff) or a.out (netbsdaout).
+		    # Return netbsd for either.  FIX?
+		    os=netbsd
+		else
+		    os=netbsdelf
+		fi
+		;;
+	    *)
+	        os=netbsd
+		;;
+	esac
+	# The OS release
+	# Debian GNU/NetBSD machines have a different userland, and
+	# thus, need a distinct triplet. However, they do not need
+	# kernel version information, so it can be replaced with a
+	# suitable tag, in the style of linux-gnu.
+	case "${UNAME_VERSION}" in
+	    Debian*)
+		release='-gnu'
+		;;
+	    *)
+		release=`echo ${UNAME_RELEASE}|sed -e 's/[-_].*/\./'`
+		;;
+	esac
+	# Since CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM:
+	# contains redundant information, the shorter form:
+	# CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM is used.
+	echo "${machine}-${os}${release}"
+	exit ;;
+    *:OpenBSD:*:*)
+	UNAME_MACHINE_ARCH=`arch | sed 's/OpenBSD.//'`
+	echo ${UNAME_MACHINE_ARCH}-unknown-openbsd${UNAME_RELEASE}
+	exit ;;
+    *:ekkoBSD:*:*)
+	echo ${UNAME_MACHINE}-unknown-ekkobsd${UNAME_RELEASE}
+	exit ;;
+    macppc:MirBSD:*:*)
+	echo powerppc-unknown-mirbsd${UNAME_RELEASE}
+	exit ;;
+    *:MirBSD:*:*)
+	echo ${UNAME_MACHINE}-unknown-mirbsd${UNAME_RELEASE}
+	exit ;;
+    alpha:OSF1:*:*)
+	case $UNAME_RELEASE in
+	*4.0)
+		UNAME_RELEASE=`/usr/sbin/sizer -v | awk '{print $3}'`
+		;;
+	*5.*)
+	        UNAME_RELEASE=`/usr/sbin/sizer -v | awk '{print $4}'`
+		;;
+	esac
+	# According to Compaq, /usr/sbin/psrinfo has been available on
+	# OSF/1 and Tru64 systems produced since 1995.  I hope that
+	# covers most systems running today.  This code pipes the CPU
+	# types through head -n 1, so we only detect the type of CPU 0.
+	ALPHA_CPU_TYPE=`/usr/sbin/psrinfo -v | sed -n -e 's/^  The alpha \(.*\) processor.*$/\1/p' | head -n 1`
+	case "$ALPHA_CPU_TYPE" in
+	    "EV4 (21064)")
+		UNAME_MACHINE="alpha" ;;
+	    "EV4.5 (21064)")
+		UNAME_MACHINE="alpha" ;;
+	    "LCA4 (21066/21068)")
+		UNAME_MACHINE="alpha" ;;
+	    "EV5 (21164)")
+		UNAME_MACHINE="alphaev5" ;;
+	    "EV5.6 (21164A)")
+		UNAME_MACHINE="alphaev56" ;;
+	    "EV5.6 (21164PC)")
+		UNAME_MACHINE="alphapca56" ;;
+	    "EV5.7 (21164PC)")
+		UNAME_MACHINE="alphapca57" ;;
+	    "EV6 (21264)")
+		UNAME_MACHINE="alphaev6" ;;
+	    "EV6.7 (21264A)")
+		UNAME_MACHINE="alphaev67" ;;
+	    "EV6.8CB (21264C)")
+		UNAME_MACHINE="alphaev68" ;;
+	    "EV6.8AL (21264B)")
+		UNAME_MACHINE="alphaev68" ;;
+	    "EV6.8CX (21264D)")
+		UNAME_MACHINE="alphaev68" ;;
+	    "EV6.9A (21264/EV69A)")
+		UNAME_MACHINE="alphaev69" ;;
+	    "EV7 (21364)")
+		UNAME_MACHINE="alphaev7" ;;
+	    "EV7.9 (21364A)")
+		UNAME_MACHINE="alphaev79" ;;
+	esac
+	# A Pn.n version is a patched version.
+	# A Vn.n version is a released version.
+	# A Tn.n version is a released field test version.
+	# A Xn.n version is an unreleased experimental baselevel.
+	# 1.2 uses "1.2" for uname -r.
+	echo ${UNAME_MACHINE}-dec-osf`echo ${UNAME_RELEASE} | sed -e 's/^[PVTX]//' | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz'`
+	exit ;;
+    Alpha\ *:Windows_NT*:*)
+	# How do we know it's Interix rather than the generic POSIX subsystem?
+	# Should we change UNAME_MACHINE based on the output of uname instead
+	# of the specific Alpha model?
+	echo alpha-pc-interix
+	exit ;;
+    21064:Windows_NT:50:3)
+	echo alpha-dec-winnt3.5
+	exit ;;
+    Amiga*:UNIX_System_V:4.0:*)
+	echo m68k-unknown-sysv4
+	exit ;;
+    *:[Aa]miga[Oo][Ss]:*:*)
+	echo ${UNAME_MACHINE}-unknown-amigaos
+	exit ;;
+    *:[Mm]orph[Oo][Ss]:*:*)
+	echo ${UNAME_MACHINE}-unknown-morphos
+	exit ;;
+    *:OS/390:*:*)
+	echo i370-ibm-openedition
+	exit ;;
+    *:z/VM:*:*)
+	echo s390-ibm-zvmoe
+	exit ;;
+    *:OS400:*:*)
+        echo powerpc-ibm-os400
+	exit ;;
+    arm:RISC*:1.[012]*:*|arm:riscix:1.[012]*:*)
+	echo arm-acorn-riscix${UNAME_RELEASE}
+	exit ;;
+    arm:riscos:*:*|arm:RISCOS:*:*)
+	echo arm-unknown-riscos
+	exit ;;
+    SR2?01:HI-UX/MPP:*:* | SR8000:HI-UX/MPP:*:*)
+	echo hppa1.1-hitachi-hiuxmpp
+	exit ;;
+    Pyramid*:OSx*:*:* | MIS*:OSx*:*:* | MIS*:SMP_DC-OSx*:*:*)
+	# akee at wpdis03.wpafb.af.mil (Earle F. Ake) contributed MIS and NILE.
+	if test "`(/bin/universe) 2>/dev/null`" = att ; then
+		echo pyramid-pyramid-sysv3
+	else
+		echo pyramid-pyramid-bsd
+	fi
+	exit ;;
+    NILE*:*:*:dcosx)
+	echo pyramid-pyramid-svr4
+	exit ;;
+    DRS?6000:unix:4.0:6*)
+	echo sparc-icl-nx6
+	exit ;;
+    DRS?6000:UNIX_SV:4.2*:7* | DRS?6000:isis:4.2*:7*)
+	case `/usr/bin/uname -p` in
+	    sparc) echo sparc-icl-nx7; exit ;;
+	esac ;;
+    sun4H:SunOS:5.*:*)
+	echo sparc-hal-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'`
+	exit ;;
+    sun4*:SunOS:5.*:* | tadpole*:SunOS:5.*:*)
+	echo sparc-sun-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'`
+	exit ;;
+    i86pc:SunOS:5.*:*)
+	echo i386-pc-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'`
+	exit ;;
+    sun4*:SunOS:6*:*)
+	# According to config.sub, this is the proper way to canonicalize
+	# SunOS6.  Hard to guess exactly what SunOS6 will be like, but
+	# it's likely to be more like Solaris than SunOS4.
+	echo sparc-sun-solaris3`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'`
+	exit ;;
+    sun4*:SunOS:*:*)
+	case "`/usr/bin/arch -k`" in
+	    Series*|S4*)
+		UNAME_RELEASE=`uname -v`
+		;;
+	esac
+	# Japanese Language versions have a version number like `4.1.3-JL'.
+	echo sparc-sun-sunos`echo ${UNAME_RELEASE}|sed -e 's/-/_/'`
+	exit ;;
+    sun3*:SunOS:*:*)
+	echo m68k-sun-sunos${UNAME_RELEASE}
+	exit ;;
+    sun*:*:4.2BSD:*)
+	UNAME_RELEASE=`(sed 1q /etc/motd | awk '{print substr($5,1,3)}') 2>/dev/null`
+	test "x${UNAME_RELEASE}" = "x" && UNAME_RELEASE=3
+	case "`/bin/arch`" in
+	    sun3)
+		echo m68k-sun-sunos${UNAME_RELEASE}
+		;;
+	    sun4)
+		echo sparc-sun-sunos${UNAME_RELEASE}
+		;;
+	esac
+	exit ;;
+    aushp:SunOS:*:*)
+	echo sparc-auspex-sunos${UNAME_RELEASE}
+	exit ;;
+    # The situation for MiNT is a little confusing.  The machine name
+    # can be virtually everything (everything which is not
+    # "atarist" or "atariste" at least should have a processor
+    # > m68000).  The system name ranges from "MiNT" over "FreeMiNT"
+    # to the lowercase version "mint" (or "freemint").  Finally
+    # the system name "TOS" denotes a system which is actually not
+    # MiNT.  But MiNT is downward compatible to TOS, so this should
+    # be no problem.
+    atarist[e]:*MiNT:*:* | atarist[e]:*mint:*:* | atarist[e]:*TOS:*:*)
+        echo m68k-atari-mint${UNAME_RELEASE}
+	exit ;;
+    atari*:*MiNT:*:* | atari*:*mint:*:* | atarist[e]:*TOS:*:*)
+	echo m68k-atari-mint${UNAME_RELEASE}
+        exit ;;
+    *falcon*:*MiNT:*:* | *falcon*:*mint:*:* | *falcon*:*TOS:*:*)
+        echo m68k-atari-mint${UNAME_RELEASE}
+	exit ;;
+    milan*:*MiNT:*:* | milan*:*mint:*:* | *milan*:*TOS:*:*)
+        echo m68k-milan-mint${UNAME_RELEASE}
+        exit ;;
+    hades*:*MiNT:*:* | hades*:*mint:*:* | *hades*:*TOS:*:*)
+        echo m68k-hades-mint${UNAME_RELEASE}
+        exit ;;
+    *:*MiNT:*:* | *:*mint:*:* | *:*TOS:*:*)
+        echo m68k-unknown-mint${UNAME_RELEASE}
+        exit ;;
+    m68k:machten:*:*)
+	echo m68k-apple-machten${UNAME_RELEASE}
+	exit ;;
+    powerpc:machten:*:*)
+	echo powerpc-apple-machten${UNAME_RELEASE}
+	exit ;;
+    RISC*:Mach:*:*)
+	echo mips-dec-mach_bsd4.3
+	exit ;;
+    RISC*:ULTRIX:*:*)
+	echo mips-dec-ultrix${UNAME_RELEASE}
+	exit ;;
+    VAX*:ULTRIX*:*:*)
+	echo vax-dec-ultrix${UNAME_RELEASE}
+	exit ;;
+    2020:CLIX:*:* | 2430:CLIX:*:*)
+	echo clipper-intergraph-clix${UNAME_RELEASE}
+	exit ;;
+    mips:*:*:UMIPS | mips:*:*:RISCos)
+	eval $set_cc_for_build
+	sed 's/^	//' << EOF >$dummy.c
+#ifdef __cplusplus
+#include <stdio.h>  /* for printf() prototype */
+	int main (int argc, char *argv[]) {
+#else
+	int main (argc, argv) int argc; char *argv[]; {
+#endif
+	#if defined (host_mips) && defined (MIPSEB)
+	#if defined (SYSTYPE_SYSV)
+	  printf ("mips-mips-riscos%ssysv\n", argv[1]); exit (0);
+	#endif
+	#if defined (SYSTYPE_SVR4)
+	  printf ("mips-mips-riscos%ssvr4\n", argv[1]); exit (0);
+	#endif
+	#if defined (SYSTYPE_BSD43) || defined(SYSTYPE_BSD)
+	  printf ("mips-mips-riscos%sbsd\n", argv[1]); exit (0);
+	#endif
+	#endif
+	  exit (-1);
+	}
+EOF
+	$CC_FOR_BUILD -o $dummy $dummy.c &&
+	  dummyarg=`echo "${UNAME_RELEASE}" | sed -n 's/\([0-9]*\).*/\1/p'` &&
+	  SYSTEM_NAME=`$dummy $dummyarg` &&
+	    { echo "$SYSTEM_NAME"; exit; }
+	echo mips-mips-riscos${UNAME_RELEASE}
+	exit ;;
+    Motorola:PowerMAX_OS:*:*)
+	echo powerpc-motorola-powermax
+	exit ;;
+    Motorola:*:4.3:PL8-*)
+	echo powerpc-harris-powermax
+	exit ;;
+    Night_Hawk:*:*:PowerMAX_OS | Synergy:PowerMAX_OS:*:*)
+	echo powerpc-harris-powermax
+	exit ;;
+    Night_Hawk:Power_UNIX:*:*)
+	echo powerpc-harris-powerunix
+	exit ;;
+    m88k:CX/UX:7*:*)
+	echo m88k-harris-cxux7
+	exit ;;
+    m88k:*:4*:R4*)
+	echo m88k-motorola-sysv4
+	exit ;;
+    m88k:*:3*:R3*)
+	echo m88k-motorola-sysv3
+	exit ;;
+    AViiON:dgux:*:*)
+        # DG/UX returns AViiON for all architectures
+        UNAME_PROCESSOR=`/usr/bin/uname -p`
+	if [ $UNAME_PROCESSOR = mc88100 ] || [ $UNAME_PROCESSOR = mc88110 ]
+	then
+	    if [ ${TARGET_BINARY_INTERFACE}x = m88kdguxelfx ] || \
+	       [ ${TARGET_BINARY_INTERFACE}x = x ]
+	    then
+		echo m88k-dg-dgux${UNAME_RELEASE}
+	    else
+		echo m88k-dg-dguxbcs${UNAME_RELEASE}
+	    fi
+	else
+	    echo i586-dg-dgux${UNAME_RELEASE}
+	fi
+ 	exit ;;
+    M88*:DolphinOS:*:*)	# DolphinOS (SVR3)
+	echo m88k-dolphin-sysv3
+	exit ;;
+    M88*:*:R3*:*)
+	# Delta 88k system running SVR3
+	echo m88k-motorola-sysv3
+	exit ;;
+    XD88*:*:*:*) # Tektronix XD88 system running UTekV (SVR3)
+	echo m88k-tektronix-sysv3
+	exit ;;
+    Tek43[0-9][0-9]:UTek:*:*) # Tektronix 4300 system running UTek (BSD)
+	echo m68k-tektronix-bsd
+	exit ;;
+    *:IRIX*:*:*)
+	echo mips-sgi-irix`echo ${UNAME_RELEASE}|sed -e 's/-/_/g'`
+	exit ;;
+    ????????:AIX?:[12].1:2)   # AIX 2.2.1 or AIX 2.1.1 is RT/PC AIX.
+	echo romp-ibm-aix     # uname -m gives an 8 hex-code CPU id
+	exit ;;               # Note that: echo "'`uname -s`'" gives 'AIX '
+    i*86:AIX:*:*)
+	echo i386-ibm-aix
+	exit ;;
+    ia64:AIX:*:*)
+	if [ -x /usr/bin/oslevel ] ; then
+		IBM_REV=`/usr/bin/oslevel`
+	else
+		IBM_REV=${UNAME_VERSION}.${UNAME_RELEASE}
+	fi
+	echo ${UNAME_MACHINE}-ibm-aix${IBM_REV}
+	exit ;;
+    *:AIX:2:3)
+	if grep bos325 /usr/include/stdio.h >/dev/null 2>&1; then
+		eval $set_cc_for_build
+		sed 's/^		//' << EOF >$dummy.c
+		#include <sys/systemcfg.h>
+
+		main()
+			{
+			if (!__power_pc())
+				exit(1);
+			puts("powerpc-ibm-aix3.2.5");
+			exit(0);
+			}
+EOF
+		if $CC_FOR_BUILD -o $dummy $dummy.c && SYSTEM_NAME=`$dummy`
+		then
+			echo "$SYSTEM_NAME"
+		else
+			echo rs6000-ibm-aix3.2.5
+		fi
+	elif grep bos324 /usr/include/stdio.h >/dev/null 2>&1; then
+		echo rs6000-ibm-aix3.2.4
+	else
+		echo rs6000-ibm-aix3.2
+	fi
+	exit ;;
+    *:AIX:*:[45])
+	IBM_CPU_ID=`/usr/sbin/lsdev -C -c processor -S available | sed 1q | awk '{ print $1 }'`
+	if /usr/sbin/lsattr -El ${IBM_CPU_ID} | grep ' POWER' >/dev/null 2>&1; then
+		IBM_ARCH=rs6000
+	else
+		IBM_ARCH=powerpc
+	fi
+	if [ -x /usr/bin/oslevel ] ; then
+		IBM_REV=`/usr/bin/oslevel`
+	else
+		IBM_REV=${UNAME_VERSION}.${UNAME_RELEASE}
+	fi
+	echo ${IBM_ARCH}-ibm-aix${IBM_REV}
+	exit ;;
+    *:AIX:*:*)
+	echo rs6000-ibm-aix
+	exit ;;
+    ibmrt:4.4BSD:*|romp-ibm:BSD:*)
+	echo romp-ibm-bsd4.4
+	exit ;;
+    ibmrt:*BSD:*|romp-ibm:BSD:*)            # covers RT/PC BSD and
+	echo romp-ibm-bsd${UNAME_RELEASE}   # 4.3 with uname added to
+	exit ;;                             # report: romp-ibm BSD 4.3
+    *:BOSX:*:*)
+	echo rs6000-bull-bosx
+	exit ;;
+    DPX/2?00:B.O.S.:*:*)
+	echo m68k-bull-sysv3
+	exit ;;
+    9000/[34]??:4.3bsd:1.*:*)
+	echo m68k-hp-bsd
+	exit ;;
+    hp300:4.4BSD:*:* | 9000/[34]??:4.3bsd:2.*:*)
+	echo m68k-hp-bsd4.4
+	exit ;;
+    9000/[34678]??:HP-UX:*:*)
+	HPUX_REV=`echo ${UNAME_RELEASE}|sed -e 's/[^.]*.[0B]*//'`
+	case "${UNAME_MACHINE}" in
+	    9000/31? )            HP_ARCH=m68000 ;;
+	    9000/[34]?? )         HP_ARCH=m68k ;;
+	    9000/[678][0-9][0-9])
+		if [ -x /usr/bin/getconf ]; then
+		    sc_cpu_version=`/usr/bin/getconf SC_CPU_VERSION 2>/dev/null`
+                    sc_kernel_bits=`/usr/bin/getconf SC_KERNEL_BITS 2>/dev/null`
+                    case "${sc_cpu_version}" in
+                      523) HP_ARCH="hppa1.0" ;; # CPU_PA_RISC1_0
+                      528) HP_ARCH="hppa1.1" ;; # CPU_PA_RISC1_1
+                      532)                      # CPU_PA_RISC2_0
+                        case "${sc_kernel_bits}" in
+                          32) HP_ARCH="hppa2.0n" ;;
+                          64) HP_ARCH="hppa2.0w" ;;
+			  '') HP_ARCH="hppa2.0" ;;   # HP-UX 10.20
+                        esac ;;
+                    esac
+		fi
+		if [ "${HP_ARCH}" = "" ]; then
+		    eval $set_cc_for_build
+		    sed 's/^              //' << EOF >$dummy.c
+
+              #define _HPUX_SOURCE
+              #include <stdlib.h>
+              #include <unistd.h>
+
+              int main ()
+              {
+              #if defined(_SC_KERNEL_BITS)
+                  long bits = sysconf(_SC_KERNEL_BITS);
+              #endif
+                  long cpu  = sysconf (_SC_CPU_VERSION);
+
+                  switch (cpu)
+              	{
+              	case CPU_PA_RISC1_0: puts ("hppa1.0"); break;
+              	case CPU_PA_RISC1_1: puts ("hppa1.1"); break;
+              	case CPU_PA_RISC2_0:
+              #if defined(_SC_KERNEL_BITS)
+              	    switch (bits)
+              		{
+              		case 64: puts ("hppa2.0w"); break;
+              		case 32: puts ("hppa2.0n"); break;
+              		default: puts ("hppa2.0"); break;
+              		} break;
+              #else  /* !defined(_SC_KERNEL_BITS) */
+              	    puts ("hppa2.0"); break;
+              #endif
+              	default: puts ("hppa1.0"); break;
+              	}
+                  exit (0);
+              }
+EOF
+		    (CCOPTS= $CC_FOR_BUILD -o $dummy $dummy.c 2>/dev/null) && HP_ARCH=`$dummy`
+		    test -z "$HP_ARCH" && HP_ARCH=hppa
+		fi ;;
+	esac
+	if [ ${HP_ARCH} = "hppa2.0w" ]
+	then
+	    eval $set_cc_for_build
+
+	    # hppa2.0w-hp-hpux* has a 64-bit kernel and a compiler generating
+	    # 32-bit code.  hppa64-hp-hpux* has the same kernel and a compiler
+	    # generating 64-bit code.  GNU and HP use different nomenclature:
+	    #
+	    # $ CC_FOR_BUILD=cc ./config.guess
+	    # => hppa2.0w-hp-hpux11.23
+	    # $ CC_FOR_BUILD="cc +DA2.0w" ./config.guess
+	    # => hppa64-hp-hpux11.23
+
+	    if echo __LP64__ | (CCOPTS= $CC_FOR_BUILD -E - 2>/dev/null) |
+		grep __LP64__ >/dev/null
+	    then
+		HP_ARCH="hppa2.0w"
+	    else
+		HP_ARCH="hppa64"
+	    fi
+	fi
+	echo ${HP_ARCH}-hp-hpux${HPUX_REV}
+	exit ;;
+    ia64:HP-UX:*:*)
+	HPUX_REV=`echo ${UNAME_RELEASE}|sed -e 's/[^.]*.[0B]*//'`
+	echo ia64-hp-hpux${HPUX_REV}
+	exit ;;
+    3050*:HI-UX:*:*)
+	eval $set_cc_for_build
+	sed 's/^	//' << EOF >$dummy.c
+	#include <unistd.h>
+	int
+	main ()
+	{
+	  long cpu = sysconf (_SC_CPU_VERSION);
+	  /* The order matters, because CPU_IS_HP_MC68K erroneously returns
+	     true for CPU_PA_RISC1_0.  CPU_IS_PA_RISC returns correct
+	     results, however.  */
+	  if (CPU_IS_PA_RISC (cpu))
+	    {
+	      switch (cpu)
+		{
+		  case CPU_PA_RISC1_0: puts ("hppa1.0-hitachi-hiuxwe2"); break;
+		  case CPU_PA_RISC1_1: puts ("hppa1.1-hitachi-hiuxwe2"); break;
+		  case CPU_PA_RISC2_0: puts ("hppa2.0-hitachi-hiuxwe2"); break;
+		  default: puts ("hppa-hitachi-hiuxwe2"); break;
+		}
+	    }
+	  else if (CPU_IS_HP_MC68K (cpu))
+	    puts ("m68k-hitachi-hiuxwe2");
+	  else puts ("unknown-hitachi-hiuxwe2");
+	  exit (0);
+	}
+EOF
+	$CC_FOR_BUILD -o $dummy $dummy.c && SYSTEM_NAME=`$dummy` &&
+		{ echo "$SYSTEM_NAME"; exit; }
+	echo unknown-hitachi-hiuxwe2
+	exit ;;
+    9000/7??:4.3bsd:*:* | 9000/8?[79]:4.3bsd:*:* )
+	echo hppa1.1-hp-bsd
+	exit ;;
+    9000/8??:4.3bsd:*:*)
+	echo hppa1.0-hp-bsd
+	exit ;;
+    *9??*:MPE/iX:*:* | *3000*:MPE/iX:*:*)
+	echo hppa1.0-hp-mpeix
+	exit ;;
+    hp7??:OSF1:*:* | hp8?[79]:OSF1:*:* )
+	echo hppa1.1-hp-osf
+	exit ;;
+    hp8??:OSF1:*:*)
+	echo hppa1.0-hp-osf
+	exit ;;
+    i*86:OSF1:*:*)
+	if [ -x /usr/sbin/sysversion ] ; then
+	    echo ${UNAME_MACHINE}-unknown-osf1mk
+	else
+	    echo ${UNAME_MACHINE}-unknown-osf1
+	fi
+	exit ;;
+    parisc*:Lites*:*:*)
+	echo hppa1.1-hp-lites
+	exit ;;
+    C1*:ConvexOS:*:* | convex:ConvexOS:C1*:*)
+	echo c1-convex-bsd
+        exit ;;
+    C2*:ConvexOS:*:* | convex:ConvexOS:C2*:*)
+	if getsysinfo -f scalar_acc
+	then echo c32-convex-bsd
+	else echo c2-convex-bsd
+	fi
+        exit ;;
+    C34*:ConvexOS:*:* | convex:ConvexOS:C34*:*)
+	echo c34-convex-bsd
+        exit ;;
+    C38*:ConvexOS:*:* | convex:ConvexOS:C38*:*)
+	echo c38-convex-bsd
+        exit ;;
+    C4*:ConvexOS:*:* | convex:ConvexOS:C4*:*)
+	echo c4-convex-bsd
+        exit ;;
+    CRAY*Y-MP:*:*:*)
+	echo ymp-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/'
+	exit ;;
+    CRAY*[A-Z]90:*:*:*)
+	echo ${UNAME_MACHINE}-cray-unicos${UNAME_RELEASE} \
+	| sed -e 's/CRAY.*\([A-Z]90\)/\1/' \
+	      -e y/ABCDEFGHIJKLMNOPQRSTUVWXYZ/abcdefghijklmnopqrstuvwxyz/ \
+	      -e 's/\.[^.]*$/.X/'
+	exit ;;
+    CRAY*TS:*:*:*)
+	echo t90-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/'
+	exit ;;
+    CRAY*T3E:*:*:*)
+	echo alphaev5-cray-unicosmk${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/'
+	exit ;;
+    CRAY*SV1:*:*:*)
+	echo sv1-cray-unicos${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/'
+	exit ;;
+    *:UNICOS/mp:*:*)
+	echo craynv-cray-unicosmp${UNAME_RELEASE} | sed -e 's/\.[^.]*$/.X/'
+	exit ;;
+    F30[01]:UNIX_System_V:*:* | F700:UNIX_System_V:*:*)
+	FUJITSU_PROC=`uname -m | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz'`
+        FUJITSU_SYS=`uname -p | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz' | sed -e 's/\///'`
+        FUJITSU_REL=`echo ${UNAME_RELEASE} | sed -e 's/ /_/'`
+        echo "${FUJITSU_PROC}-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}"
+        exit ;;
+    5000:UNIX_System_V:4.*:*)
+        FUJITSU_SYS=`uname -p | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz' | sed -e 's/\///'`
+        FUJITSU_REL=`echo ${UNAME_RELEASE} | tr 'ABCDEFGHIJKLMNOPQRSTUVWXYZ' 'abcdefghijklmnopqrstuvwxyz' | sed -e 's/ /_/'`
+        echo "sparc-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}"
+	exit ;;
+    i*86:BSD/386:*:* | i*86:BSD/OS:*:* | *:Ascend\ Embedded/OS:*:*)
+	echo ${UNAME_MACHINE}-pc-bsdi${UNAME_RELEASE}
+	exit ;;
+    sparc*:BSD/OS:*:*)
+	echo sparc-unknown-bsdi${UNAME_RELEASE}
+	exit ;;
+    *:BSD/OS:*:*)
+	echo ${UNAME_MACHINE}-unknown-bsdi${UNAME_RELEASE}
+	exit ;;
+    *:FreeBSD:*:*)
+	echo ${UNAME_MACHINE}-unknown-freebsd`echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'`
+	exit ;;
+    i*:CYGWIN*:*)
+	echo ${UNAME_MACHINE}-pc-cygwin
+	exit ;;
+    i*:MINGW*:*)
+	echo ${UNAME_MACHINE}-pc-mingw32
+	exit ;;
+    i*:windows32*:*)
+    	# uname -m includes "-pc" on this system.
+    	echo ${UNAME_MACHINE}-mingw32
+	exit ;;
+    i*:PW*:*)
+	echo ${UNAME_MACHINE}-pc-pw32
+	exit ;;
+    x86:Interix*:[34]*)
+	echo i586-pc-interix${UNAME_RELEASE}|sed -e 's/\..*//'
+	exit ;;
+    [345]86:Windows_95:* | [345]86:Windows_98:* | [345]86:Windows_NT:*)
+	echo i${UNAME_MACHINE}-pc-mks
+	exit ;;
+    i*:Windows_NT*:* | Pentium*:Windows_NT*:*)
+	# How do we know it's Interix rather than the generic POSIX subsystem?
+	# It also conflicts with pre-2.0 versions of AT&T UWIN. Should we
+	# UNAME_MACHINE based on the output of uname instead of i386?
+	echo i586-pc-interix
+	exit ;;
+    i*:UWIN*:*)
+	echo ${UNAME_MACHINE}-pc-uwin
+	exit ;;
+    amd64:CYGWIN*:*:*)
+	echo x86_64-unknown-cygwin
+	exit ;;
+    p*:CYGWIN*:*)
+	echo powerpcle-unknown-cygwin
+	exit ;;
+    prep*:SunOS:5.*:*)
+	echo powerpcle-unknown-solaris2`echo ${UNAME_RELEASE}|sed -e 's/[^.]*//'`
+	exit ;;
+    *:GNU:*:*)
+	# the GNU system
+	echo `echo ${UNAME_MACHINE}|sed -e 's,[-/].*$,,'`-unknown-gnu`echo ${UNAME_RELEASE}|sed -e 's,/.*$,,'`
+	exit ;;
+    *:GNU/*:*:*)
+	# other systems with GNU libc and userland
+	echo ${UNAME_MACHINE}-unknown-`echo ${UNAME_SYSTEM} | sed 's,^[^/]*/,,' | tr '[A-Z]' '[a-z]'``echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'`-gnu
+	exit ;;
+    i*86:Minix:*:*)
+	echo ${UNAME_MACHINE}-pc-minix
+	exit ;;
+    arm*:Linux:*:*)
+	echo ${UNAME_MACHINE}-unknown-linux-gnu
+	exit ;;
+    cris:Linux:*:*)
+	echo cris-axis-linux-gnu
+	exit ;;
+    crisv32:Linux:*:*)
+	echo crisv32-axis-linux-gnu
+	exit ;;
+    frv:Linux:*:*)
+    	echo frv-unknown-linux-gnu
+	exit ;;
+    ia64:Linux:*:*)
+	echo ${UNAME_MACHINE}-unknown-linux-gnu
+	exit ;;
+    m32r*:Linux:*:*)
+	echo ${UNAME_MACHINE}-unknown-linux-gnu
+	exit ;;
+    m68*:Linux:*:*)
+	echo ${UNAME_MACHINE}-unknown-linux-gnu
+	exit ;;
+    mips:Linux:*:*)
+	eval $set_cc_for_build
+	sed 's/^	//' << EOF >$dummy.c
+	#undef CPU
+	#undef mips
+	#undef mipsel
+	#if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL)
+	CPU=mipsel
+	#else
+	#if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB)
+	CPU=mips
+	#else
+	CPU=
+	#endif
+	#endif
+EOF
+	eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep ^CPU=`
+	test x"${CPU}" != x && { echo "${CPU}-unknown-linux-gnu"; exit; }
+	;;
+    mips64:Linux:*:*)
+	eval $set_cc_for_build
+	sed 's/^	//' << EOF >$dummy.c
+	#undef CPU
+	#undef mips64
+	#undef mips64el
+	#if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL)
+	CPU=mips64el
+	#else
+	#if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB)
+	CPU=mips64
+	#else
+	CPU=
+	#endif
+	#endif
+EOF
+	eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep ^CPU=`
+	test x"${CPU}" != x && { echo "${CPU}-unknown-linux-gnu"; exit; }
+	;;
+    ppc:Linux:*:*)
+	echo powerpc-unknown-linux-gnu
+	exit ;;
+    ppc64:Linux:*:*)
+	echo powerpc64-unknown-linux-gnu
+	exit ;;
+    alpha:Linux:*:*)
+	case `sed -n '/^cpu model/s/^.*: \(.*\)/\1/p' < /proc/cpuinfo` in
+	  EV5)   UNAME_MACHINE=alphaev5 ;;
+	  EV56)  UNAME_MACHINE=alphaev56 ;;
+	  PCA56) UNAME_MACHINE=alphapca56 ;;
+	  PCA57) UNAME_MACHINE=alphapca56 ;;
+	  EV6)   UNAME_MACHINE=alphaev6 ;;
+	  EV67)  UNAME_MACHINE=alphaev67 ;;
+	  EV68*) UNAME_MACHINE=alphaev68 ;;
+        esac
+	objdump --private-headers /bin/sh | grep ld.so.1 >/dev/null
+	if test "$?" = 0 ; then LIBC="libc1" ; else LIBC="" ; fi
+	echo ${UNAME_MACHINE}-unknown-linux-gnu${LIBC}
+	exit ;;
+    parisc:Linux:*:* | hppa:Linux:*:*)
+	# Look for CPU level
+	case `grep '^cpu[^a-z]*:' /proc/cpuinfo 2>/dev/null | cut -d' ' -f2` in
+	  PA7*) echo hppa1.1-unknown-linux-gnu ;;
+	  PA8*) echo hppa2.0-unknown-linux-gnu ;;
+	  *)    echo hppa-unknown-linux-gnu ;;
+	esac
+	exit ;;
+    parisc64:Linux:*:* | hppa64:Linux:*:*)
+	echo hppa64-unknown-linux-gnu
+	exit ;;
+    s390:Linux:*:* | s390x:Linux:*:*)
+	echo ${UNAME_MACHINE}-ibm-linux
+	exit ;;
+    sh64*:Linux:*:*)
+    	echo ${UNAME_MACHINE}-unknown-linux-gnu
+	exit ;;
+    sh*:Linux:*:*)
+	echo ${UNAME_MACHINE}-unknown-linux-gnu
+	exit ;;
+    sparc:Linux:*:* | sparc64:Linux:*:*)
+	echo ${UNAME_MACHINE}-unknown-linux-gnu
+	exit ;;
+    x86_64:Linux:*:*)
+	echo x86_64-unknown-linux-gnu
+	exit ;;
+    i*86:Linux:*:*)
+	# The BFD linker knows what the default object file format is, so
+	# first see if it will tell us. cd to the root directory to prevent
+	# problems with other programs or directories called `ld' in the path.
+	# Set LC_ALL=C to ensure ld outputs messages in English.
+	ld_supported_targets=`cd /; LC_ALL=C ld --help 2>&1 \
+			 | sed -ne '/supported targets:/!d
+				    s/[ 	][ 	]*/ /g
+				    s/.*supported targets: *//
+				    s/ .*//
+				    p'`
+        case "$ld_supported_targets" in
+	  elf32-i386)
+		TENTATIVE="${UNAME_MACHINE}-pc-linux-gnu"
+		;;
+	  a.out-i386-linux)
+		echo "${UNAME_MACHINE}-pc-linux-gnuaout"
+		exit ;;
+	  coff-i386)
+		echo "${UNAME_MACHINE}-pc-linux-gnucoff"
+		exit ;;
+	  "")
+		# Either a pre-BFD a.out linker (linux-gnuoldld) or
+		# one that does not give us useful --help.
+		echo "${UNAME_MACHINE}-pc-linux-gnuoldld"
+		exit ;;
+	esac
+	# Determine whether the default compiler is a.out or elf
+	eval $set_cc_for_build
+	sed 's/^	//' << EOF >$dummy.c
+	#include <features.h>
+	#ifdef __ELF__
+	# ifdef __GLIBC__
+	#  if __GLIBC__ >= 2
+	LIBC=gnu
+	#  else
+	LIBC=gnulibc1
+	#  endif
+	# else
+	LIBC=gnulibc1
+	# endif
+	#else
+	#ifdef __INTEL_COMPILER
+	LIBC=gnu
+	#else
+	LIBC=gnuaout
+	#endif
+	#endif
+	#ifdef __dietlibc__
+	LIBC=dietlibc
+	#endif
+EOF
+	eval `$CC_FOR_BUILD -E $dummy.c 2>/dev/null | grep ^LIBC=`
+	test x"${LIBC}" != x && {
+		echo "${UNAME_MACHINE}-pc-linux-${LIBC}"
+		exit
+	}
+	test x"${TENTATIVE}" != x && { echo "${TENTATIVE}"; exit; }
+	;;
+    i*86:DYNIX/ptx:4*:*)
+	# ptx 4.0 does uname -s correctly, with DYNIX/ptx in there.
+	# earlier versions are messed up and put the nodename in both
+	# sysname and nodename.
+	echo i386-sequent-sysv4
+	exit ;;
+    i*86:UNIX_SV:4.2MP:2.*)
+        # Unixware is an offshoot of SVR4, but it has its own version
+        # number series starting with 2...
+        # I am not positive that other SVR4 systems won't match this,
+	# I just have to hope.  -- rms.
+        # Use sysv4.2uw... so that sysv4* matches it.
+	echo ${UNAME_MACHINE}-pc-sysv4.2uw${UNAME_VERSION}
+	exit ;;
+    i*86:OS/2:*:*)
+	# If we were able to find `uname', then EMX Unix compatibility
+	# is probably installed.
+	echo ${UNAME_MACHINE}-pc-os2-emx
+	exit ;;
+    i*86:XTS-300:*:STOP)
+	echo ${UNAME_MACHINE}-unknown-stop
+	exit ;;
+    i*86:atheos:*:*)
+	echo ${UNAME_MACHINE}-unknown-atheos
+	exit ;;
+    i*86:syllable:*:*)
+	echo ${UNAME_MACHINE}-pc-syllable
+	exit ;;
+    i*86:LynxOS:2.*:* | i*86:LynxOS:3.[01]*:* | i*86:LynxOS:4.0*:*)
+	echo i386-unknown-lynxos${UNAME_RELEASE}
+	exit ;;
+    i*86:*DOS:*:*)
+	echo ${UNAME_MACHINE}-pc-msdosdjgpp
+	exit ;;
+    i*86:*:4.*:* | i*86:SYSTEM_V:4.*:*)
+	UNAME_REL=`echo ${UNAME_RELEASE} | sed 's/\/MP$//'`
+	if grep Novell /usr/include/link.h >/dev/null 2>/dev/null; then
+		echo ${UNAME_MACHINE}-univel-sysv${UNAME_REL}
+	else
+		echo ${UNAME_MACHINE}-pc-sysv${UNAME_REL}
+	fi
+	exit ;;
+    i*86:*:5:[678]*)
+    	# UnixWare 7.x, OpenUNIX and OpenServer 6.
+	case `/bin/uname -X | grep "^Machine"` in
+	    *486*)	     UNAME_MACHINE=i486 ;;
+	    *Pentium)	     UNAME_MACHINE=i586 ;;
+	    *Pent*|*Celeron) UNAME_MACHINE=i686 ;;
+	esac
+	echo ${UNAME_MACHINE}-unknown-sysv${UNAME_RELEASE}${UNAME_SYSTEM}${UNAME_VERSION}
+	exit ;;
+    i*86:*:3.2:*)
+	if test -f /usr/options/cb.name; then
+		UNAME_REL=`sed -n 's/.*Version //p' </usr/options/cb.name`
+		echo ${UNAME_MACHINE}-pc-isc$UNAME_REL
+	elif /bin/uname -X 2>/dev/null >/dev/null ; then
+		UNAME_REL=`(/bin/uname -X|grep Release|sed -e 's/.*= //')`
+		(/bin/uname -X|grep i80486 >/dev/null) && UNAME_MACHINE=i486
+		(/bin/uname -X|grep '^Machine.*Pentium' >/dev/null) \
+			&& UNAME_MACHINE=i586
+		(/bin/uname -X|grep '^Machine.*Pent *II' >/dev/null) \
+			&& UNAME_MACHINE=i686
+		(/bin/uname -X|grep '^Machine.*Pentium Pro' >/dev/null) \
+			&& UNAME_MACHINE=i686
+		echo ${UNAME_MACHINE}-pc-sco$UNAME_REL
+	else
+		echo ${UNAME_MACHINE}-pc-sysv32
+	fi
+	exit ;;
+    pc:*:*:*)
+	# Left here for compatibility:
+        # uname -m prints for DJGPP always 'pc', but it prints nothing about
+        # the processor, so we play safe by assuming i386.
+	echo i386-pc-msdosdjgpp
+        exit ;;
+    Intel:Mach:3*:*)
+	echo i386-pc-mach3
+	exit ;;
+    paragon:*:*:*)
+	echo i860-intel-osf1
+	exit ;;
+    i860:*:4.*:*) # i860-SVR4
+	if grep Stardent /usr/include/sys/uadmin.h >/dev/null 2>&1 ; then
+	  echo i860-stardent-sysv${UNAME_RELEASE} # Stardent Vistra i860-SVR4
+	else # Add other i860-SVR4 vendors below as they are discovered.
+	  echo i860-unknown-sysv${UNAME_RELEASE}  # Unknown i860-SVR4
+	fi
+	exit ;;
+    mini*:CTIX:SYS*5:*)
+	# "miniframe"
+	echo m68010-convergent-sysv
+	exit ;;
+    mc68k:UNIX:SYSTEM5:3.51m)
+	echo m68k-convergent-sysv
+	exit ;;
+    M680?0:D-NIX:5.3:*)
+	echo m68k-diab-dnix
+	exit ;;
+    M68*:*:R3V[5678]*:*)
+	test -r /sysV68 && { echo 'm68k-motorola-sysv'; exit; } ;;
+    3[345]??:*:4.0:3.0 | 3[34]??A:*:4.0:3.0 | 3[34]??,*:*:4.0:3.0 | 3[34]??/*:*:4.0:3.0 | 4400:*:4.0:3.0 | 4850:*:4.0:3.0 | SKA40:*:4.0:3.0 | SDS2:*:4.0:3.0 | SHG2:*:4.0:3.0 | S7501*:*:4.0:3.0)
+	OS_REL=''
+	test -r /etc/.relid \
+	&& OS_REL=.`sed -n 's/[^ ]* [^ ]* \([0-9][0-9]\).*/\1/p' < /etc/.relid`
+	/bin/uname -p 2>/dev/null | grep 86 >/dev/null \
+	  && { echo i486-ncr-sysv4.3${OS_REL}; exit; }
+	/bin/uname -p 2>/dev/null | /bin/grep entium >/dev/null \
+	  && { echo i586-ncr-sysv4.3${OS_REL}; exit; } ;;
+    3[34]??:*:4.0:* | 3[34]??,*:*:4.0:*)
+        /bin/uname -p 2>/dev/null | grep 86 >/dev/null \
+          && { echo i486-ncr-sysv4; exit; } ;;
+    m68*:LynxOS:2.*:* | m68*:LynxOS:3.0*:*)
+	echo m68k-unknown-lynxos${UNAME_RELEASE}
+	exit ;;
+    mc68030:UNIX_System_V:4.*:*)
+	echo m68k-atari-sysv4
+	exit ;;
+    TSUNAMI:LynxOS:2.*:*)
+	echo sparc-unknown-lynxos${UNAME_RELEASE}
+	exit ;;
+    rs6000:LynxOS:2.*:*)
+	echo rs6000-unknown-lynxos${UNAME_RELEASE}
+	exit ;;
+    PowerPC:LynxOS:2.*:* | PowerPC:LynxOS:3.[01]*:* | PowerPC:LynxOS:4.0*:*)
+	echo powerpc-unknown-lynxos${UNAME_RELEASE}
+	exit ;;
+    SM[BE]S:UNIX_SV:*:*)
+	echo mips-dde-sysv${UNAME_RELEASE}
+	exit ;;
+    RM*:ReliantUNIX-*:*:*)
+	echo mips-sni-sysv4
+	exit ;;
+    RM*:SINIX-*:*:*)
+	echo mips-sni-sysv4
+	exit ;;
+    *:SINIX-*:*:*)
+	if uname -p 2>/dev/null >/dev/null ; then
+		UNAME_MACHINE=`(uname -p) 2>/dev/null`
+		echo ${UNAME_MACHINE}-sni-sysv4
+	else
+		echo ns32k-sni-sysv
+	fi
+	exit ;;
+    PENTIUM:*:4.0*:*) # Unisys `ClearPath HMP IX 4000' SVR4/MP effort
+                      # says <Richard.M.Bartel at ccMail.Census.GOV>
+        echo i586-unisys-sysv4
+        exit ;;
+    *:UNIX_System_V:4*:FTX*)
+	# From Gerald Hewes <hewes at openmarket.com>.
+	# How about differentiating between stratus architectures? -djm
+	echo hppa1.1-stratus-sysv4
+	exit ;;
+    *:*:*:FTX*)
+	# From seanf at swdc.stratus.com.
+	echo i860-stratus-sysv4
+	exit ;;
+    i*86:VOS:*:*)
+	# From Paul.Green at stratus.com.
+	echo ${UNAME_MACHINE}-stratus-vos
+	exit ;;
+    *:VOS:*:*)
+	# From Paul.Green at stratus.com.
+	echo hppa1.1-stratus-vos
+	exit ;;
+    mc68*:A/UX:*:*)
+	echo m68k-apple-aux${UNAME_RELEASE}
+	exit ;;
+    news*:NEWS-OS:6*:*)
+	echo mips-sony-newsos6
+	exit ;;
+    R[34]000:*System_V*:*:* | R4000:UNIX_SYSV:*:* | R*000:UNIX_SV:*:*)
+	if [ -d /usr/nec ]; then
+	        echo mips-nec-sysv${UNAME_RELEASE}
+	else
+	        echo mips-unknown-sysv${UNAME_RELEASE}
+	fi
+        exit ;;
+    BeBox:BeOS:*:*)	# BeOS running on hardware made by Be, PPC only.
+	echo powerpc-be-beos
+	exit ;;
+    BeMac:BeOS:*:*)	# BeOS running on Mac or Mac clone, PPC only.
+	echo powerpc-apple-beos
+	exit ;;
+    BePC:BeOS:*:*)	# BeOS running on Intel PC compatible.
+	echo i586-pc-beos
+	exit ;;
+    SX-4:SUPER-UX:*:*)
+	echo sx4-nec-superux${UNAME_RELEASE}
+	exit ;;
+    SX-5:SUPER-UX:*:*)
+	echo sx5-nec-superux${UNAME_RELEASE}
+	exit ;;
+    SX-6:SUPER-UX:*:*)
+	echo sx6-nec-superux${UNAME_RELEASE}
+	exit ;;
+    Power*:Rhapsody:*:*)
+	echo powerpc-apple-rhapsody${UNAME_RELEASE}
+	exit ;;
+    *:Rhapsody:*:*)
+	echo ${UNAME_MACHINE}-apple-rhapsody${UNAME_RELEASE}
+	exit ;;
+    *:Darwin:*:*)
+	UNAME_PROCESSOR=`uname -p` || UNAME_PROCESSOR=unknown
+	case $UNAME_PROCESSOR in
+	    *86) UNAME_PROCESSOR=i686 ;;
+	    unknown) UNAME_PROCESSOR=powerpc ;;
+	esac
+	echo ${UNAME_PROCESSOR}-apple-darwin${UNAME_RELEASE}
+	exit ;;
+    *:procnto*:*:* | *:QNX:[0123456789]*:*)
+	UNAME_PROCESSOR=`uname -p`
+	if test "$UNAME_PROCESSOR" = "x86"; then
+		UNAME_PROCESSOR=i386
+		UNAME_MACHINE=pc
+	fi
+	echo ${UNAME_PROCESSOR}-${UNAME_MACHINE}-nto-qnx${UNAME_RELEASE}
+	exit ;;
+    *:QNX:*:4*)
+	echo i386-pc-qnx
+	exit ;;
+    NSE-?:NONSTOP_KERNEL:*:*)
+	echo nse-tandem-nsk${UNAME_RELEASE}
+	exit ;;
+    NSR-?:NONSTOP_KERNEL:*:*)
+	echo nsr-tandem-nsk${UNAME_RELEASE}
+	exit ;;
+    *:NonStop-UX:*:*)
+	echo mips-compaq-nonstopux
+	exit ;;
+    BS2000:POSIX*:*:*)
+	echo bs2000-siemens-sysv
+	exit ;;
+    DS/*:UNIX_System_V:*:*)
+	echo ${UNAME_MACHINE}-${UNAME_SYSTEM}-${UNAME_RELEASE}
+	exit ;;
+    *:Plan9:*:*)
+	# "uname -m" is not consistent, so use $cputype instead. 386
+	# is converted to i386 for consistency with other x86
+	# operating systems.
+	if test "$cputype" = "386"; then
+	    UNAME_MACHINE=i386
+	else
+	    UNAME_MACHINE="$cputype"
+	fi
+	echo ${UNAME_MACHINE}-unknown-plan9
+	exit ;;
+    *:TOPS-10:*:*)
+	echo pdp10-unknown-tops10
+	exit ;;
+    *:TENEX:*:*)
+	echo pdp10-unknown-tenex
+	exit ;;
+    KS10:TOPS-20:*:* | KL10:TOPS-20:*:* | TYPE4:TOPS-20:*:*)
+	echo pdp10-dec-tops20
+	exit ;;
+    XKL-1:TOPS-20:*:* | TYPE5:TOPS-20:*:*)
+	echo pdp10-xkl-tops20
+	exit ;;
+    *:TOPS-20:*:*)
+	echo pdp10-unknown-tops20
+	exit ;;
+    *:ITS:*:*)
+	echo pdp10-unknown-its
+	exit ;;
+    SEI:*:*:SEIUX)
+        echo mips-sei-seiux${UNAME_RELEASE}
+	exit ;;
+    *:DragonFly:*:*)
+	echo ${UNAME_MACHINE}-unknown-dragonfly`echo ${UNAME_RELEASE}|sed -e 's/[-(].*//'`
+	exit ;;
+    *:*VMS:*:*)
+    	UNAME_MACHINE=`(uname -p) 2>/dev/null`
+	case "${UNAME_MACHINE}" in
+	    A*) echo alpha-dec-vms ; exit ;;
+	    I*) echo ia64-dec-vms ; exit ;;
+	    V*) echo vax-dec-vms ; exit ;;
+	esac ;;
+    *:XENIX:*:SysV)
+	echo i386-pc-xenix
+	exit ;;
+    i*86:skyos:*:*)
+	echo ${UNAME_MACHINE}-pc-skyos`echo ${UNAME_RELEASE}` | sed -e 's/ .*$//'
+	exit ;;
+esac
+
+#echo '(No uname command or uname output not recognized.)' 1>&2
+#echo "${UNAME_MACHINE}:${UNAME_SYSTEM}:${UNAME_RELEASE}:${UNAME_VERSION}" 1>&2
+
+eval $set_cc_for_build
+cat >$dummy.c <<EOF
+#ifdef _SEQUENT_
+# include <sys/types.h>
+# include <sys/utsname.h>
+#endif
+main ()
+{
+#if defined (sony)
+#if defined (MIPSEB)
+  /* BFD wants "bsd" instead of "newsos".  Perhaps BFD should be changed,
+     I don't know....  */
+  printf ("mips-sony-bsd\n"); exit (0);
+#else
+#include <sys/param.h>
+  printf ("m68k-sony-newsos%s\n",
+#ifdef NEWSOS4
+          "4"
+#else
+	  ""
+#endif
+         ); exit (0);
+#endif
+#endif
+
+#if defined (__arm) && defined (__acorn) && defined (__unix)
+  printf ("arm-acorn-riscix\n"); exit (0);
+#endif
+
+#if defined (hp300) && !defined (hpux)
+  printf ("m68k-hp-bsd\n"); exit (0);
+#endif
+
+#if defined (NeXT)
+#if !defined (__ARCHITECTURE__)
+#define __ARCHITECTURE__ "m68k"
+#endif
+  int version;
+  version=`(hostinfo | sed -n 's/.*NeXT Mach \([0-9]*\).*/\1/p') 2>/dev/null`;
+  if (version < 4)
+    printf ("%s-next-nextstep%d\n", __ARCHITECTURE__, version);
+  else
+    printf ("%s-next-openstep%d\n", __ARCHITECTURE__, version);
+  exit (0);
+#endif
+
+#if defined (MULTIMAX) || defined (n16)
+#if defined (UMAXV)
+  printf ("ns32k-encore-sysv\n"); exit (0);
+#else
+#if defined (CMU)
+  printf ("ns32k-encore-mach\n"); exit (0);
+#else
+  printf ("ns32k-encore-bsd\n"); exit (0);
+#endif
+#endif
+#endif
+
+#if defined (__386BSD__)
+  printf ("i386-pc-bsd\n"); exit (0);
+#endif
+
+#if defined (sequent)
+#if defined (i386)
+  printf ("i386-sequent-dynix\n"); exit (0);
+#endif
+#if defined (ns32000)
+  printf ("ns32k-sequent-dynix\n"); exit (0);
+#endif
+#endif
+
+#if defined (_SEQUENT_)
+    struct utsname un;
+
+    uname(&un);
+
+    if (strncmp(un.version, "V2", 2) == 0) {
+	printf ("i386-sequent-ptx2\n"); exit (0);
+    }
+    if (strncmp(un.version, "V1", 2) == 0) { /* XXX is V1 correct? */
+	printf ("i386-sequent-ptx1\n"); exit (0);
+    }
+    printf ("i386-sequent-ptx\n"); exit (0);
+
+#endif
+
+#if defined (vax)
+# if !defined (ultrix)
+#  include <sys/param.h>
+#  if defined (BSD)
+#   if BSD == 43
+      printf ("vax-dec-bsd4.3\n"); exit (0);
+#   else
+#    if BSD == 199006
+      printf ("vax-dec-bsd4.3reno\n"); exit (0);
+#    else
+      printf ("vax-dec-bsd\n"); exit (0);
+#    endif
+#   endif
+#  else
+    printf ("vax-dec-bsd\n"); exit (0);
+#  endif
+# else
+    printf ("vax-dec-ultrix\n"); exit (0);
+# endif
+#endif
+
+#if defined (alliant) && defined (i860)
+  printf ("i860-alliant-bsd\n"); exit (0);
+#endif
+
+  exit (1);
+}
+EOF
+
+$CC_FOR_BUILD -o $dummy $dummy.c 2>/dev/null && SYSTEM_NAME=`$dummy` &&
+	{ echo "$SYSTEM_NAME"; exit; }
+
+# Apollos put the system type in the environment.
+
+test -d /usr/apollo && { echo ${ISP}-apollo-${SYSTYPE}; exit; }
+
+# Convex versions that predate uname can use getsysinfo(1)
+
+if [ -x /usr/convex/getsysinfo ]
+then
+    case `getsysinfo -f cpu_type` in
+    c1*)
+	echo c1-convex-bsd
+	exit ;;
+    c2*)
+	if getsysinfo -f scalar_acc
+	then echo c32-convex-bsd
+	else echo c2-convex-bsd
+	fi
+	exit ;;
+    c34*)
+	echo c34-convex-bsd
+	exit ;;
+    c38*)
+	echo c38-convex-bsd
+	exit ;;
+    c4*)
+	echo c4-convex-bsd
+	exit ;;
+    esac
+fi
+
+cat >&2 <<EOF
+$0: unable to guess system type
+
+This script, last modified $timestamp, has failed to recognize
+the operating system you are using. It is advised that you
+download the most up to date version of the config scripts from
+
+  http://savannah.gnu.org/cgi-bin/viewcvs/*checkout*/config/config/config.guess
+and
+  http://savannah.gnu.org/cgi-bin/viewcvs/*checkout*/config/config/config.sub
+
+If the version you run ($0) is already up to date, please
+send the following data and any information you think might be
+pertinent to <config-patches at gnu.org> in order to provide the needed
+information to handle your system.
+
+config.guess timestamp = $timestamp
+
+uname -m = `(uname -m) 2>/dev/null || echo unknown`
+uname -r = `(uname -r) 2>/dev/null || echo unknown`
+uname -s = `(uname -s) 2>/dev/null || echo unknown`
+uname -v = `(uname -v) 2>/dev/null || echo unknown`
+
+/usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null`
+/bin/uname -X     = `(/bin/uname -X) 2>/dev/null`
+
+hostinfo               = `(hostinfo) 2>/dev/null`
+/bin/universe          = `(/bin/universe) 2>/dev/null`
+/usr/bin/arch -k       = `(/usr/bin/arch -k) 2>/dev/null`
+/bin/arch              = `(/bin/arch) 2>/dev/null`
+/usr/bin/oslevel       = `(/usr/bin/oslevel) 2>/dev/null`
+/usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null`
+
+UNAME_MACHINE = ${UNAME_MACHINE}
+UNAME_RELEASE = ${UNAME_RELEASE}
+UNAME_SYSTEM  = ${UNAME_SYSTEM}
+UNAME_VERSION = ${UNAME_VERSION}
+EOF
+
+exit 1
+
+# Local variables:
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "timestamp='"
+# time-stamp-format: "%:y-%02m-%02d"
+# time-stamp-end: "'"
+# End:
diff --git a/config.sub b/config.sub
new file mode 100755
index 0000000..1c366df
--- /dev/null
+++ b/config.sub
@@ -0,0 +1,1579 @@
+#! /bin/sh
+# Configuration validation subroutine script.
+#   Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999,
+#   2000, 2001, 2002, 2003, 2004, 2005 Free Software Foundation, Inc.
+
+timestamp='2005-07-08'
+
+# This file is (in principle) common to ALL GNU software.
+# The presence of a machine in this file suggests that SOME GNU software
+# can handle that machine.  It does not imply ALL GNU software can.
+#
+# This file is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2 of the License, or
+# (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+#
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA
+# 02110-1301, USA.
+#
+# As a special exception to the GNU General Public License, if you
+# distribute this file as part of a program that contains a
+# configuration script generated by Autoconf, you may include it under
+# the same distribution terms that you use for the rest of that program.
+
+
+# Please send patches to <config-patches at gnu.org>.  Submit a context
+# diff and a properly formatted ChangeLog entry.
+#
+# Configuration subroutine to validate and canonicalize a configuration type.
+# Supply the specified configuration type as an argument.
+# If it is invalid, we print an error message on stderr and exit with code 1.
+# Otherwise, we print the canonical config type on stdout and succeed.
+
+# This file is supposed to be the same for all GNU packages
+# and recognize all the CPU types, system types and aliases
+# that are meaningful with *any* GNU software.
+# Each package is responsible for reporting which valid configurations
+# it does not support.  The user should be able to distinguish
+# a failure to support a valid configuration from a meaningless
+# configuration.
+
+# The goal of this file is to map all the various variations of a given
+# machine specification into a single specification in the form:
+#	CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM
+# or in some cases, the newer four-part form:
+#	CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM
+# It is wrong to echo any other type of specification.
+
+me=`echo "$0" | sed -e 's,.*/,,'`
+
+usage="\
+Usage: $0 [OPTION] CPU-MFR-OPSYS
+       $0 [OPTION] ALIAS
+
+Canonicalize a configuration name.
+
+Operation modes:
+  -h, --help         print this help, then exit
+  -t, --time-stamp   print date of last modification, then exit
+  -v, --version      print version number, then exit
+
+Report bugs and patches to <config-patches at gnu.org>."
+
+version="\
+GNU config.sub ($timestamp)
+
+Copyright (C) 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005
+Free Software Foundation, Inc.
+
+This is free software; see the source for copying conditions.  There is NO
+warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE."
+
+help="
+Try \`$me --help' for more information."
+
+# Parse command line
+while test $# -gt 0 ; do
+  case $1 in
+    --time-stamp | --time* | -t )
+       echo "$timestamp" ; exit ;;
+    --version | -v )
+       echo "$version" ; exit ;;
+    --help | --h* | -h )
+       echo "$usage"; exit ;;
+    -- )     # Stop option processing
+       shift; break ;;
+    - )	# Use stdin as input.
+       break ;;
+    -* )
+       echo "$me: invalid option $1$help"
+       exit 1 ;;
+
+    *local*)
+       # First pass through any local machine types.
+       echo $1
+       exit ;;
+
+    * )
+       break ;;
+  esac
+done
+
+case $# in
+ 0) echo "$me: missing argument$help" >&2
+    exit 1;;
+ 1) ;;
+ *) echo "$me: too many arguments$help" >&2
+    exit 1;;
+esac
+
+# Separate what the user gave into CPU-COMPANY and OS or KERNEL-OS (if any).
+# Here we must recognize all the valid KERNEL-OS combinations.
+maybe_os=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\2/'`
+case $maybe_os in
+  nto-qnx* | linux-gnu* | linux-dietlibc | linux-uclibc* | uclinux-uclibc* | uclinux-gnu* | \
+  kfreebsd*-gnu* | knetbsd*-gnu* | netbsd*-gnu* | storm-chaos* | os2-emx* | rtmk-nova*)
+    os=-$maybe_os
+    basic_machine=`echo $1 | sed 's/^\(.*\)-\([^-]*-[^-]*\)$/\1/'`
+    ;;
+  *)
+    basic_machine=`echo $1 | sed 's/-[^-]*$//'`
+    if [ $basic_machine != $1 ]
+    then os=`echo $1 | sed 's/.*-/-/'`
+    else os=; fi
+    ;;
+esac
+
+### Let's recognize common machines as not being operating systems so
+### that things like config.sub decstation-3100 work.  We also
+### recognize some manufacturers as not being operating systems, so we
+### can provide default operating systems below.
+case $os in
+	-sun*os*)
+		# Prevent following clause from handling this invalid input.
+		;;
+	-dec* | -mips* | -sequent* | -encore* | -pc532* | -sgi* | -sony* | \
+	-att* | -7300* | -3300* | -delta* | -motorola* | -sun[234]* | \
+	-unicom* | -ibm* | -next | -hp | -isi* | -apollo | -altos* | \
+	-convergent* | -ncr* | -news | -32* | -3600* | -3100* | -hitachi* |\
+	-c[123]* | -convex* | -sun | -crds | -omron* | -dg | -ultra | -tti* | \
+	-harris | -dolphin | -highlevel | -gould | -cbm | -ns | -masscomp | \
+	-apple | -axis | -knuth | -cray)
+		os=
+		basic_machine=$1
+		;;
+	-sim | -cisco | -oki | -wec | -winbond)
+		os=
+		basic_machine=$1
+		;;
+	-scout)
+		;;
+	-wrs)
+		os=-vxworks
+		basic_machine=$1
+		;;
+	-chorusos*)
+		os=-chorusos
+		basic_machine=$1
+		;;
+ 	-chorusrdb)
+ 		os=-chorusrdb
+		basic_machine=$1
+ 		;;
+	-hiux*)
+		os=-hiuxwe2
+		;;
+	-sco5)
+		os=-sco3.2v5
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-sco4)
+		os=-sco3.2v4
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-sco3.2.[4-9]*)
+		os=`echo $os | sed -e 's/sco3.2./sco3.2v/'`
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-sco3.2v[4-9]*)
+		# Don't forget version if it is 3.2v4 or newer.
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-sco*)
+		os=-sco3.2v2
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-udk*)
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-isc)
+		os=-isc2.2
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-clix*)
+		basic_machine=clipper-intergraph
+		;;
+	-isc*)
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-pc/'`
+		;;
+	-lynx*)
+		os=-lynxos
+		;;
+	-ptx*)
+		basic_machine=`echo $1 | sed -e 's/86-.*/86-sequent/'`
+		;;
+	-windowsnt*)
+		os=`echo $os | sed -e 's/windowsnt/winnt/'`
+		;;
+	-psos*)
+		os=-psos
+		;;
+	-mint | -mint[0-9]*)
+		basic_machine=m68k-atari
+		os=-mint
+		;;
+esac
+
+# Decode aliases for certain CPU-COMPANY combinations.
+case $basic_machine in
+	# Recognize the basic CPU types without company name.
+	# Some are omitted here because they have special meanings below.
+	1750a | 580 \
+	| a29k \
+	| alpha | alphaev[4-8] | alphaev56 | alphaev6[78] | alphapca5[67] \
+	| alpha64 | alpha64ev[4-8] | alpha64ev56 | alpha64ev6[78] | alpha64pca5[67] \
+	| am33_2.0 \
+	| arc | arm | arm[bl]e | arme[lb] | armv[2345] | armv[345][lb] | avr \
+	| bfin \
+	| c4x | clipper \
+	| d10v | d30v | dlx | dsp16xx \
+	| fr30 | frv \
+	| h8300 | h8500 | hppa | hppa1.[01] | hppa2.0 | hppa2.0[nw] | hppa64 \
+	| i370 | i860 | i960 | ia64 \
+	| ip2k | iq2000 \
+	| m32r | m32rle | m68000 | m68k | m88k | maxq | mcore \
+	| mips | mipsbe | mipseb | mipsel | mipsle \
+	| mips16 \
+	| mips64 | mips64el \
+	| mips64vr | mips64vrel \
+	| mips64orion | mips64orionel \
+	| mips64vr4100 | mips64vr4100el \
+	| mips64vr4300 | mips64vr4300el \
+	| mips64vr5000 | mips64vr5000el \
+	| mips64vr5900 | mips64vr5900el \
+	| mipsisa32 | mipsisa32el \
+	| mipsisa32r2 | mipsisa32r2el \
+	| mipsisa64 | mipsisa64el \
+	| mipsisa64r2 | mipsisa64r2el \
+	| mipsisa64sb1 | mipsisa64sb1el \
+	| mipsisa64sr71k | mipsisa64sr71kel \
+	| mipstx39 | mipstx39el \
+	| mn10200 | mn10300 \
+	| ms1 \
+	| msp430 \
+	| ns16k | ns32k \
+	| or32 \
+	| pdp10 | pdp11 | pj | pjl \
+	| powerpc | powerpc64 | powerpc64le | powerpcle | ppcbe \
+	| pyramid \
+	| sh | sh[1234] | sh[24]a | sh[23]e | sh[34]eb | shbe | shle | sh[1234]le | sh3ele \
+	| sh64 | sh64le \
+	| sparc | sparc64 | sparc64b | sparc86x | sparclet | sparclite \
+	| sparcv8 | sparcv9 | sparcv9b \
+	| strongarm \
+	| tahoe | thumb | tic4x | tic80 | tron \
+	| v850 | v850e \
+	| we32k \
+	| x86 | xscale | xscalee[bl] | xstormy16 | xtensa \
+	| z8k)
+		basic_machine=$basic_machine-unknown
+		;;
+	m32c)
+		basic_machine=$basic_machine-unknown
+		;;
+	m6811 | m68hc11 | m6812 | m68hc12)
+		# Motorola 68HC11/12.
+		basic_machine=$basic_machine-unknown
+		os=-none
+		;;
+	m88110 | m680[12346]0 | m683?2 | m68360 | m5200 | v70 | w65 | z8k)
+		;;
+
+	# We use `pc' rather than `unknown'
+	# because (1) that's what they normally are, and
+	# (2) the word "unknown" tends to confuse beginning users.
+	i*86 | x86_64)
+	  basic_machine=$basic_machine-pc
+	  ;;
+	# Object if more than one company name word.
+	*-*-*)
+		echo Invalid configuration \`$1\': machine \`$basic_machine\' not recognized 1>&2
+		exit 1
+		;;
+	# Recognize the basic CPU types with company name.
+	580-* \
+	| a29k-* \
+	| alpha-* | alphaev[4-8]-* | alphaev56-* | alphaev6[78]-* \
+	| alpha64-* | alpha64ev[4-8]-* | alpha64ev56-* | alpha64ev6[78]-* \
+	| alphapca5[67]-* | alpha64pca5[67]-* | arc-* \
+	| arm-*  | armbe-* | armle-* | armeb-* | armv*-* \
+	| avr-* \
+	| bfin-* | bs2000-* \
+	| c[123]* | c30-* | [cjt]90-* | c4x-* | c54x-* | c55x-* | c6x-* \
+	| clipper-* | craynv-* | cydra-* \
+	| d10v-* | d30v-* | dlx-* \
+	| elxsi-* \
+	| f30[01]-* | f700-* | fr30-* | frv-* | fx80-* \
+	| h8300-* | h8500-* \
+	| hppa-* | hppa1.[01]-* | hppa2.0-* | hppa2.0[nw]-* | hppa64-* \
+	| i*86-* | i860-* | i960-* | ia64-* \
+	| ip2k-* | iq2000-* \
+	| m32r-* | m32rle-* \
+	| m68000-* | m680[012346]0-* | m68360-* | m683?2-* | m68k-* \
+	| m88110-* | m88k-* | maxq-* | mcore-* \
+	| mips-* | mipsbe-* | mipseb-* | mipsel-* | mipsle-* \
+	| mips16-* \
+	| mips64-* | mips64el-* \
+	| mips64vr-* | mips64vrel-* \
+	| mips64orion-* | mips64orionel-* \
+	| mips64vr4100-* | mips64vr4100el-* \
+	| mips64vr4300-* | mips64vr4300el-* \
+	| mips64vr5000-* | mips64vr5000el-* \
+	| mips64vr5900-* | mips64vr5900el-* \
+	| mipsisa32-* | mipsisa32el-* \
+	| mipsisa32r2-* | mipsisa32r2el-* \
+	| mipsisa64-* | mipsisa64el-* \
+	| mipsisa64r2-* | mipsisa64r2el-* \
+	| mipsisa64sb1-* | mipsisa64sb1el-* \
+	| mipsisa64sr71k-* | mipsisa64sr71kel-* \
+	| mipstx39-* | mipstx39el-* \
+	| mmix-* \
+	| ms1-* \
+	| msp430-* \
+	| none-* | np1-* | ns16k-* | ns32k-* \
+	| orion-* \
+	| pdp10-* | pdp11-* | pj-* | pjl-* | pn-* | power-* \
+	| powerpc-* | powerpc64-* | powerpc64le-* | powerpcle-* | ppcbe-* \
+	| pyramid-* \
+	| romp-* | rs6000-* \
+	| sh-* | sh[1234]-* | sh[24]a-* | sh[23]e-* | sh[34]eb-* | shbe-* \
+	| shle-* | sh[1234]le-* | sh3ele-* | sh64-* | sh64le-* \
+	| sparc-* | sparc64-* | sparc64b-* | sparc86x-* | sparclet-* \
+	| sparclite-* \
+	| sparcv8-* | sparcv9-* | sparcv9b-* | strongarm-* | sv1-* | sx?-* \
+	| tahoe-* | thumb-* \
+	| tic30-* | tic4x-* | tic54x-* | tic55x-* | tic6x-* | tic80-* \
+	| tron-* \
+	| v850-* | v850e-* | vax-* \
+	| we32k-* \
+	| x86-* | x86_64-* | xps100-* | xscale-* | xscalee[bl]-* \
+	| xstormy16-* | xtensa-* \
+	| ymp-* \
+	| z8k-*)
+		;;
+	m32c-*)
+		;;
+	# Recognize the various machine names and aliases which stand
+	# for a CPU type and a company and sometimes even an OS.
+	386bsd)
+		basic_machine=i386-unknown
+		os=-bsd
+		;;
+	3b1 | 7300 | 7300-att | att-7300 | pc7300 | safari | unixpc)
+		basic_machine=m68000-att
+		;;
+	3b*)
+		basic_machine=we32k-att
+		;;
+	a29khif)
+		basic_machine=a29k-amd
+		os=-udi
+		;;
+    	abacus)
+		basic_machine=abacus-unknown
+		;;
+	adobe68k)
+		basic_machine=m68010-adobe
+		os=-scout
+		;;
+	alliant | fx80)
+		basic_machine=fx80-alliant
+		;;
+	altos | altos3068)
+		basic_machine=m68k-altos
+		;;
+	am29k)
+		basic_machine=a29k-none
+		os=-bsd
+		;;
+	amd64)
+		basic_machine=x86_64-pc
+		;;
+	amd64-*)
+		basic_machine=x86_64-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	amdahl)
+		basic_machine=580-amdahl
+		os=-sysv
+		;;
+	amiga | amiga-*)
+		basic_machine=m68k-unknown
+		;;
+	amigaos | amigados)
+		basic_machine=m68k-unknown
+		os=-amigaos
+		;;
+	amigaunix | amix)
+		basic_machine=m68k-unknown
+		os=-sysv4
+		;;
+	apollo68)
+		basic_machine=m68k-apollo
+		os=-sysv
+		;;
+	apollo68bsd)
+		basic_machine=m68k-apollo
+		os=-bsd
+		;;
+	aux)
+		basic_machine=m68k-apple
+		os=-aux
+		;;
+	balance)
+		basic_machine=ns32k-sequent
+		os=-dynix
+		;;
+	c90)
+		basic_machine=c90-cray
+		os=-unicos
+		;;
+	convex-c1)
+		basic_machine=c1-convex
+		os=-bsd
+		;;
+	convex-c2)
+		basic_machine=c2-convex
+		os=-bsd
+		;;
+	convex-c32)
+		basic_machine=c32-convex
+		os=-bsd
+		;;
+	convex-c34)
+		basic_machine=c34-convex
+		os=-bsd
+		;;
+	convex-c38)
+		basic_machine=c38-convex
+		os=-bsd
+		;;
+	cray | j90)
+		basic_machine=j90-cray
+		os=-unicos
+		;;
+	craynv)
+		basic_machine=craynv-cray
+		os=-unicosmp
+		;;
+	cr16c)
+		basic_machine=cr16c-unknown
+		os=-elf
+		;;
+	crds | unos)
+		basic_machine=m68k-crds
+		;;
+	crisv32 | crisv32-* | etraxfs*)
+		basic_machine=crisv32-axis
+		;;
+	cris | cris-* | etrax*)
+		basic_machine=cris-axis
+		;;
+	crx)
+		basic_machine=crx-unknown
+		os=-elf
+		;;
+	da30 | da30-*)
+		basic_machine=m68k-da30
+		;;
+	decstation | decstation-3100 | pmax | pmax-* | pmin | dec3100 | decstatn)
+		basic_machine=mips-dec
+		;;
+	decsystem10* | dec10*)
+		basic_machine=pdp10-dec
+		os=-tops10
+		;;
+	decsystem20* | dec20*)
+		basic_machine=pdp10-dec
+		os=-tops20
+		;;
+	delta | 3300 | motorola-3300 | motorola-delta \
+	      | 3300-motorola | delta-motorola)
+		basic_machine=m68k-motorola
+		;;
+	delta88)
+		basic_machine=m88k-motorola
+		os=-sysv3
+		;;
+	djgpp)
+		basic_machine=i586-pc
+		os=-msdosdjgpp
+		;;
+	dpx20 | dpx20-*)
+		basic_machine=rs6000-bull
+		os=-bosx
+		;;
+	dpx2* | dpx2*-bull)
+		basic_machine=m68k-bull
+		os=-sysv3
+		;;
+	ebmon29k)
+		basic_machine=a29k-amd
+		os=-ebmon
+		;;
+	elxsi)
+		basic_machine=elxsi-elxsi
+		os=-bsd
+		;;
+	encore | umax | mmax)
+		basic_machine=ns32k-encore
+		;;
+	es1800 | OSE68k | ose68k | ose | OSE)
+		basic_machine=m68k-ericsson
+		os=-ose
+		;;
+	fx2800)
+		basic_machine=i860-alliant
+		;;
+	genix)
+		basic_machine=ns32k-ns
+		;;
+	gmicro)
+		basic_machine=tron-gmicro
+		os=-sysv
+		;;
+	go32)
+		basic_machine=i386-pc
+		os=-go32
+		;;
+	h3050r* | hiux*)
+		basic_machine=hppa1.1-hitachi
+		os=-hiuxwe2
+		;;
+	h8300hms)
+		basic_machine=h8300-hitachi
+		os=-hms
+		;;
+	h8300xray)
+		basic_machine=h8300-hitachi
+		os=-xray
+		;;
+	h8500hms)
+		basic_machine=h8500-hitachi
+		os=-hms
+		;;
+	harris)
+		basic_machine=m88k-harris
+		os=-sysv3
+		;;
+	hp300-*)
+		basic_machine=m68k-hp
+		;;
+	hp300bsd)
+		basic_machine=m68k-hp
+		os=-bsd
+		;;
+	hp300hpux)
+		basic_machine=m68k-hp
+		os=-hpux
+		;;
+	hp3k9[0-9][0-9] | hp9[0-9][0-9])
+		basic_machine=hppa1.0-hp
+		;;
+	hp9k2[0-9][0-9] | hp9k31[0-9])
+		basic_machine=m68000-hp
+		;;
+	hp9k3[2-9][0-9])
+		basic_machine=m68k-hp
+		;;
+	hp9k6[0-9][0-9] | hp6[0-9][0-9])
+		basic_machine=hppa1.0-hp
+		;;
+	hp9k7[0-79][0-9] | hp7[0-79][0-9])
+		basic_machine=hppa1.1-hp
+		;;
+	hp9k78[0-9] | hp78[0-9])
+		# FIXME: really hppa2.0-hp
+		basic_machine=hppa1.1-hp
+		;;
+	hp9k8[67]1 | hp8[67]1 | hp9k80[24] | hp80[24] | hp9k8[78]9 | hp8[78]9 | hp9k893 | hp893)
+		# FIXME: really hppa2.0-hp
+		basic_machine=hppa1.1-hp
+		;;
+	hp9k8[0-9][13679] | hp8[0-9][13679])
+		basic_machine=hppa1.1-hp
+		;;
+	hp9k8[0-9][0-9] | hp8[0-9][0-9])
+		basic_machine=hppa1.0-hp
+		;;
+	hppa-next)
+		os=-nextstep3
+		;;
+	hppaosf)
+		basic_machine=hppa1.1-hp
+		os=-osf
+		;;
+	hppro)
+		basic_machine=hppa1.1-hp
+		os=-proelf
+		;;
+	i370-ibm* | ibm*)
+		basic_machine=i370-ibm
+		;;
+# I'm not sure what "Sysv32" means.  Should this be sysv3.2?
+	i*86v32)
+		basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'`
+		os=-sysv32
+		;;
+	i*86v4*)
+		basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'`
+		os=-sysv4
+		;;
+	i*86v)
+		basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'`
+		os=-sysv
+		;;
+	i*86sol2)
+		basic_machine=`echo $1 | sed -e 's/86.*/86-pc/'`
+		os=-solaris2
+		;;
+	i386mach)
+		basic_machine=i386-mach
+		os=-mach
+		;;
+	i386-vsta | vsta)
+		basic_machine=i386-unknown
+		os=-vsta
+		;;
+	iris | iris4d)
+		basic_machine=mips-sgi
+		case $os in
+		    -irix*)
+			;;
+		    *)
+			os=-irix4
+			;;
+		esac
+		;;
+	isi68 | isi)
+		basic_machine=m68k-isi
+		os=-sysv
+		;;
+	m88k-omron*)
+		basic_machine=m88k-omron
+		;;
+	magnum | m3230)
+		basic_machine=mips-mips
+		os=-sysv
+		;;
+	merlin)
+		basic_machine=ns32k-utek
+		os=-sysv
+		;;
+	mingw32)
+		basic_machine=i386-pc
+		os=-mingw32
+		;;
+	miniframe)
+		basic_machine=m68000-convergent
+		;;
+	*mint | -mint[0-9]* | *MiNT | *MiNT[0-9]*)
+		basic_machine=m68k-atari
+		os=-mint
+		;;
+	mips3*-*)
+		basic_machine=`echo $basic_machine | sed -e 's/mips3/mips64/'`
+		;;
+	mips3*)
+		basic_machine=`echo $basic_machine | sed -e 's/mips3/mips64/'`-unknown
+		;;
+	monitor)
+		basic_machine=m68k-rom68k
+		os=-coff
+		;;
+	morphos)
+		basic_machine=powerpc-unknown
+		os=-morphos
+		;;
+	msdos)
+		basic_machine=i386-pc
+		os=-msdos
+		;;
+	mvs)
+		basic_machine=i370-ibm
+		os=-mvs
+		;;
+	ncr3000)
+		basic_machine=i486-ncr
+		os=-sysv4
+		;;
+	netbsd386)
+		basic_machine=i386-unknown
+		os=-netbsd
+		;;
+	netwinder)
+		basic_machine=armv4l-rebel
+		os=-linux
+		;;
+	news | news700 | news800 | news900)
+		basic_machine=m68k-sony
+		os=-newsos
+		;;
+	news1000)
+		basic_machine=m68030-sony
+		os=-newsos
+		;;
+	news-3600 | risc-news)
+		basic_machine=mips-sony
+		os=-newsos
+		;;
+	necv70)
+		basic_machine=v70-nec
+		os=-sysv
+		;;
+	next | m*-next )
+		basic_machine=m68k-next
+		case $os in
+		    -nextstep* )
+			;;
+		    -ns2*)
+		      os=-nextstep2
+			;;
+		    *)
+		      os=-nextstep3
+			;;
+		esac
+		;;
+	nh3000)
+		basic_machine=m68k-harris
+		os=-cxux
+		;;
+	nh[45]000)
+		basic_machine=m88k-harris
+		os=-cxux
+		;;
+	nindy960)
+		basic_machine=i960-intel
+		os=-nindy
+		;;
+	mon960)
+		basic_machine=i960-intel
+		os=-mon960
+		;;
+	nonstopux)
+		basic_machine=mips-compaq
+		os=-nonstopux
+		;;
+	np1)
+		basic_machine=np1-gould
+		;;
+	nsr-tandem)
+		basic_machine=nsr-tandem
+		;;
+	op50n-* | op60c-*)
+		basic_machine=hppa1.1-oki
+		os=-proelf
+		;;
+	openrisc | openrisc-*)
+		basic_machine=or32-unknown
+		;;
+	os400)
+		basic_machine=powerpc-ibm
+		os=-os400
+		;;
+	OSE68000 | ose68000)
+		basic_machine=m68000-ericsson
+		os=-ose
+		;;
+	os68k)
+		basic_machine=m68k-none
+		os=-os68k
+		;;
+	pa-hitachi)
+		basic_machine=hppa1.1-hitachi
+		os=-hiuxwe2
+		;;
+	paragon)
+		basic_machine=i860-intel
+		os=-osf
+		;;
+	pbd)
+		basic_machine=sparc-tti
+		;;
+	pbb)
+		basic_machine=m68k-tti
+		;;
+	pc532 | pc532-*)
+		basic_machine=ns32k-pc532
+		;;
+	pentium | p5 | k5 | k6 | nexgen | viac3)
+		basic_machine=i586-pc
+		;;
+	pentiumpro | p6 | 6x86 | athlon | athlon_*)
+		basic_machine=i686-pc
+		;;
+	pentiumii | pentium2 | pentiumiii | pentium3)
+		basic_machine=i686-pc
+		;;
+	pentium4)
+		basic_machine=i786-pc
+		;;
+	pentium-* | p5-* | k5-* | k6-* | nexgen-* | viac3-*)
+		basic_machine=i586-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	pentiumpro-* | p6-* | 6x86-* | athlon-*)
+		basic_machine=i686-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	pentiumii-* | pentium2-* | pentiumiii-* | pentium3-*)
+		basic_machine=i686-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	pentium4-*)
+		basic_machine=i786-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	pn)
+		basic_machine=pn-gould
+		;;
+	power)	basic_machine=power-ibm
+		;;
+	ppc)	basic_machine=powerpc-unknown
+		;;
+	ppc-*)	basic_machine=powerpc-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	ppcle | powerpclittle | ppc-le | powerpc-little)
+		basic_machine=powerpcle-unknown
+		;;
+	ppcle-* | powerpclittle-*)
+		basic_machine=powerpcle-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	ppc64)	basic_machine=powerpc64-unknown
+		;;
+	ppc64-*) basic_machine=powerpc64-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	ppc64le | powerpc64little | ppc64-le | powerpc64-little)
+		basic_machine=powerpc64le-unknown
+		;;
+	ppc64le-* | powerpc64little-*)
+		basic_machine=powerpc64le-`echo $basic_machine | sed 's/^[^-]*-//'`
+		;;
+	ps2)
+		basic_machine=i386-ibm
+		;;
+	pw32)
+		basic_machine=i586-unknown
+		os=-pw32
+		;;
+	rom68k)
+		basic_machine=m68k-rom68k
+		os=-coff
+		;;
+	rm[46]00)
+		basic_machine=mips-siemens
+		;;
+	rtpc | rtpc-*)
+		basic_machine=romp-ibm
+		;;
+	s390 | s390-*)
+		basic_machine=s390-ibm
+		;;
+	s390x | s390x-*)
+		basic_machine=s390x-ibm
+		;;
+	sa29200)
+		basic_machine=a29k-amd
+		os=-udi
+		;;
+	sb1)
+		basic_machine=mipsisa64sb1-unknown
+		;;
+	sb1el)
+		basic_machine=mipsisa64sb1el-unknown
+		;;
+	sei)
+		basic_machine=mips-sei
+		os=-seiux
+		;;
+	sequent)
+		basic_machine=i386-sequent
+		;;
+	sh)
+		basic_machine=sh-hitachi
+		os=-hms
+		;;
+	sh64)
+		basic_machine=sh64-unknown
+		;;
+	sparclite-wrs | simso-wrs)
+		basic_machine=sparclite-wrs
+		os=-vxworks
+		;;
+	sps7)
+		basic_machine=m68k-bull
+		os=-sysv2
+		;;
+	spur)
+		basic_machine=spur-unknown
+		;;
+	st2000)
+		basic_machine=m68k-tandem
+		;;
+	stratus)
+		basic_machine=i860-stratus
+		os=-sysv4
+		;;
+	sun2)
+		basic_machine=m68000-sun
+		;;
+	sun2os3)
+		basic_machine=m68000-sun
+		os=-sunos3
+		;;
+	sun2os4)
+		basic_machine=m68000-sun
+		os=-sunos4
+		;;
+	sun3os3)
+		basic_machine=m68k-sun
+		os=-sunos3
+		;;
+	sun3os4)
+		basic_machine=m68k-sun
+		os=-sunos4
+		;;
+	sun4os3)
+		basic_machine=sparc-sun
+		os=-sunos3
+		;;
+	sun4os4)
+		basic_machine=sparc-sun
+		os=-sunos4
+		;;
+	sun4sol2)
+		basic_machine=sparc-sun
+		os=-solaris2
+		;;
+	sun3 | sun3-*)
+		basic_machine=m68k-sun
+		;;
+	sun4)
+		basic_machine=sparc-sun
+		;;
+	sun386 | sun386i | roadrunner)
+		basic_machine=i386-sun
+		;;
+	sv1)
+		basic_machine=sv1-cray
+		os=-unicos
+		;;
+	symmetry)
+		basic_machine=i386-sequent
+		os=-dynix
+		;;
+	t3e)
+		basic_machine=alphaev5-cray
+		os=-unicos
+		;;
+	t90)
+		basic_machine=t90-cray
+		os=-unicos
+		;;
+	tic54x | c54x*)
+		basic_machine=tic54x-unknown
+		os=-coff
+		;;
+	tic55x | c55x*)
+		basic_machine=tic55x-unknown
+		os=-coff
+		;;
+	tic6x | c6x*)
+		basic_machine=tic6x-unknown
+		os=-coff
+		;;
+	tx39)
+		basic_machine=mipstx39-unknown
+		;;
+	tx39el)
+		basic_machine=mipstx39el-unknown
+		;;
+	toad1)
+		basic_machine=pdp10-xkl
+		os=-tops20
+		;;
+	tower | tower-32)
+		basic_machine=m68k-ncr
+		;;
+	tpf)
+		basic_machine=s390x-ibm
+		os=-tpf
+		;;
+	udi29k)
+		basic_machine=a29k-amd
+		os=-udi
+		;;
+	ultra3)
+		basic_machine=a29k-nyu
+		os=-sym1
+		;;
+	v810 | necv810)
+		basic_machine=v810-nec
+		os=-none
+		;;
+	vaxv)
+		basic_machine=vax-dec
+		os=-sysv
+		;;
+	vms)
+		basic_machine=vax-dec
+		os=-vms
+		;;
+	vpp*|vx|vx-*)
+		basic_machine=f301-fujitsu
+		;;
+	vxworks960)
+		basic_machine=i960-wrs
+		os=-vxworks
+		;;
+	vxworks68)
+		basic_machine=m68k-wrs
+		os=-vxworks
+		;;
+	vxworks29k)
+		basic_machine=a29k-wrs
+		os=-vxworks
+		;;
+	w65*)
+		basic_machine=w65-wdc
+		os=-none
+		;;
+	w89k-*)
+		basic_machine=hppa1.1-winbond
+		os=-proelf
+		;;
+	xbox)
+		basic_machine=i686-pc
+		os=-mingw32
+		;;
+	xps | xps100)
+		basic_machine=xps100-honeywell
+		;;
+	ymp)
+		basic_machine=ymp-cray
+		os=-unicos
+		;;
+	z8k-*-coff)
+		basic_machine=z8k-unknown
+		os=-sim
+		;;
+	none)
+		basic_machine=none-none
+		os=-none
+		;;
+
+# Here we handle the default manufacturer of certain CPU types.  It is in
+# some cases the only manufacturer, in others, it is the most popular.
+	w89k)
+		basic_machine=hppa1.1-winbond
+		;;
+	op50n)
+		basic_machine=hppa1.1-oki
+		;;
+	op60c)
+		basic_machine=hppa1.1-oki
+		;;
+	romp)
+		basic_machine=romp-ibm
+		;;
+	mmix)
+		basic_machine=mmix-knuth
+		;;
+	rs6000)
+		basic_machine=rs6000-ibm
+		;;
+	vax)
+		basic_machine=vax-dec
+		;;
+	pdp10)
+		# there are many clones, so DEC is not a safe bet
+		basic_machine=pdp10-unknown
+		;;
+	pdp11)
+		basic_machine=pdp11-dec
+		;;
+	we32k)
+		basic_machine=we32k-att
+		;;
+	sh[1234] | sh[24]a | sh[34]eb | sh[1234]le | sh[23]ele)
+		basic_machine=sh-unknown
+		;;
+	sparc | sparcv8 | sparcv9 | sparcv9b)
+		basic_machine=sparc-sun
+		;;
+	cydra)
+		basic_machine=cydra-cydrome
+		;;
+	orion)
+		basic_machine=orion-highlevel
+		;;
+	orion105)
+		basic_machine=clipper-highlevel
+		;;
+	mac | mpw | mac-mpw)
+		basic_machine=m68k-apple
+		;;
+	pmac | pmac-mpw)
+		basic_machine=powerpc-apple
+		;;
+	*-unknown)
+		# Make sure to match an already-canonicalized machine name.
+		;;
+	*)
+		echo Invalid configuration \`$1\': machine \`$basic_machine\' not recognized 1>&2
+		exit 1
+		;;
+esac
+
+# Here we canonicalize certain aliases for manufacturers.
+case $basic_machine in
+	*-digital*)
+		basic_machine=`echo $basic_machine | sed 's/digital.*/dec/'`
+		;;
+	*-commodore*)
+		basic_machine=`echo $basic_machine | sed 's/commodore.*/cbm/'`
+		;;
+	*)
+		;;
+esac
+
+# Decode manufacturer-specific aliases for certain operating systems.
+
+if [ x"$os" != x"" ]
+then
+case $os in
+        # First match some system type aliases
+        # that might get confused with valid system types.
+	# -solaris* is a basic system type, with this one exception.
+	-solaris1 | -solaris1.*)
+		os=`echo $os | sed -e 's|solaris1|sunos4|'`
+		;;
+	-solaris)
+		os=-solaris2
+		;;
+	-svr4*)
+		os=-sysv4
+		;;
+	-unixware*)
+		os=-sysv4.2uw
+		;;
+	-gnu/linux*)
+		os=`echo $os | sed -e 's|gnu/linux|linux-gnu|'`
+		;;
+	# First accept the basic system types.
+	# The portable systems comes first.
+	# Each alternative MUST END IN A *, to match a version number.
+	# -sysv* is not here because it comes later, after sysvr4.
+	-gnu* | -bsd* | -mach* | -minix* | -genix* | -ultrix* | -irix* \
+	      | -*vms* | -sco* | -esix* | -isc* | -aix* | -sunos | -sunos[34]*\
+	      | -hpux* | -unos* | -osf* | -luna* | -dgux* | -solaris* | -sym* \
+	      | -amigaos* | -amigados* | -msdos* | -newsos* | -unicos* | -aof* \
+	      | -aos* \
+	      | -nindy* | -vxsim* | -vxworks* | -ebmon* | -hms* | -mvs* \
+	      | -clix* | -riscos* | -uniplus* | -iris* | -rtu* | -xenix* \
+	      | -hiux* | -386bsd* | -knetbsd* | -mirbsd* | -netbsd* | -openbsd* \
+	      | -ekkobsd* | -kfreebsd* | -freebsd* | -riscix* | -lynxos* \
+	      | -bosx* | -nextstep* | -cxux* | -aout* | -elf* | -oabi* \
+	      | -ptx* | -coff* | -ecoff* | -winnt* | -domain* | -vsta* \
+	      | -udi* | -eabi* | -lites* | -ieee* | -go32* | -aux* \
+	      | -chorusos* | -chorusrdb* \
+	      | -cygwin* | -pe* | -psos* | -moss* | -proelf* | -rtems* \
+	      | -mingw32* | -linux-gnu* | -linux-uclibc* | -uxpv* | -beos* | -mpeix* | -udk* \
+	      | -interix* | -uwin* | -mks* | -rhapsody* | -darwin* | -opened* \
+	      | -openstep* | -oskit* | -conix* | -pw32* | -nonstopux* \
+	      | -storm-chaos* | -tops10* | -tenex* | -tops20* | -its* \
+	      | -os2* | -vos* | -palmos* | -uclinux* | -nucleus* \
+	      | -morphos* | -superux* | -rtmk* | -rtmk-nova* | -windiss* \
+	      | -powermax* | -dnix* | -nx6 | -nx7 | -sei* | -dragonfly* \
+	      | -skyos* | -haiku*)
+	# Remember, each alternative MUST END IN *, to match a version number.
+		;;
+	-qnx*)
+		case $basic_machine in
+		    x86-* | i*86-*)
+			;;
+		    *)
+			os=-nto$os
+			;;
+		esac
+		;;
+	-nto-qnx*)
+		;;
+	-nto*)
+		os=`echo $os | sed -e 's|nto|nto-qnx|'`
+		;;
+	-sim | -es1800* | -hms* | -xray | -os68k* | -none* | -v88r* \
+	      | -windows* | -osx | -abug | -netware* | -os9* | -beos* | -haiku* \
+	      | -macos* | -mpw* | -magic* | -mmixware* | -mon960* | -lnews*)
+		;;
+	-mac*)
+		os=`echo $os | sed -e 's|mac|macos|'`
+		;;
+	-linux-dietlibc)
+		os=-linux-dietlibc
+		;;
+	-linux*)
+		os=`echo $os | sed -e 's|linux|linux-gnu|'`
+		;;
+	-sunos5*)
+		os=`echo $os | sed -e 's|sunos5|solaris2|'`
+		;;
+	-sunos6*)
+		os=`echo $os | sed -e 's|sunos6|solaris3|'`
+		;;
+	-opened*)
+		os=-openedition
+		;;
+        -os400*)
+		os=-os400
+		;;
+	-wince*)
+		os=-wince
+		;;
+	-osfrose*)
+		os=-osfrose
+		;;
+	-osf*)
+		os=-osf
+		;;
+	-utek*)
+		os=-bsd
+		;;
+	-dynix*)
+		os=-bsd
+		;;
+	-acis*)
+		os=-aos
+		;;
+	-atheos*)
+		os=-atheos
+		;;
+	-syllable*)
+		os=-syllable
+		;;
+	-386bsd)
+		os=-bsd
+		;;
+	-ctix* | -uts*)
+		os=-sysv
+		;;
+	-nova*)
+		os=-rtmk-nova
+		;;
+	-ns2 )
+		os=-nextstep2
+		;;
+	-nsk*)
+		os=-nsk
+		;;
+	# Preserve the version number of sinix5.
+	-sinix5.*)
+		os=`echo $os | sed -e 's|sinix|sysv|'`
+		;;
+	-sinix*)
+		os=-sysv4
+		;;
+        -tpf*)
+		os=-tpf
+		;;
+	-triton*)
+		os=-sysv3
+		;;
+	-oss*)
+		os=-sysv3
+		;;
+	-svr4)
+		os=-sysv4
+		;;
+	-svr3)
+		os=-sysv3
+		;;
+	-sysvr4)
+		os=-sysv4
+		;;
+	# This must come after -sysvr4.
+	-sysv*)
+		;;
+	-ose*)
+		os=-ose
+		;;
+	-es1800*)
+		os=-ose
+		;;
+	-xenix)
+		os=-xenix
+		;;
+	-*mint | -mint[0-9]* | -*MiNT | -MiNT[0-9]*)
+		os=-mint
+		;;
+	-aros*)
+		os=-aros
+		;;
+	-kaos*)
+		os=-kaos
+		;;
+	-zvmoe)
+		os=-zvmoe
+		;;
+	-none)
+		;;
+	*)
+		# Get rid of the `-' at the beginning of $os.
+		os=`echo $os | sed 's/[^-]*-//'`
+		echo Invalid configuration \`$1\': system \`$os\' not recognized 1>&2
+		exit 1
+		;;
+esac
+else
+
+# Here we handle the default operating systems that come with various machines.
+# The value should be what the vendor currently ships out the door with their
+# machine or put another way, the most popular os provided with the machine.
+
+# Note that if you're going to try to match "-MANUFACTURER" here (say,
+# "-sun"), then you have to tell the case statement up towards the top
+# that MANUFACTURER isn't an operating system.  Otherwise, code above
+# will signal an error saying that MANUFACTURER isn't an operating
+# system, and we'll never get to this point.
+
+case $basic_machine in
+	*-acorn)
+		os=-riscix1.2
+		;;
+	arm*-rebel)
+		os=-linux
+		;;
+	arm*-semi)
+		os=-aout
+		;;
+    c4x-* | tic4x-*)
+        os=-coff
+        ;;
+	# This must come before the *-dec entry.
+	pdp10-*)
+		os=-tops20
+		;;
+	pdp11-*)
+		os=-none
+		;;
+	*-dec | vax-*)
+		os=-ultrix4.2
+		;;
+	m68*-apollo)
+		os=-domain
+		;;
+	i386-sun)
+		os=-sunos4.0.2
+		;;
+	m68000-sun)
+		os=-sunos3
+		# This also exists in the configure program, but was not the
+		# default.
+		# os=-sunos4
+		;;
+	m68*-cisco)
+		os=-aout
+		;;
+	mips*-cisco)
+		os=-elf
+		;;
+	mips*-*)
+		os=-elf
+		;;
+	or32-*)
+		os=-coff
+		;;
+	*-tti)	# must be before sparc entry or we get the wrong os.
+		os=-sysv3
+		;;
+	sparc-* | *-sun)
+		os=-sunos4.1.1
+		;;
+	*-be)
+		os=-beos
+		;;
+	*-haiku)
+		os=-haiku
+		;;
+	*-ibm)
+		os=-aix
+		;;
+    	*-knuth)
+		os=-mmixware
+		;;
+	*-wec)
+		os=-proelf
+		;;
+	*-winbond)
+		os=-proelf
+		;;
+	*-oki)
+		os=-proelf
+		;;
+	*-hp)
+		os=-hpux
+		;;
+	*-hitachi)
+		os=-hiux
+		;;
+	i860-* | *-att | *-ncr | *-altos | *-motorola | *-convergent)
+		os=-sysv
+		;;
+	*-cbm)
+		os=-amigaos
+		;;
+	*-dg)
+		os=-dgux
+		;;
+	*-dolphin)
+		os=-sysv3
+		;;
+	m68k-ccur)
+		os=-rtu
+		;;
+	m88k-omron*)
+		os=-luna
+		;;
+	*-next )
+		os=-nextstep
+		;;
+	*-sequent)
+		os=-ptx
+		;;
+	*-crds)
+		os=-unos
+		;;
+	*-ns)
+		os=-genix
+		;;
+	i370-*)
+		os=-mvs
+		;;
+	*-next)
+		os=-nextstep3
+		;;
+	*-gould)
+		os=-sysv
+		;;
+	*-highlevel)
+		os=-bsd
+		;;
+	*-encore)
+		os=-bsd
+		;;
+	*-sgi)
+		os=-irix
+		;;
+	*-siemens)
+		os=-sysv4
+		;;
+	*-masscomp)
+		os=-rtu
+		;;
+	f30[01]-fujitsu | f700-fujitsu)
+		os=-uxpv
+		;;
+	*-rom68k)
+		os=-coff
+		;;
+	*-*bug)
+		os=-coff
+		;;
+	*-apple)
+		os=-macos
+		;;
+	*-atari*)
+		os=-mint
+		;;
+	*)
+		os=-none
+		;;
+esac
+fi
+
+# Here we handle the case where we know the os, and the CPU type, but not the
+# manufacturer.  We pick the logical manufacturer.
+vendor=unknown
+case $basic_machine in
+	*-unknown)
+		case $os in
+			-riscix*)
+				vendor=acorn
+				;;
+			-sunos*)
+				vendor=sun
+				;;
+			-aix*)
+				vendor=ibm
+				;;
+			-beos*)
+				vendor=be
+				;;
+			-hpux*)
+				vendor=hp
+				;;
+			-mpeix*)
+				vendor=hp
+				;;
+			-hiux*)
+				vendor=hitachi
+				;;
+			-unos*)
+				vendor=crds
+				;;
+			-dgux*)
+				vendor=dg
+				;;
+			-luna*)
+				vendor=omron
+				;;
+			-genix*)
+				vendor=ns
+				;;
+			-mvs* | -opened*)
+				vendor=ibm
+				;;
+			-os400*)
+				vendor=ibm
+				;;
+			-ptx*)
+				vendor=sequent
+				;;
+			-tpf*)
+				vendor=ibm
+				;;
+			-vxsim* | -vxworks* | -windiss*)
+				vendor=wrs
+				;;
+			-aux*)
+				vendor=apple
+				;;
+			-hms*)
+				vendor=hitachi
+				;;
+			-mpw* | -macos*)
+				vendor=apple
+				;;
+			-*mint | -mint[0-9]* | -*MiNT | -MiNT[0-9]*)
+				vendor=atari
+				;;
+			-vos*)
+				vendor=stratus
+				;;
+		esac
+		basic_machine=`echo $basic_machine | sed "s/unknown/$vendor/"`
+		;;
+esac
+
+echo $basic_machine$os
+exit
+
+# Local variables:
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "timestamp='"
+# time-stamp-format: "%:y-%02m-%02d"
+# time-stamp-end: "'"
+# End:
diff --git a/configure b/configure
new file mode 100755
index 0000000..d90ccec
--- /dev/null
+++ b/configure
@@ -0,0 +1,5792 @@
+#! /bin/sh
+# Guess values for system-dependent variables and create Makefiles.
+# Generated by GNU Autoconf 2.59 for toppred 1.10.
+#
+# Copyright (C) 2003 Free Software Foundation, Inc.
+# This configure script is free software; the Free Software Foundation
+# gives unlimited permission to copy, distribute and modify it.
+## --------------------- ##
+## M4sh Initialization.  ##
+## --------------------- ##
+
+# Be Bourne compatible
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then
+  emulate sh
+  NULLCMD=:
+  # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which
+  # is contrary to our usage.  Disable this feature.
+  alias -g '${1+"$@"}'='"$@"'
+elif test -n "${BASH_VERSION+set}" && (set -o posix) >/dev/null 2>&1; then
+  set -o posix
+fi
+DUALCASE=1; export DUALCASE # for MKS sh
+
+# Support unset when possible.
+if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then
+  as_unset=unset
+else
+  as_unset=false
+fi
+
+
+# Work around bugs in pre-3.0 UWIN ksh.
+$as_unset ENV MAIL MAILPATH
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+for as_var in \
+  LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \
+  LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \
+  LC_TELEPHONE LC_TIME
+do
+  if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then
+    eval $as_var=C; export $as_var
+  else
+    $as_unset $as_var
+  fi
+done
+
+# Required to use basename.
+if expr a : '\(a\)' >/dev/null 2>&1; then
+  as_expr=expr
+else
+  as_expr=false
+fi
+
+if (basename /) >/dev/null 2>&1 && test "X`basename / 2>&1`" = "X/"; then
+  as_basename=basename
+else
+  as_basename=false
+fi
+
+
+# Name of the executable.
+as_me=`$as_basename "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+	 X"$0" : 'X\(//\)$' \| \
+	 X"$0" : 'X\(/\)$' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X/"$0" |
+    sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/; q; }
+  	  /^X\/\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\/\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+
+
+# PATH needs CR, and LINENO needs CR and PATH.
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+  echo "#! /bin/sh" >conf$$.sh
+  echo  "exit 0"   >>conf$$.sh
+  chmod +x conf$$.sh
+  if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then
+    PATH_SEPARATOR=';'
+  else
+    PATH_SEPARATOR=:
+  fi
+  rm -f conf$$.sh
+fi
+
+
+  as_lineno_1=$LINENO
+  as_lineno_2=$LINENO
+  as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null`
+  test "x$as_lineno_1" != "x$as_lineno_2" &&
+  test "x$as_lineno_3"  = "x$as_lineno_2"  || {
+  # Find who we are.  Look in the path if we contain no path at all
+  # relative or not.
+  case $0 in
+    *[\\/]* ) as_myself=$0 ;;
+    *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+done
+
+       ;;
+  esac
+  # We did not find ourselves, most probably we were run as `sh COMMAND'
+  # in which case we are not to be found in the path.
+  if test "x$as_myself" = x; then
+    as_myself=$0
+  fi
+  if test ! -f "$as_myself"; then
+    { echo "$as_me: error: cannot find myself; rerun with an absolute path" >&2
+   { (exit 1); exit 1; }; }
+  fi
+  case $CONFIG_SHELL in
+  '')
+    as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for as_base in sh bash ksh sh5; do
+	 case $as_dir in
+	 /*)
+	   if ("$as_dir/$as_base" -c '
+  as_lineno_1=$LINENO
+  as_lineno_2=$LINENO
+  as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null`
+  test "x$as_lineno_1" != "x$as_lineno_2" &&
+  test "x$as_lineno_3"  = "x$as_lineno_2" ') 2>/dev/null; then
+	     $as_unset BASH_ENV || test "${BASH_ENV+set}" != set || { BASH_ENV=; export BASH_ENV; }
+	     $as_unset ENV || test "${ENV+set}" != set || { ENV=; export ENV; }
+	     CONFIG_SHELL=$as_dir/$as_base
+	     export CONFIG_SHELL
+	     exec "$CONFIG_SHELL" "$0" ${1+"$@"}
+	   fi;;
+	 esac
+       done
+done
+;;
+  esac
+
+  # Create $as_me.lineno as a copy of $as_myself, but with $LINENO
+  # uniformly replaced by the line number.  The first 'sed' inserts a
+  # line-number line before each line; the second 'sed' does the real
+  # work.  The second script uses 'N' to pair each line-number line
+  # with the numbered line, and appends trailing '-' during
+  # substitution so that $LINENO is not a special case at line end.
+  # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the
+  # second 'sed' script.  Blame Lee E. McMahon for sed's syntax.  :-)
+  sed '=' <$as_myself |
+    sed '
+      N
+      s,$,-,
+      : loop
+      s,^\(['$as_cr_digits']*\)\(.*\)[$]LINENO\([^'$as_cr_alnum'_]\),\1\2\1\3,
+      t loop
+      s,-$,,
+      s,^['$as_cr_digits']*\n,,
+    ' >$as_me.lineno &&
+  chmod +x $as_me.lineno ||
+    { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2
+   { (exit 1); exit 1; }; }
+
+  # Don't try to exec as it changes $[0], causing all sort of problems
+  # (the dirname of $[0] is not the place where we might find the
+  # original and so on.  Autoconf is especially sensible to this).
+  . ./$as_me.lineno
+  # Exit status is that of the last command.
+  exit
+}
+
+
+case `echo "testing\c"; echo 1,2,3`,`echo -n testing; echo 1,2,3` in
+  *c*,-n*) ECHO_N= ECHO_C='
+' ECHO_T='	' ;;
+  *c*,*  ) ECHO_N=-n ECHO_C= ECHO_T= ;;
+  *)       ECHO_N= ECHO_C='\c' ECHO_T= ;;
+esac
+
+if expr a : '\(a\)' >/dev/null 2>&1; then
+  as_expr=expr
+else
+  as_expr=false
+fi
+
+rm -f conf$$ conf$$.exe conf$$.file
+echo >conf$$.file
+if ln -s conf$$.file conf$$ 2>/dev/null; then
+  # We could just check for DJGPP; but this test a) works b) is more generic
+  # and c) will remain valid once DJGPP supports symlinks (DJGPP 2.04).
+  if test -f conf$$.exe; then
+    # Don't use ln at all; we don't have any links
+    as_ln_s='cp -p'
+  else
+    as_ln_s='ln -s'
+  fi
+elif ln conf$$.file conf$$ 2>/dev/null; then
+  as_ln_s=ln
+else
+  as_ln_s='cp -p'
+fi
+rm -f conf$$ conf$$.exe conf$$.file
+
+if mkdir -p . 2>/dev/null; then
+  as_mkdir_p=:
+else
+  test -d ./-p && rmdir ./-p
+  as_mkdir_p=false
+fi
+
+as_executable_p="test -f"
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+# IFS
+# We need space, tab and new line, in precisely that order.
+as_nl='
+'
+IFS=" 	$as_nl"
+
+# CDPATH.
+$as_unset CDPATH
+
+
+# Name of the host.
+# hostname on some systems (SVR3.2, Linux) returns a bogus exit status,
+# so uname gets run too.
+ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q`
+
+exec 6>&1
+
+#
+# Initializations.
+#
+ac_default_prefix=/usr/local
+ac_config_libobj_dir=.
+cross_compiling=no
+subdirs=
+MFLAGS=
+MAKEFLAGS=
+SHELL=${CONFIG_SHELL-/bin/sh}
+
+# Maximum number of lines to put in a shell here document.
+# This variable seems obsolete.  It should probably be removed, and
+# only ac_max_sed_lines should be used.
+: ${ac_max_here_lines=38}
+
+# Identity of this package.
+PACKAGE_NAME='toppred'
+PACKAGE_TARNAME='toppred'
+PACKAGE_VERSION='1.10'
+PACKAGE_STRING='toppred 1.10'
+PACKAGE_BUGREPORT=''
+
+# Factoring default headers for most tests.
+ac_includes_default="\
+#include <stdio.h>
+#if HAVE_SYS_TYPES_H
+# include <sys/types.h>
+#endif
+#if HAVE_SYS_STAT_H
+# include <sys/stat.h>
+#endif
+#if STDC_HEADERS
+# include <stdlib.h>
+# include <stddef.h>
+#else
+# if HAVE_STDLIB_H
+#  include <stdlib.h>
+# endif
+#endif
+#if HAVE_STRING_H
+# if !STDC_HEADERS && HAVE_MEMORY_H
+#  include <memory.h>
+# endif
+# include <string.h>
+#endif
+#if HAVE_STRINGS_H
+# include <strings.h>
+#endif
+#if HAVE_INTTYPES_H
+# include <inttypes.h>
+#else
+# if HAVE_STDINT_H
+#  include <stdint.h>
+# endif
+#endif
+#if HAVE_UNISTD_H
+# include <unistd.h>
+#endif"
+
+ac_subst_vars='SHELL PATH_SEPARATOR PACKAGE_NAME PACKAGE_TARNAME PACKAGE_VERSION PACKAGE_STRING PACKAGE_BUGREPORT exec_prefix prefix program_transform_name bindir sbindir libexecdir datadir sysconfdir sharedstatedir localstatedir libdir includedir oldincludedir infodir mandir build_alias host_alias target_alias DEFS ECHO_C ECHO_N ECHO_T LIBS INSTALL_PROGRAM INSTALL_SCRIPT INSTALL_DATA CYGPATH_W PACKAGE VERSION ACLOCAL AUTOCONF AUTOMAKE AUTOHEADER MAKEINFO install_sh STRIP ac_ct_STRIP INS [...]
+ac_subst_files=''
+
+# Initialize some variables set by options.
+ac_init_help=
+ac_init_version=false
+# The variables have the same names as the options, with
+# dashes changed to underlines.
+cache_file=/dev/null
+exec_prefix=NONE
+no_create=
+no_recursion=
+prefix=NONE
+program_prefix=NONE
+program_suffix=NONE
+program_transform_name=s,x,x,
+silent=
+site=
+srcdir=
+verbose=
+x_includes=NONE
+x_libraries=NONE
+
+# Installation directory options.
+# These are left unexpanded so users can "make install exec_prefix=/foo"
+# and all the variables that are supposed to be based on exec_prefix
+# by default will actually change.
+# Use braces instead of parens because sh, perl, etc. also accept them.
+bindir='${exec_prefix}/bin'
+sbindir='${exec_prefix}/sbin'
+libexecdir='${exec_prefix}/libexec'
+datadir='${prefix}/share'
+sysconfdir='${prefix}/etc'
+sharedstatedir='${prefix}/com'
+localstatedir='${prefix}/var'
+libdir='${exec_prefix}/lib'
+includedir='${prefix}/include'
+oldincludedir='/usr/include'
+infodir='${prefix}/info'
+mandir='${prefix}/man'
+
+ac_prev=
+for ac_option
+do
+  # If the previous option needs an argument, assign it.
+  if test -n "$ac_prev"; then
+    eval "$ac_prev=\$ac_option"
+    ac_prev=
+    continue
+  fi
+
+  ac_optarg=`expr "x$ac_option" : 'x[^=]*=\(.*\)'`
+
+  # Accept the important Cygnus configure options, so we can diagnose typos.
+
+  case $ac_option in
+
+  -bindir | --bindir | --bindi | --bind | --bin | --bi)
+    ac_prev=bindir ;;
+  -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*)
+    bindir=$ac_optarg ;;
+
+  -build | --build | --buil | --bui | --bu)
+    ac_prev=build_alias ;;
+  -build=* | --build=* | --buil=* | --bui=* | --bu=*)
+    build_alias=$ac_optarg ;;
+
+  -cache-file | --cache-file | --cache-fil | --cache-fi \
+  | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c)
+    ac_prev=cache_file ;;
+  -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \
+  | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*)
+    cache_file=$ac_optarg ;;
+
+  --config-cache | -C)
+    cache_file=config.cache ;;
+
+  -datadir | --datadir | --datadi | --datad | --data | --dat | --da)
+    ac_prev=datadir ;;
+  -datadir=* | --datadir=* | --datadi=* | --datad=* | --data=* | --dat=* \
+  | --da=*)
+    datadir=$ac_optarg ;;
+
+  -disable-* | --disable-*)
+    ac_feature=`expr "x$ac_option" : 'x-*disable-\(.*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_feature" : ".*[^-_$as_cr_alnum]" >/dev/null &&
+      { echo "$as_me: error: invalid feature name: $ac_feature" >&2
+   { (exit 1); exit 1; }; }
+    ac_feature=`echo $ac_feature | sed 's/-/_/g'`
+    eval "enable_$ac_feature=no" ;;
+
+  -enable-* | --enable-*)
+    ac_feature=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_feature" : ".*[^-_$as_cr_alnum]" >/dev/null &&
+      { echo "$as_me: error: invalid feature name: $ac_feature" >&2
+   { (exit 1); exit 1; }; }
+    ac_feature=`echo $ac_feature | sed 's/-/_/g'`
+    case $ac_option in
+      *=*) ac_optarg=`echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"`;;
+      *) ac_optarg=yes ;;
+    esac
+    eval "enable_$ac_feature='$ac_optarg'" ;;
+
+  -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \
+  | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \
+  | --exec | --exe | --ex)
+    ac_prev=exec_prefix ;;
+  -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \
+  | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \
+  | --exec=* | --exe=* | --ex=*)
+    exec_prefix=$ac_optarg ;;
+
+  -gas | --gas | --ga | --g)
+    # Obsolete; use --with-gas.
+    with_gas=yes ;;
+
+  -help | --help | --hel | --he | -h)
+    ac_init_help=long ;;
+  -help=r* | --help=r* | --hel=r* | --he=r* | -hr*)
+    ac_init_help=recursive ;;
+  -help=s* | --help=s* | --hel=s* | --he=s* | -hs*)
+    ac_init_help=short ;;
+
+  -host | --host | --hos | --ho)
+    ac_prev=host_alias ;;
+  -host=* | --host=* | --hos=* | --ho=*)
+    host_alias=$ac_optarg ;;
+
+  -includedir | --includedir | --includedi | --included | --include \
+  | --includ | --inclu | --incl | --inc)
+    ac_prev=includedir ;;
+  -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \
+  | --includ=* | --inclu=* | --incl=* | --inc=*)
+    includedir=$ac_optarg ;;
+
+  -infodir | --infodir | --infodi | --infod | --info | --inf)
+    ac_prev=infodir ;;
+  -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*)
+    infodir=$ac_optarg ;;
+
+  -libdir | --libdir | --libdi | --libd)
+    ac_prev=libdir ;;
+  -libdir=* | --libdir=* | --libdi=* | --libd=*)
+    libdir=$ac_optarg ;;
+
+  -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \
+  | --libexe | --libex | --libe)
+    ac_prev=libexecdir ;;
+  -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \
+  | --libexe=* | --libex=* | --libe=*)
+    libexecdir=$ac_optarg ;;
+
+  -localstatedir | --localstatedir | --localstatedi | --localstated \
+  | --localstate | --localstat | --localsta | --localst \
+  | --locals | --local | --loca | --loc | --lo)
+    ac_prev=localstatedir ;;
+  -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \
+  | --localstate=* | --localstat=* | --localsta=* | --localst=* \
+  | --locals=* | --local=* | --loca=* | --loc=* | --lo=*)
+    localstatedir=$ac_optarg ;;
+
+  -mandir | --mandir | --mandi | --mand | --man | --ma | --m)
+    ac_prev=mandir ;;
+  -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*)
+    mandir=$ac_optarg ;;
+
+  -nfp | --nfp | --nf)
+    # Obsolete; use --without-fp.
+    with_fp=no ;;
+
+  -no-create | --no-create | --no-creat | --no-crea | --no-cre \
+  | --no-cr | --no-c | -n)
+    no_create=yes ;;
+
+  -no-recursion | --no-recursion | --no-recursio | --no-recursi \
+  | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r)
+    no_recursion=yes ;;
+
+  -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \
+  | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \
+  | --oldin | --oldi | --old | --ol | --o)
+    ac_prev=oldincludedir ;;
+  -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \
+  | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \
+  | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*)
+    oldincludedir=$ac_optarg ;;
+
+  -prefix | --prefix | --prefi | --pref | --pre | --pr | --p)
+    ac_prev=prefix ;;
+  -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*)
+    prefix=$ac_optarg ;;
+
+  -program-prefix | --program-prefix | --program-prefi | --program-pref \
+  | --program-pre | --program-pr | --program-p)
+    ac_prev=program_prefix ;;
+  -program-prefix=* | --program-prefix=* | --program-prefi=* \
+  | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*)
+    program_prefix=$ac_optarg ;;
+
+  -program-suffix | --program-suffix | --program-suffi | --program-suff \
+  | --program-suf | --program-su | --program-s)
+    ac_prev=program_suffix ;;
+  -program-suffix=* | --program-suffix=* | --program-suffi=* \
+  | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*)
+    program_suffix=$ac_optarg ;;
+
+  -program-transform-name | --program-transform-name \
+  | --program-transform-nam | --program-transform-na \
+  | --program-transform-n | --program-transform- \
+  | --program-transform | --program-transfor \
+  | --program-transfo | --program-transf \
+  | --program-trans | --program-tran \
+  | --progr-tra | --program-tr | --program-t)
+    ac_prev=program_transform_name ;;
+  -program-transform-name=* | --program-transform-name=* \
+  | --program-transform-nam=* | --program-transform-na=* \
+  | --program-transform-n=* | --program-transform-=* \
+  | --program-transform=* | --program-transfor=* \
+  | --program-transfo=* | --program-transf=* \
+  | --program-trans=* | --program-tran=* \
+  | --progr-tra=* | --program-tr=* | --program-t=*)
+    program_transform_name=$ac_optarg ;;
+
+  -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+  | -silent | --silent | --silen | --sile | --sil)
+    silent=yes ;;
+
+  -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb)
+    ac_prev=sbindir ;;
+  -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \
+  | --sbi=* | --sb=*)
+    sbindir=$ac_optarg ;;
+
+  -sharedstatedir | --sharedstatedir | --sharedstatedi \
+  | --sharedstated | --sharedstate | --sharedstat | --sharedsta \
+  | --sharedst | --shareds | --shared | --share | --shar \
+  | --sha | --sh)
+    ac_prev=sharedstatedir ;;
+  -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \
+  | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \
+  | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \
+  | --sha=* | --sh=*)
+    sharedstatedir=$ac_optarg ;;
+
+  -site | --site | --sit)
+    ac_prev=site ;;
+  -site=* | --site=* | --sit=*)
+    site=$ac_optarg ;;
+
+  -srcdir | --srcdir | --srcdi | --srcd | --src | --sr)
+    ac_prev=srcdir ;;
+  -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*)
+    srcdir=$ac_optarg ;;
+
+  -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \
+  | --syscon | --sysco | --sysc | --sys | --sy)
+    ac_prev=sysconfdir ;;
+  -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \
+  | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*)
+    sysconfdir=$ac_optarg ;;
+
+  -target | --target | --targe | --targ | --tar | --ta | --t)
+    ac_prev=target_alias ;;
+  -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*)
+    target_alias=$ac_optarg ;;
+
+  -v | -verbose | --verbose | --verbos | --verbo | --verb)
+    verbose=yes ;;
+
+  -version | --version | --versio | --versi | --vers | -V)
+    ac_init_version=: ;;
+
+  -with-* | --with-*)
+    ac_package=`expr "x$ac_option" : 'x-*with-\([^=]*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_package" : ".*[^-_$as_cr_alnum]" >/dev/null &&
+      { echo "$as_me: error: invalid package name: $ac_package" >&2
+   { (exit 1); exit 1; }; }
+    ac_package=`echo $ac_package| sed 's/-/_/g'`
+    case $ac_option in
+      *=*) ac_optarg=`echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"`;;
+      *) ac_optarg=yes ;;
+    esac
+    eval "with_$ac_package='$ac_optarg'" ;;
+
+  -without-* | --without-*)
+    ac_package=`expr "x$ac_option" : 'x-*without-\(.*\)'`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_package" : ".*[^-_$as_cr_alnum]" >/dev/null &&
+      { echo "$as_me: error: invalid package name: $ac_package" >&2
+   { (exit 1); exit 1; }; }
+    ac_package=`echo $ac_package | sed 's/-/_/g'`
+    eval "with_$ac_package=no" ;;
+
+  --x)
+    # Obsolete; use --with-x.
+    with_x=yes ;;
+
+  -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \
+  | --x-incl | --x-inc | --x-in | --x-i)
+    ac_prev=x_includes ;;
+  -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \
+  | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*)
+    x_includes=$ac_optarg ;;
+
+  -x-libraries | --x-libraries | --x-librarie | --x-librari \
+  | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l)
+    ac_prev=x_libraries ;;
+  -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \
+  | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*)
+    x_libraries=$ac_optarg ;;
+
+  -*) { echo "$as_me: error: unrecognized option: $ac_option
+Try \`$0 --help' for more information." >&2
+   { (exit 1); exit 1; }; }
+    ;;
+
+  *=*)
+    ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='`
+    # Reject names that are not valid shell variable names.
+    expr "x$ac_envvar" : ".*[^_$as_cr_alnum]" >/dev/null &&
+      { echo "$as_me: error: invalid variable name: $ac_envvar" >&2
+   { (exit 1); exit 1; }; }
+    ac_optarg=`echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"`
+    eval "$ac_envvar='$ac_optarg'"
+    export $ac_envvar ;;
+
+  *)
+    # FIXME: should be removed in autoconf 3.0.
+    echo "$as_me: WARNING: you should use --build, --host, --target" >&2
+    expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+      echo "$as_me: WARNING: invalid host type: $ac_option" >&2
+    : ${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}
+    ;;
+
+  esac
+done
+
+if test -n "$ac_prev"; then
+  ac_option=--`echo $ac_prev | sed 's/_/-/g'`
+  { echo "$as_me: error: missing argument to $ac_option" >&2
+   { (exit 1); exit 1; }; }
+fi
+
+# Be sure to have absolute paths.
+for ac_var in exec_prefix prefix
+do
+  eval ac_val=$`echo $ac_var`
+  case $ac_val in
+    [\\/$]* | ?:[\\/]* | NONE | '' ) ;;
+    *)  { echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2
+   { (exit 1); exit 1; }; };;
+  esac
+done
+
+# Be sure to have absolute paths.
+for ac_var in bindir sbindir libexecdir datadir sysconfdir sharedstatedir \
+	      localstatedir libdir includedir oldincludedir infodir mandir
+do
+  eval ac_val=$`echo $ac_var`
+  case $ac_val in
+    [\\/$]* | ?:[\\/]* ) ;;
+    *)  { echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2
+   { (exit 1); exit 1; }; };;
+  esac
+done
+
+# There might be people who depend on the old broken behavior: `$host'
+# used to hold the argument of --host etc.
+# FIXME: To remove some day.
+build=$build_alias
+host=$host_alias
+target=$target_alias
+
+# FIXME: To remove some day.
+if test "x$host_alias" != x; then
+  if test "x$build_alias" = x; then
+    cross_compiling=maybe
+    echo "$as_me: WARNING: If you wanted to set the --build type, don't use --host.
+    If a cross compiler is detected then cross compile mode will be used." >&2
+  elif test "x$build_alias" != "x$host_alias"; then
+    cross_compiling=yes
+  fi
+fi
+
+ac_tool_prefix=
+test -n "$host_alias" && ac_tool_prefix=$host_alias-
+
+test "$silent" = yes && exec 6>/dev/null
+
+
+# Find the source files, if location was not specified.
+if test -z "$srcdir"; then
+  ac_srcdir_defaulted=yes
+  # Try the directory containing this script, then its parent.
+  ac_confdir=`(dirname "$0") 2>/dev/null ||
+$as_expr X"$0" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$0" : 'X\(//\)[^/]' \| \
+	 X"$0" : 'X\(//\)$' \| \
+	 X"$0" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$0" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+  srcdir=$ac_confdir
+  if test ! -r $srcdir/$ac_unique_file; then
+    srcdir=..
+  fi
+else
+  ac_srcdir_defaulted=no
+fi
+if test ! -r $srcdir/$ac_unique_file; then
+  if test "$ac_srcdir_defaulted" = yes; then
+    { echo "$as_me: error: cannot find sources ($ac_unique_file) in $ac_confdir or .." >&2
+   { (exit 1); exit 1; }; }
+  else
+    { echo "$as_me: error: cannot find sources ($ac_unique_file) in $srcdir" >&2
+   { (exit 1); exit 1; }; }
+  fi
+fi
+(cd $srcdir && test -r ./$ac_unique_file) 2>/dev/null ||
+  { echo "$as_me: error: sources are in $srcdir, but \`cd $srcdir' does not work" >&2
+   { (exit 1); exit 1; }; }
+srcdir=`echo "$srcdir" | sed 's%\([^\\/]\)[\\/]*$%\1%'`
+ac_env_build_alias_set=${build_alias+set}
+ac_env_build_alias_value=$build_alias
+ac_cv_env_build_alias_set=${build_alias+set}
+ac_cv_env_build_alias_value=$build_alias
+ac_env_host_alias_set=${host_alias+set}
+ac_env_host_alias_value=$host_alias
+ac_cv_env_host_alias_set=${host_alias+set}
+ac_cv_env_host_alias_value=$host_alias
+ac_env_target_alias_set=${target_alias+set}
+ac_env_target_alias_value=$target_alias
+ac_cv_env_target_alias_set=${target_alias+set}
+ac_cv_env_target_alias_value=$target_alias
+ac_env_CC_set=${CC+set}
+ac_env_CC_value=$CC
+ac_cv_env_CC_set=${CC+set}
+ac_cv_env_CC_value=$CC
+ac_env_CFLAGS_set=${CFLAGS+set}
+ac_env_CFLAGS_value=$CFLAGS
+ac_cv_env_CFLAGS_set=${CFLAGS+set}
+ac_cv_env_CFLAGS_value=$CFLAGS
+ac_env_LDFLAGS_set=${LDFLAGS+set}
+ac_env_LDFLAGS_value=$LDFLAGS
+ac_cv_env_LDFLAGS_set=${LDFLAGS+set}
+ac_cv_env_LDFLAGS_value=$LDFLAGS
+ac_env_CPPFLAGS_set=${CPPFLAGS+set}
+ac_env_CPPFLAGS_value=$CPPFLAGS
+ac_cv_env_CPPFLAGS_set=${CPPFLAGS+set}
+ac_cv_env_CPPFLAGS_value=$CPPFLAGS
+ac_env_CPP_set=${CPP+set}
+ac_env_CPP_value=$CPP
+ac_cv_env_CPP_set=${CPP+set}
+ac_cv_env_CPP_value=$CPP
+
+#
+# Report the --help message.
+#
+if test "$ac_init_help" = "long"; then
+  # Omit some internal or obsolete options to make the list less imposing.
+  # This message is too long to be a string in the A/UX 3.1 sh.
+  cat <<_ACEOF
+\`configure' configures toppred 1.10 to adapt to many kinds of systems.
+
+Usage: $0 [OPTION]... [VAR=VALUE]...
+
+To assign environment variables (e.g., CC, CFLAGS...), specify them as
+VAR=VALUE.  See below for descriptions of some of the useful variables.
+
+Defaults for the options are specified in brackets.
+
+Configuration:
+  -h, --help              display this help and exit
+      --help=short        display options specific to this package
+      --help=recursive    display the short help of all the included packages
+  -V, --version           display version information and exit
+  -q, --quiet, --silent   do not print \`checking...' messages
+      --cache-file=FILE   cache test results in FILE [disabled]
+  -C, --config-cache      alias for \`--cache-file=config.cache'
+  -n, --no-create         do not create output files
+      --srcdir=DIR        find the sources in DIR [configure dir or \`..']
+
+_ACEOF
+
+  cat <<_ACEOF
+Installation directories:
+  --prefix=PREFIX         install architecture-independent files in PREFIX
+			  [$ac_default_prefix]
+  --exec-prefix=EPREFIX   install architecture-dependent files in EPREFIX
+			  [PREFIX]
+
+By default, \`make install' will install all the files in
+\`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc.  You can specify
+an installation prefix other than \`$ac_default_prefix' using \`--prefix',
+for instance \`--prefix=\$HOME'.
+
+For better control, use the options below.
+
+Fine tuning of the installation directories:
+  --bindir=DIR           user executables [EPREFIX/bin]
+  --sbindir=DIR          system admin executables [EPREFIX/sbin]
+  --libexecdir=DIR       program executables [EPREFIX/libexec]
+  --datadir=DIR          read-only architecture-independent data [PREFIX/share]
+  --sysconfdir=DIR       read-only single-machine data [PREFIX/etc]
+  --sharedstatedir=DIR   modifiable architecture-independent data [PREFIX/com]
+  --localstatedir=DIR    modifiable single-machine data [PREFIX/var]
+  --libdir=DIR           object code libraries [EPREFIX/lib]
+  --includedir=DIR       C header files [PREFIX/include]
+  --oldincludedir=DIR    C header files for non-gcc [/usr/include]
+  --infodir=DIR          info documentation [PREFIX/info]
+  --mandir=DIR           man documentation [PREFIX/man]
+_ACEOF
+
+  cat <<\_ACEOF
+
+Program names:
+  --program-prefix=PREFIX            prepend PREFIX to installed program names
+  --program-suffix=SUFFIX            append SUFFIX to installed program names
+  --program-transform-name=PROGRAM   run sed PROGRAM on installed program names
+
+System types:
+  --build=BUILD     configure for building on BUILD [guessed]
+  --host=HOST       cross-compile to build programs to run on HOST [BUILD]
+_ACEOF
+fi
+
+if test -n "$ac_init_help"; then
+  case $ac_init_help in
+     short | recursive ) echo "Configuration of toppred 1.10:";;
+   esac
+  cat <<\_ACEOF
+
+Optional Features:
+  --disable-FEATURE       do not include FEATURE (same as --enable-FEATURE=no)
+  --enable-FEATURE[=ARG]  include FEATURE [ARG=yes]
+  --disable-dependency-tracking  speeds up one-time build
+  --enable-dependency-tracking   do not reject slow dependency extractors
+
+Optional Packages:
+  --with-PACKAGE[=ARG]    use PACKAGE [ARG=yes]
+  --without-PACKAGE       do not use PACKAGE (same as --with-PACKAGE=no)
+  --with-libgd=DIR root directory path of libgd installation
+		   defaults to /usr and /usr/local
+  --without-libgd to disable libgd usage completely (not yet implemented)
+
+Some influential environment variables:
+  CC          C compiler command
+  CFLAGS      C compiler flags
+  LDFLAGS     linker flags, e.g. -L<lib dir> if you have libraries in a
+              nonstandard directory <lib dir>
+  CPPFLAGS    C/C++ preprocessor flags, e.g. -I<include dir> if you have
+              headers in a nonstandard directory <include dir>
+  CPP         C preprocessor
+
+Use these variables to override the choices made by `configure' or to help
+it to find libraries and programs with nonstandard names/locations.
+
+_ACEOF
+fi
+
+if test "$ac_init_help" = "recursive"; then
+  # If there are subdirs, report their specific --help.
+  ac_popdir=`pwd`
+  for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue
+    test -d $ac_dir || continue
+    ac_builddir=.
+
+if test "$ac_dir" != .; then
+  ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'`
+  # A "../" for each directory in $ac_dir_suffix.
+  ac_top_builddir=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,../,g'`
+else
+  ac_dir_suffix= ac_top_builddir=
+fi
+
+case $srcdir in
+  .)  # No --srcdir option.  We are building in place.
+    ac_srcdir=.
+    if test -z "$ac_top_builddir"; then
+       ac_top_srcdir=.
+    else
+       ac_top_srcdir=`echo $ac_top_builddir | sed 's,/$,,'`
+    fi ;;
+  [\\/]* | ?:[\\/]* )  # Absolute path.
+    ac_srcdir=$srcdir$ac_dir_suffix;
+    ac_top_srcdir=$srcdir ;;
+  *) # Relative path.
+    ac_srcdir=$ac_top_builddir$srcdir$ac_dir_suffix
+    ac_top_srcdir=$ac_top_builddir$srcdir ;;
+esac
+
+# Do not use `cd foo && pwd` to compute absolute paths, because
+# the directories may not exist.
+case `pwd` in
+.) ac_abs_builddir="$ac_dir";;
+*)
+  case "$ac_dir" in
+  .) ac_abs_builddir=`pwd`;;
+  [\\/]* | ?:[\\/]* ) ac_abs_builddir="$ac_dir";;
+  *) ac_abs_builddir=`pwd`/"$ac_dir";;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_top_builddir=${ac_top_builddir}.;;
+*)
+  case ${ac_top_builddir}. in
+  .) ac_abs_top_builddir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_top_builddir=${ac_top_builddir}.;;
+  *) ac_abs_top_builddir=$ac_abs_builddir/${ac_top_builddir}.;;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_srcdir=$ac_srcdir;;
+*)
+  case $ac_srcdir in
+  .) ac_abs_srcdir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_srcdir=$ac_srcdir;;
+  *) ac_abs_srcdir=$ac_abs_builddir/$ac_srcdir;;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_top_srcdir=$ac_top_srcdir;;
+*)
+  case $ac_top_srcdir in
+  .) ac_abs_top_srcdir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_top_srcdir=$ac_top_srcdir;;
+  *) ac_abs_top_srcdir=$ac_abs_builddir/$ac_top_srcdir;;
+  esac;;
+esac
+
+    cd $ac_dir
+    # Check for guested configure; otherwise get Cygnus style configure.
+    if test -f $ac_srcdir/configure.gnu; then
+      echo
+      $SHELL $ac_srcdir/configure.gnu  --help=recursive
+    elif test -f $ac_srcdir/configure; then
+      echo
+      $SHELL $ac_srcdir/configure  --help=recursive
+    elif test -f $ac_srcdir/configure.ac ||
+	   test -f $ac_srcdir/configure.in; then
+      echo
+      $ac_configure --help
+    else
+      echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2
+    fi
+    cd $ac_popdir
+  done
+fi
+
+test -n "$ac_init_help" && exit 0
+if $ac_init_version; then
+  cat <<\_ACEOF
+toppred configure 1.10
+generated by GNU Autoconf 2.59
+
+Copyright (C) 2003 Free Software Foundation, Inc.
+This configure script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it.
+_ACEOF
+  exit 0
+fi
+exec 5>config.log
+cat >&5 <<_ACEOF
+This file contains any messages produced by compilers while
+running configure, to aid debugging if configure makes a mistake.
+
+It was created by toppred $as_me 1.10, which was
+generated by GNU Autoconf 2.59.  Invocation command line was
+
+  $ $0 $@
+
+_ACEOF
+{
+cat <<_ASUNAME
+## --------- ##
+## Platform. ##
+## --------- ##
+
+hostname = `(hostname || uname -n) 2>/dev/null | sed 1q`
+uname -m = `(uname -m) 2>/dev/null || echo unknown`
+uname -r = `(uname -r) 2>/dev/null || echo unknown`
+uname -s = `(uname -s) 2>/dev/null || echo unknown`
+uname -v = `(uname -v) 2>/dev/null || echo unknown`
+
+/usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown`
+/bin/uname -X     = `(/bin/uname -X) 2>/dev/null     || echo unknown`
+
+/bin/arch              = `(/bin/arch) 2>/dev/null              || echo unknown`
+/usr/bin/arch -k       = `(/usr/bin/arch -k) 2>/dev/null       || echo unknown`
+/usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown`
+hostinfo               = `(hostinfo) 2>/dev/null               || echo unknown`
+/bin/machine           = `(/bin/machine) 2>/dev/null           || echo unknown`
+/usr/bin/oslevel       = `(/usr/bin/oslevel) 2>/dev/null       || echo unknown`
+/bin/universe          = `(/bin/universe) 2>/dev/null          || echo unknown`
+
+_ASUNAME
+
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  echo "PATH: $as_dir"
+done
+
+} >&5
+
+cat >&5 <<_ACEOF
+
+
+## ----------- ##
+## Core tests. ##
+## ----------- ##
+
+_ACEOF
+
+
+# Keep a trace of the command line.
+# Strip out --no-create and --no-recursion so they do not pile up.
+# Strip out --silent because we don't want to record it for future runs.
+# Also quote any args containing shell meta-characters.
+# Make two passes to allow for proper duplicate-argument suppression.
+ac_configure_args=
+ac_configure_args0=
+ac_configure_args1=
+ac_sep=
+ac_must_keep_next=false
+for ac_pass in 1 2
+do
+  for ac_arg
+  do
+    case $ac_arg in
+    -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;;
+    -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+    | -silent | --silent | --silen | --sile | --sil)
+      continue ;;
+    *" "*|*"	"*|*[\[\]\~\#\$\^\&\*\(\)\{\}\\\|\;\<\>\?\"\']*)
+      ac_arg=`echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;;
+    esac
+    case $ac_pass in
+    1) ac_configure_args0="$ac_configure_args0 '$ac_arg'" ;;
+    2)
+      ac_configure_args1="$ac_configure_args1 '$ac_arg'"
+      if test $ac_must_keep_next = true; then
+	ac_must_keep_next=false # Got value, back to normal.
+      else
+	case $ac_arg in
+	  *=* | --config-cache | -C | -disable-* | --disable-* \
+	  | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \
+	  | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \
+	  | -with-* | --with-* | -without-* | --without-* | --x)
+	    case "$ac_configure_args0 " in
+	      "$ac_configure_args1"*" '$ac_arg' "* ) continue ;;
+	    esac
+	    ;;
+	  -* ) ac_must_keep_next=true ;;
+	esac
+      fi
+      ac_configure_args="$ac_configure_args$ac_sep'$ac_arg'"
+      # Get rid of the leading space.
+      ac_sep=" "
+      ;;
+    esac
+  done
+done
+$as_unset ac_configure_args0 || test "${ac_configure_args0+set}" != set || { ac_configure_args0=; export ac_configure_args0; }
+$as_unset ac_configure_args1 || test "${ac_configure_args1+set}" != set || { ac_configure_args1=; export ac_configure_args1; }
+
+# When interrupted or exit'd, cleanup temporary files, and complete
+# config.log.  We remove comments because anyway the quotes in there
+# would cause problems or look ugly.
+# WARNING: Be sure not to use single quotes in there, as some shells,
+# such as our DU 5.0 friend, will then `close' the trap.
+trap 'exit_status=$?
+  # Save into config.log some information that might help in debugging.
+  {
+    echo
+
+    cat <<\_ASBOX
+## ---------------- ##
+## Cache variables. ##
+## ---------------- ##
+_ASBOX
+    echo
+    # The following way of writing the cache mishandles newlines in values,
+{
+  (set) 2>&1 |
+    case `(ac_space='"'"' '"'"'; set | grep ac_space) 2>&1` in
+    *ac_space=\ *)
+      sed -n \
+	"s/'"'"'/'"'"'\\\\'"'"''"'"'/g;
+	  s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='"'"'\\2'"'"'/p"
+      ;;
+    *)
+      sed -n \
+	"s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1=\\2/p"
+      ;;
+    esac;
+}
+    echo
+
+    cat <<\_ASBOX
+## ----------------- ##
+## Output variables. ##
+## ----------------- ##
+_ASBOX
+    echo
+    for ac_var in $ac_subst_vars
+    do
+      eval ac_val=$`echo $ac_var`
+      echo "$ac_var='"'"'$ac_val'"'"'"
+    done | sort
+    echo
+
+    if test -n "$ac_subst_files"; then
+      cat <<\_ASBOX
+## ------------- ##
+## Output files. ##
+## ------------- ##
+_ASBOX
+      echo
+      for ac_var in $ac_subst_files
+      do
+	eval ac_val=$`echo $ac_var`
+	echo "$ac_var='"'"'$ac_val'"'"'"
+      done | sort
+      echo
+    fi
+
+    if test -s confdefs.h; then
+      cat <<\_ASBOX
+## ----------- ##
+## confdefs.h. ##
+## ----------- ##
+_ASBOX
+      echo
+      sed "/^$/d" confdefs.h | sort
+      echo
+    fi
+    test "$ac_signal" != 0 &&
+      echo "$as_me: caught signal $ac_signal"
+    echo "$as_me: exit $exit_status"
+  } >&5
+  rm -f core *.core &&
+  rm -rf conftest* confdefs* conf$$* $ac_clean_files &&
+    exit $exit_status
+     ' 0
+for ac_signal in 1 2 13 15; do
+  trap 'ac_signal='$ac_signal'; { (exit 1); exit 1; }' $ac_signal
+done
+ac_signal=0
+
+# confdefs.h avoids OS command line length limits that DEFS can exceed.
+rm -rf conftest* confdefs.h
+# AIX cpp loses on an empty file, so make sure it contains at least a newline.
+echo >confdefs.h
+
+# Predefined preprocessor variables.
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_NAME "$PACKAGE_NAME"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_TARNAME "$PACKAGE_TARNAME"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_VERSION "$PACKAGE_VERSION"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_STRING "$PACKAGE_STRING"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT"
+_ACEOF
+
+
+# Let the site file select an alternate cache file if it wants to.
+# Prefer explicitly selected file to automatically selected ones.
+if test -z "$CONFIG_SITE"; then
+  if test "x$prefix" != xNONE; then
+    CONFIG_SITE="$prefix/share/config.site $prefix/etc/config.site"
+  else
+    CONFIG_SITE="$ac_default_prefix/share/config.site $ac_default_prefix/etc/config.site"
+  fi
+fi
+for ac_site_file in $CONFIG_SITE; do
+  if test -r "$ac_site_file"; then
+    { echo "$as_me:$LINENO: loading site script $ac_site_file" >&5
+echo "$as_me: loading site script $ac_site_file" >&6;}
+    sed 's/^/| /' "$ac_site_file" >&5
+    . "$ac_site_file"
+  fi
+done
+
+if test -r "$cache_file"; then
+  # Some versions of bash will fail to source /dev/null (special
+  # files actually), so we avoid doing that.
+  if test -f "$cache_file"; then
+    { echo "$as_me:$LINENO: loading cache $cache_file" >&5
+echo "$as_me: loading cache $cache_file" >&6;}
+    case $cache_file in
+      [\\/]* | ?:[\\/]* ) . $cache_file;;
+      *)                      . ./$cache_file;;
+    esac
+  fi
+else
+  { echo "$as_me:$LINENO: creating cache $cache_file" >&5
+echo "$as_me: creating cache $cache_file" >&6;}
+  >$cache_file
+fi
+
+# Check that the precious variables saved in the cache have kept the same
+# value.
+ac_cache_corrupted=false
+for ac_var in `(set) 2>&1 |
+	       sed -n 's/^ac_env_\([a-zA-Z_0-9]*\)_set=.*/\1/p'`; do
+  eval ac_old_set=\$ac_cv_env_${ac_var}_set
+  eval ac_new_set=\$ac_env_${ac_var}_set
+  eval ac_old_val="\$ac_cv_env_${ac_var}_value"
+  eval ac_new_val="\$ac_env_${ac_var}_value"
+  case $ac_old_set,$ac_new_set in
+    set,)
+      { echo "$as_me:$LINENO: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5
+echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;}
+      ac_cache_corrupted=: ;;
+    ,set)
+      { echo "$as_me:$LINENO: error: \`$ac_var' was not set in the previous run" >&5
+echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;}
+      ac_cache_corrupted=: ;;
+    ,);;
+    *)
+      if test "x$ac_old_val" != "x$ac_new_val"; then
+	{ echo "$as_me:$LINENO: error: \`$ac_var' has changed since the previous run:" >&5
+echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;}
+	{ echo "$as_me:$LINENO:   former value:  $ac_old_val" >&5
+echo "$as_me:   former value:  $ac_old_val" >&2;}
+	{ echo "$as_me:$LINENO:   current value: $ac_new_val" >&5
+echo "$as_me:   current value: $ac_new_val" >&2;}
+	ac_cache_corrupted=:
+      fi;;
+  esac
+  # Pass precious variables to config.status.
+  if test "$ac_new_set" = set; then
+    case $ac_new_val in
+    *" "*|*"	"*|*[\[\]\~\#\$\^\&\*\(\)\{\}\\\|\;\<\>\?\"\']*)
+      ac_arg=$ac_var=`echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;;
+    *) ac_arg=$ac_var=$ac_new_val ;;
+    esac
+    case " $ac_configure_args " in
+      *" '$ac_arg' "*) ;; # Avoid dups.  Use of quotes ensures accuracy.
+      *) ac_configure_args="$ac_configure_args '$ac_arg'" ;;
+    esac
+  fi
+done
+if $ac_cache_corrupted; then
+  { echo "$as_me:$LINENO: error: changes in the environment can compromise the build" >&5
+echo "$as_me: error: changes in the environment can compromise the build" >&2;}
+  { { echo "$as_me:$LINENO: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&5
+echo "$as_me: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&2;}
+   { (exit 1); exit 1; }; }
+fi
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+am__api_version="1.9"
+ac_aux_dir=
+for ac_dir in $srcdir $srcdir/.. $srcdir/../..; do
+  if test -f $ac_dir/install-sh; then
+    ac_aux_dir=$ac_dir
+    ac_install_sh="$ac_aux_dir/install-sh -c"
+    break
+  elif test -f $ac_dir/install.sh; then
+    ac_aux_dir=$ac_dir
+    ac_install_sh="$ac_aux_dir/install.sh -c"
+    break
+  elif test -f $ac_dir/shtool; then
+    ac_aux_dir=$ac_dir
+    ac_install_sh="$ac_aux_dir/shtool install -c"
+    break
+  fi
+done
+if test -z "$ac_aux_dir"; then
+  { { echo "$as_me:$LINENO: error: cannot find install-sh or install.sh in $srcdir $srcdir/.. $srcdir/../.." >&5
+echo "$as_me: error: cannot find install-sh or install.sh in $srcdir $srcdir/.. $srcdir/../.." >&2;}
+   { (exit 1); exit 1; }; }
+fi
+ac_config_guess="$SHELL $ac_aux_dir/config.guess"
+ac_config_sub="$SHELL $ac_aux_dir/config.sub"
+ac_configure="$SHELL $ac_aux_dir/configure" # This should be Cygnus configure.
+
+# Find a good install program.  We prefer a C program (faster),
+# so one script is as good as another.  But avoid the broken or
+# incompatible versions:
+# SysV /etc/install, /usr/sbin/install
+# SunOS /usr/etc/install
+# IRIX /sbin/install
+# AIX /bin/install
+# AmigaOS /C/install, which installs bootblocks on floppy discs
+# AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag
+# AFS /usr/afsws/bin/install, which mishandles nonexistent args
+# SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff"
+# OS/2's system install, which has a completely different semantic
+# ./install, which can be erroneously created by make from ./install.sh.
+echo "$as_me:$LINENO: checking for a BSD-compatible install" >&5
+echo $ECHO_N "checking for a BSD-compatible install... $ECHO_C" >&6
+if test -z "$INSTALL"; then
+if test "${ac_cv_path_install+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  # Account for people who put trailing slashes in PATH elements.
+case $as_dir/ in
+  ./ | .// | /cC/* | \
+  /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \
+  ?:\\/os2\\/install\\/* | ?:\\/OS2\\/INSTALL\\/* | \
+  /usr/ucb/* ) ;;
+  *)
+    # OSF1 and SCO ODT 3.0 have their own names for install.
+    # Don't use installbsd from OSF since it installs stuff as root
+    # by default.
+    for ac_prog in ginstall scoinst install; do
+      for ac_exec_ext in '' $ac_executable_extensions; do
+	if $as_executable_p "$as_dir/$ac_prog$ac_exec_ext"; then
+	  if test $ac_prog = install &&
+	    grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+	    # AIX install.  It has an incompatible calling convention.
+	    :
+	  elif test $ac_prog = install &&
+	    grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+	    # program-specific install script used by HP pwplus--don't use.
+	    :
+	  else
+	    ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c"
+	    break 3
+	  fi
+	fi
+      done
+    done
+    ;;
+esac
+done
+
+
+fi
+  if test "${ac_cv_path_install+set}" = set; then
+    INSTALL=$ac_cv_path_install
+  else
+    # As a last resort, use the slow shell script.  We don't cache a
+    # path for INSTALL within a source directory, because that will
+    # break other packages using the cache if that directory is
+    # removed, or if the path is relative.
+    INSTALL=$ac_install_sh
+  fi
+fi
+echo "$as_me:$LINENO: result: $INSTALL" >&5
+echo "${ECHO_T}$INSTALL" >&6
+
+# Use test -z because SunOS4 sh mishandles braces in ${var-val}.
+# It thinks the first close brace ends the variable substitution.
+test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}'
+
+test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}'
+
+test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644'
+
+echo "$as_me:$LINENO: checking whether build environment is sane" >&5
+echo $ECHO_N "checking whether build environment is sane... $ECHO_C" >&6
+# Just in case
+sleep 1
+echo timestamp > conftest.file
+# Do `set' in a subshell so we don't clobber the current shell's
+# arguments.  Must try -L first in case configure is actually a
+# symlink; some systems play weird games with the mod time of symlinks
+# (eg FreeBSD returns the mod time of the symlink's containing
+# directory).
+if (
+   set X `ls -Lt $srcdir/configure conftest.file 2> /dev/null`
+   if test "$*" = "X"; then
+      # -L didn't work.
+      set X `ls -t $srcdir/configure conftest.file`
+   fi
+   rm -f conftest.file
+   if test "$*" != "X $srcdir/configure conftest.file" \
+      && test "$*" != "X conftest.file $srcdir/configure"; then
+
+      # If neither matched, then we have a broken ls.  This can happen
+      # if, for instance, CONFIG_SHELL is bash and it inherits a
+      # broken ls alias from the environment.  This has actually
+      # happened.  Such a system could not be considered "sane".
+      { { echo "$as_me:$LINENO: error: ls -t appears to fail.  Make sure there is not a broken
+alias in your environment" >&5
+echo "$as_me: error: ls -t appears to fail.  Make sure there is not a broken
+alias in your environment" >&2;}
+   { (exit 1); exit 1; }; }
+   fi
+
+   test "$2" = conftest.file
+   )
+then
+   # Ok.
+   :
+else
+   { { echo "$as_me:$LINENO: error: newly created file is older than distributed files!
+Check your system clock" >&5
+echo "$as_me: error: newly created file is older than distributed files!
+Check your system clock" >&2;}
+   { (exit 1); exit 1; }; }
+fi
+echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6
+test "$program_prefix" != NONE &&
+  program_transform_name="s,^,$program_prefix,;$program_transform_name"
+# Use a double $ so make ignores it.
+test "$program_suffix" != NONE &&
+  program_transform_name="s,\$,$program_suffix,;$program_transform_name"
+# Double any \ or $.  echo might interpret backslashes.
+# By default was `s,x,x', remove it if useless.
+cat <<\_ACEOF >conftest.sed
+s/[\\$]/&&/g;s/;s,x,x,$//
+_ACEOF
+program_transform_name=`echo $program_transform_name | sed -f conftest.sed`
+rm conftest.sed
+
+# expand $ac_aux_dir to an absolute path
+am_aux_dir=`cd $ac_aux_dir && pwd`
+
+test x"${MISSING+set}" = xset || MISSING="\${SHELL} $am_aux_dir/missing"
+# Use eval to expand $SHELL
+if eval "$MISSING --run true"; then
+  am_missing_run="$MISSING --run "
+else
+  am_missing_run=
+  { echo "$as_me:$LINENO: WARNING: \`missing' script is too old or missing" >&5
+echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;}
+fi
+
+if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then
+  # We used to keeping the `.' as first argument, in order to
+  # allow $(mkdir_p) to be used without argument.  As in
+  #   $(mkdir_p) $(somedir)
+  # where $(somedir) is conditionally defined.  However this is wrong
+  # for two reasons:
+  #  1. if the package is installed by a user who cannot write `.'
+  #     make install will fail,
+  #  2. the above comment should most certainly read
+  #     $(mkdir_p) $(DESTDIR)$(somedir)
+  #     so it does not work when $(somedir) is undefined and
+  #     $(DESTDIR) is not.
+  #  To support the latter case, we have to write
+  #     test -z "$(somedir)" || $(mkdir_p) $(DESTDIR)$(somedir),
+  #  so the `.' trick is pointless.
+  mkdir_p='mkdir -p --'
+else
+  # On NextStep and OpenStep, the `mkdir' command does not
+  # recognize any option.  It will interpret all options as
+  # directories to create, and then abort because `.' already
+  # exists.
+  for d in ./-p ./--version;
+  do
+    test -d $d && rmdir $d
+  done
+  # $(mkinstalldirs) is defined by Automake if mkinstalldirs exists.
+  if test -f "$ac_aux_dir/mkinstalldirs"; then
+    mkdir_p='$(mkinstalldirs)'
+  else
+    mkdir_p='$(install_sh) -d'
+  fi
+fi
+
+for ac_prog in gawk mawk nawk awk
+do
+  # Extract the first word of "$ac_prog", so it can be a program name with args.
+set dummy $ac_prog; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_AWK+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$AWK"; then
+  ac_cv_prog_AWK="$AWK" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_AWK="$ac_prog"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+AWK=$ac_cv_prog_AWK
+if test -n "$AWK"; then
+  echo "$as_me:$LINENO: result: $AWK" >&5
+echo "${ECHO_T}$AWK" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+  test -n "$AWK" && break
+done
+
+echo "$as_me:$LINENO: checking whether ${MAKE-make} sets \$(MAKE)" >&5
+echo $ECHO_N "checking whether ${MAKE-make} sets \$(MAKE)... $ECHO_C" >&6
+set dummy ${MAKE-make}; ac_make=`echo "$2" | sed 'y,:./+-,___p_,'`
+if eval "test \"\${ac_cv_prog_make_${ac_make}_set+set}\" = set"; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.make <<\_ACEOF
+all:
+	@echo 'ac_maketemp="$(MAKE)"'
+_ACEOF
+# GNU make sometimes prints "make[1]: Entering...", which would confuse us.
+eval `${MAKE-make} -f conftest.make 2>/dev/null | grep temp=`
+if test -n "$ac_maketemp"; then
+  eval ac_cv_prog_make_${ac_make}_set=yes
+else
+  eval ac_cv_prog_make_${ac_make}_set=no
+fi
+rm -f conftest.make
+fi
+if eval "test \"`echo '$ac_cv_prog_make_'${ac_make}_set`\" = yes"; then
+  echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6
+  SET_MAKE=
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+  SET_MAKE="MAKE=${MAKE-make}"
+fi
+
+rm -rf .tst 2>/dev/null
+mkdir .tst 2>/dev/null
+if test -d .tst; then
+  am__leading_dot=.
+else
+  am__leading_dot=_
+fi
+rmdir .tst 2>/dev/null
+
+# test to see if srcdir already configured
+if test "`cd $srcdir && pwd`" != "`pwd`" &&
+   test -f $srcdir/config.status; then
+  { { echo "$as_me:$LINENO: error: source directory already configured; run \"make distclean\" there first" >&5
+echo "$as_me: error: source directory already configured; run \"make distclean\" there first" >&2;}
+   { (exit 1); exit 1; }; }
+fi
+
+# test whether we have cygpath
+if test -z "$CYGPATH_W"; then
+  if (cygpath --version) >/dev/null 2>/dev/null; then
+    CYGPATH_W='cygpath -w'
+  else
+    CYGPATH_W=echo
+  fi
+fi
+
+
+# Define the identity of the package.
+ PACKAGE='toppred'
+ VERSION='1.10'
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE "$PACKAGE"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define VERSION "$VERSION"
+_ACEOF
+
+# Some tools Automake needs.
+
+ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"}
+
+
+AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"}
+
+
+AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"}
+
+
+AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"}
+
+
+MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"}
+
+install_sh=${install_sh-"$am_aux_dir/install-sh"}
+
+# Installed binaries are usually stripped using `strip' when the user
+# run `make install-strip'.  However `strip' might not be the right
+# tool to use in cross-compilation environments, therefore Automake
+# will honor the `STRIP' environment variable to overrule this program.
+if test "$cross_compiling" != no; then
+  if test -n "$ac_tool_prefix"; then
+  # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args.
+set dummy ${ac_tool_prefix}strip; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_STRIP+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$STRIP"; then
+  ac_cv_prog_STRIP="$STRIP" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_STRIP="${ac_tool_prefix}strip"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+STRIP=$ac_cv_prog_STRIP
+if test -n "$STRIP"; then
+  echo "$as_me:$LINENO: result: $STRIP" >&5
+echo "${ECHO_T}$STRIP" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+fi
+if test -z "$ac_cv_prog_STRIP"; then
+  ac_ct_STRIP=$STRIP
+  # Extract the first word of "strip", so it can be a program name with args.
+set dummy strip; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_ac_ct_STRIP+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$ac_ct_STRIP"; then
+  ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_ac_ct_STRIP="strip"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+  test -z "$ac_cv_prog_ac_ct_STRIP" && ac_cv_prog_ac_ct_STRIP=":"
+fi
+fi
+ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP
+if test -n "$ac_ct_STRIP"; then
+  echo "$as_me:$LINENO: result: $ac_ct_STRIP" >&5
+echo "${ECHO_T}$ac_ct_STRIP" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+  STRIP=$ac_ct_STRIP
+else
+  STRIP="$ac_cv_prog_STRIP"
+fi
+
+fi
+INSTALL_STRIP_PROGRAM="\${SHELL} \$(install_sh) -c -s"
+
+# We need awk for the "check" target.  The system "awk" is bad on
+# some platforms.
+# Always define AMTAR for backward compatibility.
+
+AMTAR=${AMTAR-"${am_missing_run}tar"}
+
+am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'
+
+
+
+
+
+          ac_config_headers="$ac_config_headers src/config.h"
+
+
+# Checks for programs.
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+if test -n "$ac_tool_prefix"; then
+  # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args.
+set dummy ${ac_tool_prefix}gcc; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_CC+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$CC"; then
+  ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_CC="${ac_tool_prefix}gcc"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+  echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+fi
+if test -z "$ac_cv_prog_CC"; then
+  ac_ct_CC=$CC
+  # Extract the first word of "gcc", so it can be a program name with args.
+set dummy gcc; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_ac_ct_CC+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$ac_ct_CC"; then
+  ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_ac_ct_CC="gcc"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+ac_ct_CC=$ac_cv_prog_ac_ct_CC
+if test -n "$ac_ct_CC"; then
+  echo "$as_me:$LINENO: result: $ac_ct_CC" >&5
+echo "${ECHO_T}$ac_ct_CC" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+  CC=$ac_ct_CC
+else
+  CC="$ac_cv_prog_CC"
+fi
+
+if test -z "$CC"; then
+  if test -n "$ac_tool_prefix"; then
+  # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args.
+set dummy ${ac_tool_prefix}cc; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_CC+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$CC"; then
+  ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_CC="${ac_tool_prefix}cc"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+  echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+fi
+if test -z "$ac_cv_prog_CC"; then
+  ac_ct_CC=$CC
+  # Extract the first word of "cc", so it can be a program name with args.
+set dummy cc; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_ac_ct_CC+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$ac_ct_CC"; then
+  ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_ac_ct_CC="cc"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+ac_ct_CC=$ac_cv_prog_ac_ct_CC
+if test -n "$ac_ct_CC"; then
+  echo "$as_me:$LINENO: result: $ac_ct_CC" >&5
+echo "${ECHO_T}$ac_ct_CC" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+  CC=$ac_ct_CC
+else
+  CC="$ac_cv_prog_CC"
+fi
+
+fi
+if test -z "$CC"; then
+  # Extract the first word of "cc", so it can be a program name with args.
+set dummy cc; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_CC+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$CC"; then
+  ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+  ac_prog_rejected=no
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then
+       ac_prog_rejected=yes
+       continue
+     fi
+    ac_cv_prog_CC="cc"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+if test $ac_prog_rejected = yes; then
+  # We found a bogon in the path, so make sure we never use it.
+  set dummy $ac_cv_prog_CC
+  shift
+  if test $# != 0; then
+    # We chose a different compiler from the bogus one.
+    # However, it has the same basename, so the bogon will be chosen
+    # first if we set CC to just the basename; use the full file name.
+    shift
+    ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@"
+  fi
+fi
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+  echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+fi
+if test -z "$CC"; then
+  if test -n "$ac_tool_prefix"; then
+  for ac_prog in cl
+  do
+    # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args.
+set dummy $ac_tool_prefix$ac_prog; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_CC+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$CC"; then
+  ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_CC="$ac_tool_prefix$ac_prog"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+  echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+    test -n "$CC" && break
+  done
+fi
+if test -z "$CC"; then
+  ac_ct_CC=$CC
+  for ac_prog in cl
+do
+  # Extract the first word of "$ac_prog", so it can be a program name with args.
+set dummy $ac_prog; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_ac_ct_CC+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$ac_ct_CC"; then
+  ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_ac_ct_CC="$ac_prog"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+ac_ct_CC=$ac_cv_prog_ac_ct_CC
+if test -n "$ac_ct_CC"; then
+  echo "$as_me:$LINENO: result: $ac_ct_CC" >&5
+echo "${ECHO_T}$ac_ct_CC" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+  test -n "$ac_ct_CC" && break
+done
+
+  CC=$ac_ct_CC
+fi
+
+fi
+
+
+test -z "$CC" && { { echo "$as_me:$LINENO: error: no acceptable C compiler found in \$PATH
+See \`config.log' for more details." >&5
+echo "$as_me: error: no acceptable C compiler found in \$PATH
+See \`config.log' for more details." >&2;}
+   { (exit 1); exit 1; }; }
+
+# Provide some information about the compiler.
+echo "$as_me:$LINENO:" \
+     "checking for C compiler version" >&5
+ac_compiler=`set X $ac_compile; echo $2`
+{ (eval echo "$as_me:$LINENO: \"$ac_compiler --version </dev/null >&5\"") >&5
+  (eval $ac_compiler --version </dev/null >&5) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }
+{ (eval echo "$as_me:$LINENO: \"$ac_compiler -v </dev/null >&5\"") >&5
+  (eval $ac_compiler -v </dev/null >&5) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }
+{ (eval echo "$as_me:$LINENO: \"$ac_compiler -V </dev/null >&5\"") >&5
+  (eval $ac_compiler -V </dev/null >&5) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }
+
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+
+int
+main ()
+{
+
+  ;
+  return 0;
+}
+_ACEOF
+ac_clean_files_save=$ac_clean_files
+ac_clean_files="$ac_clean_files a.out a.exe b.out"
+# Try to create an executable without -o first, disregard a.out.
+# It will help us diagnose broken compilers, and finding out an intuition
+# of exeext.
+echo "$as_me:$LINENO: checking for C compiler default output file name" >&5
+echo $ECHO_N "checking for C compiler default output file name... $ECHO_C" >&6
+ac_link_default=`echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'`
+if { (eval echo "$as_me:$LINENO: \"$ac_link_default\"") >&5
+  (eval $ac_link_default) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; then
+  # Find the output, starting from the most likely.  This scheme is
+# not robust to junk in `.', hence go to wildcards (a.*) only as a last
+# resort.
+
+# Be careful to initialize this variable, since it used to be cached.
+# Otherwise an old cache value of `no' led to `EXEEXT = no' in a Makefile.
+ac_cv_exeext=
+# b.out is created by i960 compilers.
+for ac_file in a_out.exe a.exe conftest.exe a.out conftest a.* conftest.* b.out
+do
+  test -f "$ac_file" || continue
+  case $ac_file in
+    *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.o | *.obj )
+	;;
+    conftest.$ac_ext )
+	# This is the source file.
+	;;
+    [ab].out )
+	# We found the default executable, but exeext='' is most
+	# certainly right.
+	break;;
+    *.* )
+	ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'`
+	# FIXME: I believe we export ac_cv_exeext for Libtool,
+	# but it would be cool to find out if it's true.  Does anybody
+	# maintain Libtool? --akim.
+	export ac_cv_exeext
+	break;;
+    * )
+	break;;
+  esac
+done
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+{ { echo "$as_me:$LINENO: error: C compiler cannot create executables
+See \`config.log' for more details." >&5
+echo "$as_me: error: C compiler cannot create executables
+See \`config.log' for more details." >&2;}
+   { (exit 77); exit 77; }; }
+fi
+
+ac_exeext=$ac_cv_exeext
+echo "$as_me:$LINENO: result: $ac_file" >&5
+echo "${ECHO_T}$ac_file" >&6
+
+# Check the compiler produces executables we can run.  If not, either
+# the compiler is broken, or we cross compile.
+echo "$as_me:$LINENO: checking whether the C compiler works" >&5
+echo $ECHO_N "checking whether the C compiler works... $ECHO_C" >&6
+# FIXME: These cross compiler hacks should be removed for Autoconf 3.0
+# If not cross compiling, check that we can run a simple program.
+if test "$cross_compiling" != yes; then
+  if { ac_try='./$ac_file'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+    cross_compiling=no
+  else
+    if test "$cross_compiling" = maybe; then
+	cross_compiling=yes
+    else
+	{ { echo "$as_me:$LINENO: error: cannot run C compiled programs.
+If you meant to cross compile, use \`--host'.
+See \`config.log' for more details." >&5
+echo "$as_me: error: cannot run C compiled programs.
+If you meant to cross compile, use \`--host'.
+See \`config.log' for more details." >&2;}
+   { (exit 1); exit 1; }; }
+    fi
+  fi
+fi
+echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6
+
+rm -f a.out a.exe conftest$ac_cv_exeext b.out
+ac_clean_files=$ac_clean_files_save
+# Check the compiler produces executables we can run.  If not, either
+# the compiler is broken, or we cross compile.
+echo "$as_me:$LINENO: checking whether we are cross compiling" >&5
+echo $ECHO_N "checking whether we are cross compiling... $ECHO_C" >&6
+echo "$as_me:$LINENO: result: $cross_compiling" >&5
+echo "${ECHO_T}$cross_compiling" >&6
+
+echo "$as_me:$LINENO: checking for suffix of executables" >&5
+echo $ECHO_N "checking for suffix of executables... $ECHO_C" >&6
+if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5
+  (eval $ac_link) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; then
+  # If both `conftest.exe' and `conftest' are `present' (well, observable)
+# catch `conftest.exe'.  For instance with Cygwin, `ls conftest' will
+# work properly (i.e., refer to `conftest.exe'), while it won't with
+# `rm'.
+for ac_file in conftest.exe conftest conftest.*; do
+  test -f "$ac_file" || continue
+  case $ac_file in
+    *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.o | *.obj ) ;;
+    *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'`
+	  export ac_cv_exeext
+	  break;;
+    * ) break;;
+  esac
+done
+else
+  { { echo "$as_me:$LINENO: error: cannot compute suffix of executables: cannot compile and link
+See \`config.log' for more details." >&5
+echo "$as_me: error: cannot compute suffix of executables: cannot compile and link
+See \`config.log' for more details." >&2;}
+   { (exit 1); exit 1; }; }
+fi
+
+rm -f conftest$ac_cv_exeext
+echo "$as_me:$LINENO: result: $ac_cv_exeext" >&5
+echo "${ECHO_T}$ac_cv_exeext" >&6
+
+rm -f conftest.$ac_ext
+EXEEXT=$ac_cv_exeext
+ac_exeext=$EXEEXT
+echo "$as_me:$LINENO: checking for suffix of object files" >&5
+echo $ECHO_N "checking for suffix of object files... $ECHO_C" >&6
+if test "${ac_cv_objext+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+
+int
+main ()
+{
+
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.o conftest.obj
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; then
+  for ac_file in `(ls conftest.o conftest.obj; ls conftest.*) 2>/dev/null`; do
+  case $ac_file in
+    *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg ) ;;
+    *) ac_cv_objext=`expr "$ac_file" : '.*\.\(.*\)'`
+       break;;
+  esac
+done
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+{ { echo "$as_me:$LINENO: error: cannot compute suffix of object files: cannot compile
+See \`config.log' for more details." >&5
+echo "$as_me: error: cannot compute suffix of object files: cannot compile
+See \`config.log' for more details." >&2;}
+   { (exit 1); exit 1; }; }
+fi
+
+rm -f conftest.$ac_cv_objext conftest.$ac_ext
+fi
+echo "$as_me:$LINENO: result: $ac_cv_objext" >&5
+echo "${ECHO_T}$ac_cv_objext" >&6
+OBJEXT=$ac_cv_objext
+ac_objext=$OBJEXT
+echo "$as_me:$LINENO: checking whether we are using the GNU C compiler" >&5
+echo $ECHO_N "checking whether we are using the GNU C compiler... $ECHO_C" >&6
+if test "${ac_cv_c_compiler_gnu+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+
+int
+main ()
+{
+#ifndef __GNUC__
+       choke me
+#endif
+
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_compiler_gnu=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_compiler_gnu=no
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+ac_cv_c_compiler_gnu=$ac_compiler_gnu
+
+fi
+echo "$as_me:$LINENO: result: $ac_cv_c_compiler_gnu" >&5
+echo "${ECHO_T}$ac_cv_c_compiler_gnu" >&6
+GCC=`test $ac_compiler_gnu = yes && echo yes`
+ac_test_CFLAGS=${CFLAGS+set}
+ac_save_CFLAGS=$CFLAGS
+CFLAGS="-g"
+echo "$as_me:$LINENO: checking whether $CC accepts -g" >&5
+echo $ECHO_N "checking whether $CC accepts -g... $ECHO_C" >&6
+if test "${ac_cv_prog_cc_g+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+
+int
+main ()
+{
+
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_prog_cc_g=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_cv_prog_cc_g=no
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+echo "$as_me:$LINENO: result: $ac_cv_prog_cc_g" >&5
+echo "${ECHO_T}$ac_cv_prog_cc_g" >&6
+if test "$ac_test_CFLAGS" = set; then
+  CFLAGS=$ac_save_CFLAGS
+elif test $ac_cv_prog_cc_g = yes; then
+  if test "$GCC" = yes; then
+    CFLAGS="-g -O2"
+  else
+    CFLAGS="-g"
+  fi
+else
+  if test "$GCC" = yes; then
+    CFLAGS="-O2"
+  else
+    CFLAGS=
+  fi
+fi
+echo "$as_me:$LINENO: checking for $CC option to accept ANSI C" >&5
+echo $ECHO_N "checking for $CC option to accept ANSI C... $ECHO_C" >&6
+if test "${ac_cv_prog_cc_stdc+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  ac_cv_prog_cc_stdc=no
+ac_save_CC=$CC
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <stdarg.h>
+#include <stdio.h>
+#include <sys/types.h>
+#include <sys/stat.h>
+/* Most of the following tests are stolen from RCS 5.7's src/conf.sh.  */
+struct buf { int x; };
+FILE * (*rcsopen) (struct buf *, struct stat *, int);
+static char *e (p, i)
+     char **p;
+     int i;
+{
+  return p[i];
+}
+static char *f (char * (*g) (char **, int), char **p, ...)
+{
+  char *s;
+  va_list v;
+  va_start (v,p);
+  s = g (p, va_arg (v,int));
+  va_end (v);
+  return s;
+}
+
+/* OSF 4.0 Compaq cc is some sort of almost-ANSI by default.  It has
+   function prototypes and stuff, but not '\xHH' hex character constants.
+   These don't provoke an error unfortunately, instead are silently treated
+   as 'x'.  The following induces an error, until -std1 is added to get
+   proper ANSI mode.  Curiously '\x00'!='x' always comes out true, for an
+   array size at least.  It's necessary to write '\x00'==0 to get something
+   that's true only with -std1.  */
+int osf4_cc_array ['\x00' == 0 ? 1 : -1];
+
+int test (int i, double x);
+struct s1 {int (*f) (int a);};
+struct s2 {int (*f) (double a);};
+int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int);
+int argc;
+char **argv;
+int
+main ()
+{
+return f (e, argv, 0) != argv[0]  ||  f (e, argv, 1) != argv[1];
+  ;
+  return 0;
+}
+_ACEOF
+# Don't try gcc -ansi; that turns off useful extensions and
+# breaks some systems' header files.
+# AIX			-qlanglvl=ansi
+# Ultrix and OSF/1	-std1
+# HP-UX 10.20 and later	-Ae
+# HP-UX older versions	-Aa -D_HPUX_SOURCE
+# SVR4			-Xc -D__EXTENSIONS__
+for ac_arg in "" -qlanglvl=ansi -std1 -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__"
+do
+  CC="$ac_save_CC $ac_arg"
+  rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_prog_cc_stdc=$ac_arg
+break
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+fi
+rm -f conftest.err conftest.$ac_objext
+done
+rm -f conftest.$ac_ext conftest.$ac_objext
+CC=$ac_save_CC
+
+fi
+
+case "x$ac_cv_prog_cc_stdc" in
+  x|xno)
+    echo "$as_me:$LINENO: result: none needed" >&5
+echo "${ECHO_T}none needed" >&6 ;;
+  *)
+    echo "$as_me:$LINENO: result: $ac_cv_prog_cc_stdc" >&5
+echo "${ECHO_T}$ac_cv_prog_cc_stdc" >&6
+    CC="$CC $ac_cv_prog_cc_stdc" ;;
+esac
+
+# Some people use a C++ compiler to compile C.  Since we use `exit',
+# in C++ we need to declare it.  In case someone uses the same compiler
+# for both compiling C and C++ we need to have the C++ compiler decide
+# the declaration of exit, since it's the most demanding environment.
+cat >conftest.$ac_ext <<_ACEOF
+#ifndef __cplusplus
+  choke me
+#endif
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  for ac_declaration in \
+   '' \
+   'extern "C" void std::exit (int) throw (); using std::exit;' \
+   'extern "C" void std::exit (int); using std::exit;' \
+   'extern "C" void exit (int) throw ();' \
+   'extern "C" void exit (int);' \
+   'void exit (int);'
+do
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+$ac_declaration
+#include <stdlib.h>
+int
+main ()
+{
+exit (42);
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  :
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+continue
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+$ac_declaration
+int
+main ()
+{
+exit (42);
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  break
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+done
+rm -f conftest*
+if test -n "$ac_declaration"; then
+  echo '#ifdef __cplusplus' >>confdefs.h
+  echo $ac_declaration      >>confdefs.h
+  echo '#endif'             >>confdefs.h
+fi
+
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+DEPDIR="${am__leading_dot}deps"
+
+          ac_config_commands="$ac_config_commands depfiles"
+
+
+am_make=${MAKE-make}
+cat > confinc << 'END'
+am__doit:
+	@echo done
+.PHONY: am__doit
+END
+# If we don't find an include directive, just comment out the code.
+echo "$as_me:$LINENO: checking for style of include used by $am_make" >&5
+echo $ECHO_N "checking for style of include used by $am_make... $ECHO_C" >&6
+am__include="#"
+am__quote=
+_am_result=none
+# First try GNU make style include.
+echo "include confinc" > confmf
+# We grep out `Entering directory' and `Leaving directory'
+# messages which can occur if `w' ends up in MAKEFLAGS.
+# In particular we don't look at `^make:' because GNU make might
+# be invoked under some other name (usually "gmake"), in which
+# case it prints its new name instead of `make'.
+if test "`$am_make -s -f confmf 2> /dev/null | grep -v 'ing directory'`" = "done"; then
+   am__include=include
+   am__quote=
+   _am_result=GNU
+fi
+# Now try BSD make style include.
+if test "$am__include" = "#"; then
+   echo '.include "confinc"' > confmf
+   if test "`$am_make -s -f confmf 2> /dev/null`" = "done"; then
+      am__include=.include
+      am__quote="\""
+      _am_result=BSD
+   fi
+fi
+
+
+echo "$as_me:$LINENO: result: $_am_result" >&5
+echo "${ECHO_T}$_am_result" >&6
+rm -f confinc confmf
+
+# Check whether --enable-dependency-tracking or --disable-dependency-tracking was given.
+if test "${enable_dependency_tracking+set}" = set; then
+  enableval="$enable_dependency_tracking"
+
+fi;
+if test "x$enable_dependency_tracking" != xno; then
+  am_depcomp="$ac_aux_dir/depcomp"
+  AMDEPBACKSLASH='\'
+fi
+
+
+if test "x$enable_dependency_tracking" != xno; then
+  AMDEP_TRUE=
+  AMDEP_FALSE='#'
+else
+  AMDEP_TRUE='#'
+  AMDEP_FALSE=
+fi
+
+
+
+
+depcc="$CC"   am_compiler_list=
+
+echo "$as_me:$LINENO: checking dependency style of $depcc" >&5
+echo $ECHO_N "checking dependency style of $depcc... $ECHO_C" >&6
+if test "${am_cv_CC_dependencies_compiler_type+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then
+  # We make a subdir and do the tests there.  Otherwise we can end up
+  # making bogus files that we don't know about and never remove.  For
+  # instance it was reported that on HP-UX the gcc test will end up
+  # making a dummy file named `D' -- because `-MD' means `put the output
+  # in D'.
+  mkdir conftest.dir
+  # Copy depcomp to subdir because otherwise we won't find it if we're
+  # using a relative directory.
+  cp "$am_depcomp" conftest.dir
+  cd conftest.dir
+  # We will build objects and dependencies in a subdirectory because
+  # it helps to detect inapplicable dependency modes.  For instance
+  # both Tru64's cc and ICC support -MD to output dependencies as a
+  # side effect of compilation, but ICC will put the dependencies in
+  # the current directory while Tru64 will put them in the object
+  # directory.
+  mkdir sub
+
+  am_cv_CC_dependencies_compiler_type=none
+  if test "$am_compiler_list" = ""; then
+     am_compiler_list=`sed -n 's/^#*\([a-zA-Z0-9]*\))$/\1/p' < ./depcomp`
+  fi
+  for depmode in $am_compiler_list; do
+    # Setup a source with many dependencies, because some compilers
+    # like to wrap large dependency lists on column 80 (with \), and
+    # we should not choose a depcomp mode which is confused by this.
+    #
+    # We need to recreate these files for each test, as the compiler may
+    # overwrite some of them when testing with obscure command lines.
+    # This happens at least with the AIX C compiler.
+    : > sub/conftest.c
+    for i in 1 2 3 4 5 6; do
+      echo '#include "conftst'$i'.h"' >> sub/conftest.c
+      # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with
+      # Solaris 8's {/usr,}/bin/sh.
+      touch sub/conftst$i.h
+    done
+    echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf
+
+    case $depmode in
+    nosideeffect)
+      # after this tag, mechanisms are not by side-effect, so they'll
+      # only be used when explicitly requested
+      if test "x$enable_dependency_tracking" = xyes; then
+	continue
+      else
+	break
+      fi
+      ;;
+    none) break ;;
+    esac
+    # We check with `-c' and `-o' for the sake of the "dashmstdout"
+    # mode.  It turns out that the SunPro C++ compiler does not properly
+    # handle `-M -o', and we need to detect this.
+    if depmode=$depmode \
+       source=sub/conftest.c object=sub/conftest.${OBJEXT-o} \
+       depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \
+       $SHELL ./depcomp $depcc -c -o sub/conftest.${OBJEXT-o} sub/conftest.c \
+         >/dev/null 2>conftest.err &&
+       grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 &&
+       grep sub/conftest.${OBJEXT-o} sub/conftest.Po > /dev/null 2>&1 &&
+       ${MAKE-make} -s -f confmf > /dev/null 2>&1; then
+      # icc doesn't choke on unknown options, it will just issue warnings
+      # or remarks (even with -Werror).  So we grep stderr for any message
+      # that says an option was ignored or not supported.
+      # When given -MP, icc 7.0 and 7.1 complain thusly:
+      #   icc: Command line warning: ignoring option '-M'; no argument required
+      # The diagnosis changed in icc 8.0:
+      #   icc: Command line remark: option '-MP' not supported
+      if (grep 'ignoring option' conftest.err ||
+          grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else
+        am_cv_CC_dependencies_compiler_type=$depmode
+        break
+      fi
+    fi
+  done
+
+  cd ..
+  rm -rf conftest.dir
+else
+  am_cv_CC_dependencies_compiler_type=none
+fi
+
+fi
+echo "$as_me:$LINENO: result: $am_cv_CC_dependencies_compiler_type" >&5
+echo "${ECHO_T}$am_cv_CC_dependencies_compiler_type" >&6
+CCDEPMODE=depmode=$am_cv_CC_dependencies_compiler_type
+
+
+
+if
+  test "x$enable_dependency_tracking" != xno \
+  && test "$am_cv_CC_dependencies_compiler_type" = gcc3; then
+  am__fastdepCC_TRUE=
+  am__fastdepCC_FALSE='#'
+else
+  am__fastdepCC_TRUE='#'
+  am__fastdepCC_FALSE=
+fi
+
+
+# Extract the first word of "pod2man", so it can be a program name with args.
+set dummy pod2man; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_POD2MAN+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$POD2MAN"; then
+  ac_cv_prog_POD2MAN="$POD2MAN" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_POD2MAN="pod2man"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+  test -z "$ac_cv_prog_POD2MAN" && ac_cv_prog_POD2MAN=":"
+fi
+fi
+POD2MAN=$ac_cv_prog_POD2MAN
+if test -n "$POD2MAN"; then
+  echo "$as_me:$LINENO: result: $POD2MAN" >&5
+echo "${ECHO_T}$POD2MAN" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+# Extract the first word of "gnuplot", so it can be a program name with args.
+set dummy gnuplot; ac_word=$2
+echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6
+if test "${ac_cv_prog_GNUPLOT+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test -n "$GNUPLOT"; then
+  ac_cv_prog_GNUPLOT="$GNUPLOT" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for ac_exec_ext in '' $ac_executable_extensions; do
+  if $as_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+    ac_cv_prog_GNUPLOT="gnuplot"
+    echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+    break 2
+  fi
+done
+done
+
+fi
+fi
+GNUPLOT=$ac_cv_prog_GNUPLOT
+if test -n "$GNUPLOT"; then
+  echo "$as_me:$LINENO: result: $GNUPLOT" >&5
+echo "${ECHO_T}$GNUPLOT" >&6
+else
+  echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+fi
+
+if test "$GNUPLOT" = "gnuplot"; then
+
+cat >>confdefs.h <<\_ACEOF
+#define HAVE_GNUPLOT 1
+_ACEOF
+
+else
+ { echo "$as_me:$LINENO: WARNING: gnuplot not found, Hydrophobic profile will be unavailable" >&5
+echo "$as_me: WARNING: gnuplot not found, Hydrophobic profile will be unavailable" >&2;}
+fi
+
+# Checks for libraries.
+
+
+echo "$as_me:$LINENO: checking for pow in -lm" >&5
+echo $ECHO_N "checking for pow in -lm... $ECHO_C" >&6
+if test "${ac_cv_lib_m_pow+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  ac_check_lib_save_LIBS=$LIBS
+LIBS="-lm  $LIBS"
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+
+/* Override any gcc2 internal prototype to avoid an error.  */
+#ifdef __cplusplus
+extern "C"
+#endif
+/* We use char because int might match the return type of a gcc2
+   builtin and then its argument prototype would still apply.  */
+char pow ();
+int
+main ()
+{
+pow ();
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext conftest$ac_exeext
+if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5
+  (eval $ac_link) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest$ac_exeext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_lib_m_pow=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_cv_lib_m_pow=no
+fi
+rm -f conftest.err conftest.$ac_objext \
+      conftest$ac_exeext conftest.$ac_ext
+LIBS=$ac_check_lib_save_LIBS
+fi
+echo "$as_me:$LINENO: result: $ac_cv_lib_m_pow" >&5
+echo "${ECHO_T}$ac_cv_lib_m_pow" >&6
+if test $ac_cv_lib_m_pow = yes; then
+  cat >>confdefs.h <<_ACEOF
+#define HAVE_LIBM 1
+_ACEOF
+
+  LIBS="-lm $LIBS"
+
+fi
+
+
+# Checks for header files.
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+echo "$as_me:$LINENO: checking how to run the C preprocessor" >&5
+echo $ECHO_N "checking how to run the C preprocessor... $ECHO_C" >&6
+# On Suns, sometimes $CPP names a directory.
+if test -n "$CPP" && test -d "$CPP"; then
+  CPP=
+fi
+if test -z "$CPP"; then
+  if test "${ac_cv_prog_CPP+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+      # Double quotes because CPP needs to be expanded
+    for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp"
+    do
+      ac_preproc_ok=false
+for ac_c_preproc_warn_flag in '' yes
+do
+  # Use a header file that comes with gcc, so configuring glibc
+  # with a fresh cross-compiler works.
+  # Prefer <limits.h> to <assert.h> if __STDC__ is defined, since
+  # <limits.h> exists even on freestanding compilers.
+  # On the NeXT, cc -E runs the code through the compiler's parser,
+  # not just through cpp. "Syntax error" is here to catch this case.
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#ifdef __STDC__
+# include <limits.h>
+#else
+# include <assert.h>
+#endif
+		     Syntax error
+_ACEOF
+if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5
+  (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } >/dev/null; then
+  if test -s conftest.err; then
+    ac_cpp_err=$ac_c_preproc_warn_flag
+    ac_cpp_err=$ac_cpp_err$ac_c_werror_flag
+  else
+    ac_cpp_err=
+  fi
+else
+  ac_cpp_err=yes
+fi
+if test -z "$ac_cpp_err"; then
+  :
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+  # Broken: fails on valid input.
+continue
+fi
+rm -f conftest.err conftest.$ac_ext
+
+  # OK, works on sane cases.  Now check whether non-existent headers
+  # can be detected and how.
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <ac_nonexistent.h>
+_ACEOF
+if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5
+  (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } >/dev/null; then
+  if test -s conftest.err; then
+    ac_cpp_err=$ac_c_preproc_warn_flag
+    ac_cpp_err=$ac_cpp_err$ac_c_werror_flag
+  else
+    ac_cpp_err=
+  fi
+else
+  ac_cpp_err=yes
+fi
+if test -z "$ac_cpp_err"; then
+  # Broken: success on invalid input.
+continue
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+  # Passes both tests.
+ac_preproc_ok=:
+break
+fi
+rm -f conftest.err conftest.$ac_ext
+
+done
+# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped.
+rm -f conftest.err conftest.$ac_ext
+if $ac_preproc_ok; then
+  break
+fi
+
+    done
+    ac_cv_prog_CPP=$CPP
+
+fi
+  CPP=$ac_cv_prog_CPP
+else
+  ac_cv_prog_CPP=$CPP
+fi
+echo "$as_me:$LINENO: result: $CPP" >&5
+echo "${ECHO_T}$CPP" >&6
+ac_preproc_ok=false
+for ac_c_preproc_warn_flag in '' yes
+do
+  # Use a header file that comes with gcc, so configuring glibc
+  # with a fresh cross-compiler works.
+  # Prefer <limits.h> to <assert.h> if __STDC__ is defined, since
+  # <limits.h> exists even on freestanding compilers.
+  # On the NeXT, cc -E runs the code through the compiler's parser,
+  # not just through cpp. "Syntax error" is here to catch this case.
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#ifdef __STDC__
+# include <limits.h>
+#else
+# include <assert.h>
+#endif
+		     Syntax error
+_ACEOF
+if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5
+  (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } >/dev/null; then
+  if test -s conftest.err; then
+    ac_cpp_err=$ac_c_preproc_warn_flag
+    ac_cpp_err=$ac_cpp_err$ac_c_werror_flag
+  else
+    ac_cpp_err=
+  fi
+else
+  ac_cpp_err=yes
+fi
+if test -z "$ac_cpp_err"; then
+  :
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+  # Broken: fails on valid input.
+continue
+fi
+rm -f conftest.err conftest.$ac_ext
+
+  # OK, works on sane cases.  Now check whether non-existent headers
+  # can be detected and how.
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <ac_nonexistent.h>
+_ACEOF
+if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5
+  (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } >/dev/null; then
+  if test -s conftest.err; then
+    ac_cpp_err=$ac_c_preproc_warn_flag
+    ac_cpp_err=$ac_cpp_err$ac_c_werror_flag
+  else
+    ac_cpp_err=
+  fi
+else
+  ac_cpp_err=yes
+fi
+if test -z "$ac_cpp_err"; then
+  # Broken: success on invalid input.
+continue
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+  # Passes both tests.
+ac_preproc_ok=:
+break
+fi
+rm -f conftest.err conftest.$ac_ext
+
+done
+# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped.
+rm -f conftest.err conftest.$ac_ext
+if $ac_preproc_ok; then
+  :
+else
+  { { echo "$as_me:$LINENO: error: C preprocessor \"$CPP\" fails sanity check
+See \`config.log' for more details." >&5
+echo "$as_me: error: C preprocessor \"$CPP\" fails sanity check
+See \`config.log' for more details." >&2;}
+   { (exit 1); exit 1; }; }
+fi
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+
+echo "$as_me:$LINENO: checking for egrep" >&5
+echo $ECHO_N "checking for egrep... $ECHO_C" >&6
+if test "${ac_cv_prog_egrep+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if echo a | (grep -E '(a|b)') >/dev/null 2>&1
+    then ac_cv_prog_egrep='grep -E'
+    else ac_cv_prog_egrep='egrep'
+    fi
+fi
+echo "$as_me:$LINENO: result: $ac_cv_prog_egrep" >&5
+echo "${ECHO_T}$ac_cv_prog_egrep" >&6
+ EGREP=$ac_cv_prog_egrep
+
+
+echo "$as_me:$LINENO: checking for ANSI C header files" >&5
+echo $ECHO_N "checking for ANSI C header files... $ECHO_C" >&6
+if test "${ac_cv_header_stdc+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <stdlib.h>
+#include <stdarg.h>
+#include <string.h>
+#include <float.h>
+
+int
+main ()
+{
+
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_header_stdc=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_cv_header_stdc=no
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+
+if test $ac_cv_header_stdc = yes; then
+  # SunOS 4.x string.h does not declare mem*, contrary to ANSI.
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <string.h>
+
+_ACEOF
+if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
+  $EGREP "memchr" >/dev/null 2>&1; then
+  :
+else
+  ac_cv_header_stdc=no
+fi
+rm -f conftest*
+
+fi
+
+if test $ac_cv_header_stdc = yes; then
+  # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI.
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <stdlib.h>
+
+_ACEOF
+if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
+  $EGREP "free" >/dev/null 2>&1; then
+  :
+else
+  ac_cv_header_stdc=no
+fi
+rm -f conftest*
+
+fi
+
+if test $ac_cv_header_stdc = yes; then
+  # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi.
+  if test "$cross_compiling" = yes; then
+  :
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <ctype.h>
+#if ((' ' & 0x0FF) == 0x020)
+# define ISLOWER(c) ('a' <= (c) && (c) <= 'z')
+# define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c))
+#else
+# define ISLOWER(c) \
+		   (('a' <= (c) && (c) <= 'i') \
+		     || ('j' <= (c) && (c) <= 'r') \
+		     || ('s' <= (c) && (c) <= 'z'))
+# define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c))
+#endif
+
+#define XOR(e, f) (((e) && !(f)) || (!(e) && (f)))
+int
+main ()
+{
+  int i;
+  for (i = 0; i < 256; i++)
+    if (XOR (islower (i), ISLOWER (i))
+	|| toupper (i) != TOUPPER (i))
+      exit(2);
+  exit (0);
+}
+_ACEOF
+rm -f conftest$ac_exeext
+if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5
+  (eval $ac_link) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } && { ac_try='./conftest$ac_exeext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  :
+else
+  echo "$as_me: program exited with status $ac_status" >&5
+echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+( exit $ac_status )
+ac_cv_header_stdc=no
+fi
+rm -f core *.core gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext
+fi
+fi
+fi
+echo "$as_me:$LINENO: result: $ac_cv_header_stdc" >&5
+echo "${ECHO_T}$ac_cv_header_stdc" >&6
+if test $ac_cv_header_stdc = yes; then
+
+cat >>confdefs.h <<\_ACEOF
+#define STDC_HEADERS 1
+_ACEOF
+
+fi
+
+# On IRIX 5.3, sys/types and inttypes.h are conflicting.
+
+
+
+
+
+
+
+
+
+for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \
+		  inttypes.h stdint.h unistd.h
+do
+as_ac_Header=`echo "ac_cv_header_$ac_header" | $as_tr_sh`
+echo "$as_me:$LINENO: checking for $ac_header" >&5
+echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6
+if eval "test \"\${$as_ac_Header+set}\" = set"; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+$ac_includes_default
+
+#include <$ac_header>
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  eval "$as_ac_Header=yes"
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+eval "$as_ac_Header=no"
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5
+echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6
+if test `eval echo '${'$as_ac_Header'}'` = yes; then
+  cat >>confdefs.h <<_ACEOF
+#define `echo "HAVE_$ac_header" | $as_tr_cpp` 1
+_ACEOF
+
+fi
+
+done
+
+
+
+
+
+
+for ac_header in errno.h stdlib.h string.h unistd.h
+do
+as_ac_Header=`echo "ac_cv_header_$ac_header" | $as_tr_sh`
+if eval "test \"\${$as_ac_Header+set}\" = set"; then
+  echo "$as_me:$LINENO: checking for $ac_header" >&5
+echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6
+if eval "test \"\${$as_ac_Header+set}\" = set"; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+fi
+echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5
+echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6
+else
+  # Is the header compilable?
+echo "$as_me:$LINENO: checking $ac_header usability" >&5
+echo $ECHO_N "checking $ac_header usability... $ECHO_C" >&6
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+$ac_includes_default
+#include <$ac_header>
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_header_compiler=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_header_compiler=no
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+echo "$as_me:$LINENO: result: $ac_header_compiler" >&5
+echo "${ECHO_T}$ac_header_compiler" >&6
+
+# Is the header present?
+echo "$as_me:$LINENO: checking $ac_header presence" >&5
+echo $ECHO_N "checking $ac_header presence... $ECHO_C" >&6
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <$ac_header>
+_ACEOF
+if { (eval echo "$as_me:$LINENO: \"$ac_cpp conftest.$ac_ext\"") >&5
+  (eval $ac_cpp conftest.$ac_ext) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } >/dev/null; then
+  if test -s conftest.err; then
+    ac_cpp_err=$ac_c_preproc_warn_flag
+    ac_cpp_err=$ac_cpp_err$ac_c_werror_flag
+  else
+    ac_cpp_err=
+  fi
+else
+  ac_cpp_err=yes
+fi
+if test -z "$ac_cpp_err"; then
+  ac_header_preproc=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+  ac_header_preproc=no
+fi
+rm -f conftest.err conftest.$ac_ext
+echo "$as_me:$LINENO: result: $ac_header_preproc" >&5
+echo "${ECHO_T}$ac_header_preproc" >&6
+
+# So?  What about this header?
+case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in
+  yes:no: )
+    { echo "$as_me:$LINENO: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&5
+echo "$as_me: WARNING: $ac_header: accepted by the compiler, rejected by the preprocessor!" >&2;}
+    { echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the compiler's result" >&5
+echo "$as_me: WARNING: $ac_header: proceeding with the compiler's result" >&2;}
+    ac_header_preproc=yes
+    ;;
+  no:yes:* )
+    { echo "$as_me:$LINENO: WARNING: $ac_header: present but cannot be compiled" >&5
+echo "$as_me: WARNING: $ac_header: present but cannot be compiled" >&2;}
+    { echo "$as_me:$LINENO: WARNING: $ac_header:     check for missing prerequisite headers?" >&5
+echo "$as_me: WARNING: $ac_header:     check for missing prerequisite headers?" >&2;}
+    { echo "$as_me:$LINENO: WARNING: $ac_header: see the Autoconf documentation" >&5
+echo "$as_me: WARNING: $ac_header: see the Autoconf documentation" >&2;}
+    { echo "$as_me:$LINENO: WARNING: $ac_header:     section \"Present But Cannot Be Compiled\"" >&5
+echo "$as_me: WARNING: $ac_header:     section \"Present But Cannot Be Compiled\"" >&2;}
+    { echo "$as_me:$LINENO: WARNING: $ac_header: proceeding with the preprocessor's result" >&5
+echo "$as_me: WARNING: $ac_header: proceeding with the preprocessor's result" >&2;}
+    { echo "$as_me:$LINENO: WARNING: $ac_header: in the future, the compiler will take precedence" >&5
+echo "$as_me: WARNING: $ac_header: in the future, the compiler will take precedence" >&2;}
+    (
+      cat <<\_ASBOX
+## ---------------------------------- ##
+## Report this to the toppred lists.  ##
+## ---------------------------------- ##
+_ASBOX
+    ) |
+      sed "s/^/$as_me: WARNING:     /" >&2
+    ;;
+esac
+echo "$as_me:$LINENO: checking for $ac_header" >&5
+echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6
+if eval "test \"\${$as_ac_Header+set}\" = set"; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  eval "$as_ac_Header=\$ac_header_preproc"
+fi
+echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_Header'}'`" >&5
+echo "${ECHO_T}`eval echo '${'$as_ac_Header'}'`" >&6
+
+fi
+if test `eval echo '${'$as_ac_Header'}'` = yes; then
+  cat >>confdefs.h <<_ACEOF
+#define `echo "HAVE_$ac_header" | $as_tr_cpp` 1
+_ACEOF
+
+fi
+
+done
+
+
+# Checks for typedefs, structures, and compiler characteristics.
+echo "$as_me:$LINENO: checking for an ANSI C-conforming const" >&5
+echo $ECHO_N "checking for an ANSI C-conforming const... $ECHO_C" >&6
+if test "${ac_cv_c_const+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+
+int
+main ()
+{
+/* FIXME: Include the comments suggested by Paul. */
+#ifndef __cplusplus
+  /* Ultrix mips cc rejects this.  */
+  typedef int charset[2];
+  const charset x;
+  /* SunOS 4.1.1 cc rejects this.  */
+  char const *const *ccp;
+  char **p;
+  /* NEC SVR4.0.2 mips cc rejects this.  */
+  struct point {int x, y;};
+  static struct point const zero = {0,0};
+  /* AIX XL C 1.02.0.0 rejects this.
+     It does not let you subtract one const X* pointer from another in
+     an arm of an if-expression whose if-part is not a constant
+     expression */
+  const char *g = "string";
+  ccp = &g + (g ? g-g : 0);
+  /* HPUX 7.0 cc rejects these. */
+  ++ccp;
+  p = (char**) ccp;
+  ccp = (char const *const *) p;
+  { /* SCO 3.2v4 cc rejects this.  */
+    char *t;
+    char const *s = 0 ? (char *) 0 : (char const *) 0;
+
+    *t++ = 0;
+  }
+  { /* Someone thinks the Sun supposedly-ANSI compiler will reject this.  */
+    int x[] = {25, 17};
+    const int *foo = &x[0];
+    ++foo;
+  }
+  { /* Sun SC1.0 ANSI compiler rejects this -- but not the above. */
+    typedef const int *iptr;
+    iptr p = 0;
+    ++p;
+  }
+  { /* AIX XL C 1.02.0.0 rejects this saying
+       "k.c", line 2.27: 1506-025 (S) Operand must be a modifiable lvalue. */
+    struct s { int j; const int *ap[3]; };
+    struct s *b; b->j = 5;
+  }
+  { /* ULTRIX-32 V3.1 (Rev 9) vcc rejects this */
+    const int foo = 10;
+  }
+#endif
+
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_c_const=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_cv_c_const=no
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+echo "$as_me:$LINENO: result: $ac_cv_c_const" >&5
+echo "${ECHO_T}$ac_cv_c_const" >&6
+if test $ac_cv_c_const = no; then
+
+cat >>confdefs.h <<\_ACEOF
+#define const
+_ACEOF
+
+fi
+
+echo "$as_me:$LINENO: checking for size_t" >&5
+echo $ECHO_N "checking for size_t... $ECHO_C" >&6
+if test "${ac_cv_type_size_t+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+$ac_includes_default
+int
+main ()
+{
+if ((size_t *) 0)
+  return 0;
+if (sizeof (size_t))
+  return 0;
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_type_size_t=yes
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_cv_type_size_t=no
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+echo "$as_me:$LINENO: result: $ac_cv_type_size_t" >&5
+echo "${ECHO_T}$ac_cv_type_size_t" >&6
+if test $ac_cv_type_size_t = yes; then
+  :
+else
+
+cat >>confdefs.h <<_ACEOF
+#define size_t unsigned
+_ACEOF
+
+fi
+
+echo "$as_me:$LINENO: checking whether struct tm is in sys/time.h or time.h" >&5
+echo $ECHO_N "checking whether struct tm is in sys/time.h or time.h... $ECHO_C" >&6
+if test "${ac_cv_struct_tm+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include <sys/types.h>
+#include <time.h>
+
+int
+main ()
+{
+struct tm *tp; tp->tm_sec;
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_struct_tm=time.h
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ac_cv_struct_tm=sys/time.h
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+echo "$as_me:$LINENO: result: $ac_cv_struct_tm" >&5
+echo "${ECHO_T}$ac_cv_struct_tm" >&6
+if test $ac_cv_struct_tm = sys/time.h; then
+
+cat >>confdefs.h <<\_ACEOF
+#define TM_IN_SYS_TIME 1
+_ACEOF
+
+fi
+
+
+# Checks for library functions.
+# AC_FUNC_MALLOC # tru64 problem
+echo "$as_me:$LINENO: checking whether lstat dereferences a symlink specified with a trailing slash" >&5
+echo $ECHO_N "checking whether lstat dereferences a symlink specified with a trailing slash... $ECHO_C" >&6
+if test "${ac_cv_func_lstat_dereferences_slashed_symlink+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  rm -f conftest.sym conftest.file
+echo >conftest.file
+if test "$as_ln_s" = "ln -s" && ln -s conftest.file conftest.sym; then
+  if test "$cross_compiling" = yes; then
+  ac_cv_func_lstat_dereferences_slashed_symlink=no
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+$ac_includes_default
+int
+main ()
+{
+struct stat sbuf;
+     /* Linux will dereference the symlink and fail.
+	That is better in the sense that it means we will not
+	have to compile and use the lstat wrapper.  */
+     exit (lstat ("conftest.sym/", &sbuf) ? 0 : 1);
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest$ac_exeext
+if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5
+  (eval $ac_link) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } && { ac_try='./conftest$ac_exeext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_func_lstat_dereferences_slashed_symlink=yes
+else
+  echo "$as_me: program exited with status $ac_status" >&5
+echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+( exit $ac_status )
+ac_cv_func_lstat_dereferences_slashed_symlink=no
+fi
+rm -f core *.core gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext
+fi
+else
+  # If the `ln -s' command failed, then we probably don't even
+  # have an lstat function.
+  ac_cv_func_lstat_dereferences_slashed_symlink=no
+fi
+rm -f conftest.sym conftest.file
+
+fi
+echo "$as_me:$LINENO: result: $ac_cv_func_lstat_dereferences_slashed_symlink" >&5
+echo "${ECHO_T}$ac_cv_func_lstat_dereferences_slashed_symlink" >&6
+
+test $ac_cv_func_lstat_dereferences_slashed_symlink = yes &&
+
+cat >>confdefs.h <<_ACEOF
+#define LSTAT_FOLLOWS_SLASHED_SYMLINK 1
+_ACEOF
+
+
+if test $ac_cv_func_lstat_dereferences_slashed_symlink = no; then
+  case $LIBOBJS in
+    "lstat.$ac_objext"   | \
+  *" lstat.$ac_objext"   | \
+    "lstat.$ac_objext "* | \
+  *" lstat.$ac_objext "* ) ;;
+  *) LIBOBJS="$LIBOBJS lstat.$ac_objext" ;;
+esac
+
+fi
+
+echo "$as_me:$LINENO: checking whether stat accepts an empty string" >&5
+echo $ECHO_N "checking whether stat accepts an empty string... $ECHO_C" >&6
+if test "${ac_cv_func_stat_empty_string_bug+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  if test "$cross_compiling" = yes; then
+  ac_cv_func_stat_empty_string_bug=yes
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+$ac_includes_default
+int
+main ()
+{
+struct stat sbuf;
+  exit (stat ("", &sbuf) ? 1 : 0);
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest$ac_exeext
+if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5
+  (eval $ac_link) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } && { ac_try='./conftest$ac_exeext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  ac_cv_func_stat_empty_string_bug=yes
+else
+  echo "$as_me: program exited with status $ac_status" >&5
+echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+( exit $ac_status )
+ac_cv_func_stat_empty_string_bug=no
+fi
+rm -f core *.core gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext
+fi
+fi
+echo "$as_me:$LINENO: result: $ac_cv_func_stat_empty_string_bug" >&5
+echo "${ECHO_T}$ac_cv_func_stat_empty_string_bug" >&6
+if test $ac_cv_func_stat_empty_string_bug = yes; then
+  case $LIBOBJS in
+    "stat.$ac_objext"   | \
+  *" stat.$ac_objext"   | \
+    "stat.$ac_objext "* | \
+  *" stat.$ac_objext "* ) ;;
+  *) LIBOBJS="$LIBOBJS stat.$ac_objext" ;;
+esac
+
+
+cat >>confdefs.h <<_ACEOF
+#define HAVE_STAT_EMPTY_STRING_BUG 1
+_ACEOF
+
+fi
+
+
+
+
+
+
+for ac_func in pow sqrt strchr strerror strrchr
+do
+as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh`
+echo "$as_me:$LINENO: checking for $ac_func" >&5
+echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6
+if eval "test \"\${$as_ac_var+set}\" = set"; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+/* Define $ac_func to an innocuous variant, in case <limits.h> declares $ac_func.
+   For example, HP-UX 11i <limits.h> declares gettimeofday.  */
+#define $ac_func innocuous_$ac_func
+
+/* System header to define __stub macros and hopefully few prototypes,
+    which can conflict with char $ac_func (); below.
+    Prefer <limits.h> to <assert.h> if __STDC__ is defined, since
+    <limits.h> exists even on freestanding compilers.  */
+
+#ifdef __STDC__
+# include <limits.h>
+#else
+# include <assert.h>
+#endif
+
+#undef $ac_func
+
+/* Override any gcc2 internal prototype to avoid an error.  */
+#ifdef __cplusplus
+extern "C"
+{
+#endif
+/* We use char because int might match the return type of a gcc2
+   builtin and then its argument prototype would still apply.  */
+char $ac_func ();
+/* The GNU C library defines this for functions which it implements
+    to always fail with ENOSYS.  Some functions are actually named
+    something starting with __ and the normal name is an alias.  */
+#if defined (__stub_$ac_func) || defined (__stub___$ac_func)
+choke me
+#else
+char (*f) () = $ac_func;
+#endif
+#ifdef __cplusplus
+}
+#endif
+
+int
+main ()
+{
+return f != $ac_func;
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext conftest$ac_exeext
+if { (eval echo "$as_me:$LINENO: \"$ac_link\"") >&5
+  (eval $ac_link) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest$ac_exeext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  eval "$as_ac_var=yes"
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+eval "$as_ac_var=no"
+fi
+rm -f conftest.err conftest.$ac_objext \
+      conftest$ac_exeext conftest.$ac_ext
+fi
+echo "$as_me:$LINENO: result: `eval echo '${'$as_ac_var'}'`" >&5
+echo "${ECHO_T}`eval echo '${'$as_ac_var'}'`" >&6
+if test `eval echo '${'$as_ac_var'}'` = yes; then
+  cat >>confdefs.h <<_ACEOF
+#define `echo "HAVE_$ac_func" | $as_tr_cpp` 1
+_ACEOF
+
+fi
+done
+
+
+# Checks for png driver
+#
+# Handle user hints
+#
+
+ echo "$as_me:$LINENO: checking if libgd is wanted" >&5
+echo $ECHO_N "checking if libgd is wanted... $ECHO_C" >&6
+
+
+# Check whether --with-libgd or --without-libgd was given.
+if test "${with_libgd+set}" = set; then
+  withval="$with_libgd"
+
+    #
+    # Run this if -with or -without was specified
+    #
+    if test "$withval" != no ; then
+       echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6
+       LIBGD_WANTED=yes
+       if test "$withval" != yes ; then
+         LIBGD_HOME_DIR="$withval"
+       fi
+    else
+       LIBGD_WANTED=no
+       echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+    fi
+
+else
+
+   # Nothing was said I assume libgd is needed
+
+    LIBGD_WANTED=yes
+    echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6
+
+fi;
+
+
+
+# just do the job if libgd is wanted
+if test $LIBGD_WANTED = yes; then
+
+    # save the state at begining
+    _old_LDFLAGS=$LDFLAGS
+    _old_CPPFLAGS=$CPPFLAGS
+
+    # perform search in various directory.
+    echo "$as_me:$LINENO: checking for libgd with png support" >&5
+echo $ECHO_N "checking for libgd with png support... $ECHO_C" >&6
+    for _search_dir_to_inc in "$LIBGD_HOME_DIR"  /usr /usr/local ; do
+
+	LDFLAGS="$_old_LDFLAGS -L${_search_dir_to_inc}/lib"
+	CPPFLAGS="$_old_CPPFLAGS -I${_search_dir_to_inc}/include"
+
+
+	cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h.  */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h.  */
+#include "gd.h"
+int
+main ()
+{
+ gdImagePtr im;
+			 FILE *pngout;
+			 gdImagePng(im, pngout);
+
+  ;
+  return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (eval echo "$as_me:$LINENO: \"$ac_compile\"") >&5
+  (eval $ac_compile) 2>conftest.er1
+  ac_status=$?
+  grep -v '^ *+' conftest.er1 >conftest.err
+  rm -f conftest.er1
+  cat conftest.err >&5
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); } &&
+	 { ac_try='test -z "$ac_c_werror_flag"
+			 || test ! -s conftest.err'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; } &&
+	 { ac_try='test -s conftest.$ac_objext'
+  { (eval echo "$as_me:$LINENO: \"$ac_try\"") >&5
+  (eval $ac_try) 2>&5
+  ac_status=$?
+  echo "$as_me:$LINENO: \$? = $ac_status" >&5
+  (exit $ac_status); }; }; then
+  _compil_ok="yes"
+else
+  echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+fi
+rm -f conftest.err conftest.$ac_objext conftest.$ac_ext
+	if test "$_compil_ok" = yes ; then
+	    break
+	fi
+    done
+
+    # if OK, then just add the library to $LIBS,
+    # else reset to the initial state
+
+    if test "$_compil_ok" = yes ; then
+	echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6
+
+cat >>confdefs.h <<\_ACEOF
+#define HAVE_LIBGD 1
+_ACEOF
+
+	LIBS="$LIBS -lgd -lpng -lz"
+	if  test -z "$_search_dir_to_inc" ; then
+       	   LDFLAGS=$_old_LDFLAGS
+	   CPPFLAGS=$_old_CPPFLAGS
+	fi
+    else
+	echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6
+	{ echo "$as_me:$LINENO: WARNING: libgd not found, graphic topologies will be unavailable" >&5
+echo "$as_me: WARNING: libgd not found, graphic topologies will be unavailable" >&2;}
+    fi
+
+
+if test "$_compil_ok"; then
+  USE_GD_LIB_SRC_TRUE=
+  USE_GD_LIB_SRC_FALSE='#'
+else
+  USE_GD_LIB_SRC_TRUE='#'
+  USE_GD_LIB_SRC_FALSE=
+fi
+
+    # if libgd is not wanted, disable some piece of code
+    # still to implement
+    # I'm thinking about
+    # setting up a #define and check for it in the code.
+
+fi
+
+
+# Host specific stuff
+OS_CPPFLAGS=""
+# Make sure we can run config.sub.
+$ac_config_sub sun4 >/dev/null 2>&1 ||
+  { { echo "$as_me:$LINENO: error: cannot run $ac_config_sub" >&5
+echo "$as_me: error: cannot run $ac_config_sub" >&2;}
+   { (exit 1); exit 1; }; }
+
+echo "$as_me:$LINENO: checking build system type" >&5
+echo $ECHO_N "checking build system type... $ECHO_C" >&6
+if test "${ac_cv_build+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  ac_cv_build_alias=$build_alias
+test -z "$ac_cv_build_alias" &&
+  ac_cv_build_alias=`$ac_config_guess`
+test -z "$ac_cv_build_alias" &&
+  { { echo "$as_me:$LINENO: error: cannot guess build type; you must specify one" >&5
+echo "$as_me: error: cannot guess build type; you must specify one" >&2;}
+   { (exit 1); exit 1; }; }
+ac_cv_build=`$ac_config_sub $ac_cv_build_alias` ||
+  { { echo "$as_me:$LINENO: error: $ac_config_sub $ac_cv_build_alias failed" >&5
+echo "$as_me: error: $ac_config_sub $ac_cv_build_alias failed" >&2;}
+   { (exit 1); exit 1; }; }
+
+fi
+echo "$as_me:$LINENO: result: $ac_cv_build" >&5
+echo "${ECHO_T}$ac_cv_build" >&6
+build=$ac_cv_build
+build_cpu=`echo $ac_cv_build | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\1/'`
+build_vendor=`echo $ac_cv_build | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\2/'`
+build_os=`echo $ac_cv_build | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\3/'`
+
+
+echo "$as_me:$LINENO: checking host system type" >&5
+echo $ECHO_N "checking host system type... $ECHO_C" >&6
+if test "${ac_cv_host+set}" = set; then
+  echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+  ac_cv_host_alias=$host_alias
+test -z "$ac_cv_host_alias" &&
+  ac_cv_host_alias=$ac_cv_build_alias
+ac_cv_host=`$ac_config_sub $ac_cv_host_alias` ||
+  { { echo "$as_me:$LINENO: error: $ac_config_sub $ac_cv_host_alias failed" >&5
+echo "$as_me: error: $ac_config_sub $ac_cv_host_alias failed" >&2;}
+   { (exit 1); exit 1; }; }
+
+fi
+echo "$as_me:$LINENO: result: $ac_cv_host" >&5
+echo "${ECHO_T}$ac_cv_host" >&6
+host=$ac_cv_host
+host_cpu=`echo $ac_cv_host | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\1/'`
+host_vendor=`echo $ac_cv_host | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\2/'`
+host_os=`echo $ac_cv_host | sed 's/^\([^-]*\)-\([^-]*\)-\(.*\)$/\3/'`
+
+
+case $host in
+  *-*osf*)
+    OS_CPPFLAGS="-D_XOPEN_SOURCE_EXTENDED"
+    break
+esac
+
+
+                                                            ac_config_files="$ac_config_files Makefile m4/Makefile src/Makefile data/Makefile doc/Makefile test/Makefile"
+
+cat >confcache <<\_ACEOF
+# This file is a shell script that caches the results of configure
+# tests run on this system so they can be shared between configure
+# scripts and configure runs, see configure's option --config-cache.
+# It is not useful on other systems.  If it contains results you don't
+# want to keep, you may remove or edit it.
+#
+# config.status only pays attention to the cache file if you give it
+# the --recheck option to rerun configure.
+#
+# `ac_cv_env_foo' variables (set or unset) will be overridden when
+# loading this file, other *unset* `ac_cv_foo' will be assigned the
+# following values.
+
+_ACEOF
+
+# The following way of writing the cache mishandles newlines in values,
+# but we know of no workaround that is simple, portable, and efficient.
+# So, don't put newlines in cache variables' values.
+# Ultrix sh set writes to stderr and can't be redirected directly,
+# and sets the high bit in the cache file unless we assign to the vars.
+{
+  (set) 2>&1 |
+    case `(ac_space=' '; set | grep ac_space) 2>&1` in
+    *ac_space=\ *)
+      # `set' does not quote correctly, so add quotes (double-quote
+      # substitution turns \\\\ into \\, and sed turns \\ into \).
+      sed -n \
+	"s/'/'\\\\''/g;
+	  s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p"
+      ;;
+    *)
+      # `set' quotes correctly as required by POSIX, so do not add quotes.
+      sed -n \
+	"s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1=\\2/p"
+      ;;
+    esac;
+} |
+  sed '
+     t clear
+     : clear
+     s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/
+     t end
+     /^ac_cv_env/!s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/
+     : end' >>confcache
+if diff $cache_file confcache >/dev/null 2>&1; then :; else
+  if test -w $cache_file; then
+    test "x$cache_file" != "x/dev/null" && echo "updating cache $cache_file"
+    cat confcache >$cache_file
+  else
+    echo "not updating unwritable cache $cache_file"
+  fi
+fi
+rm -f confcache
+
+test "x$prefix" = xNONE && prefix=$ac_default_prefix
+# Let make expand exec_prefix.
+test "x$exec_prefix" = xNONE && exec_prefix='${prefix}'
+
+# VPATH may cause trouble with some makes, so we remove $(srcdir),
+# ${srcdir} and @srcdir@ from VPATH if srcdir is ".", strip leading and
+# trailing colons and then remove the whole line if VPATH becomes empty
+# (actually we leave an empty line to preserve line numbers).
+if test "x$srcdir" = x.; then
+  ac_vpsub='/^[	 ]*VPATH[	 ]*=/{
+s/:*\$(srcdir):*/:/;
+s/:*\${srcdir}:*/:/;
+s/:*@srcdir@:*/:/;
+s/^\([^=]*=[	 ]*\):*/\1/;
+s/:*$//;
+s/^[^=]*=[	 ]*$//;
+}'
+fi
+
+DEFS=-DHAVE_CONFIG_H
+
+ac_libobjs=
+ac_ltlibobjs=
+for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue
+  # 1. Remove the extension, and $U if already installed.
+  ac_i=`echo "$ac_i" |
+	 sed 's/\$U\././;s/\.o$//;s/\.obj$//'`
+  # 2. Add them.
+  ac_libobjs="$ac_libobjs $ac_i\$U.$ac_objext"
+  ac_ltlibobjs="$ac_ltlibobjs $ac_i"'$U.lo'
+done
+LIBOBJS=$ac_libobjs
+
+LTLIBOBJS=$ac_ltlibobjs
+
+
+if test -z "${AMDEP_TRUE}" && test -z "${AMDEP_FALSE}"; then
+  { { echo "$as_me:$LINENO: error: conditional \"AMDEP\" was never defined.
+Usually this means the macro was only invoked conditionally." >&5
+echo "$as_me: error: conditional \"AMDEP\" was never defined.
+Usually this means the macro was only invoked conditionally." >&2;}
+   { (exit 1); exit 1; }; }
+fi
+if test -z "${am__fastdepCC_TRUE}" && test -z "${am__fastdepCC_FALSE}"; then
+  { { echo "$as_me:$LINENO: error: conditional \"am__fastdepCC\" was never defined.
+Usually this means the macro was only invoked conditionally." >&5
+echo "$as_me: error: conditional \"am__fastdepCC\" was never defined.
+Usually this means the macro was only invoked conditionally." >&2;}
+   { (exit 1); exit 1; }; }
+fi
+if test -z "${USE_GD_LIB_SRC_TRUE}" && test -z "${USE_GD_LIB_SRC_FALSE}"; then
+  { { echo "$as_me:$LINENO: error: conditional \"USE_GD_LIB_SRC\" was never defined.
+Usually this means the macro was only invoked conditionally." >&5
+echo "$as_me: error: conditional \"USE_GD_LIB_SRC\" was never defined.
+Usually this means the macro was only invoked conditionally." >&2;}
+   { (exit 1); exit 1; }; }
+fi
+
+: ${CONFIG_STATUS=./config.status}
+ac_clean_files_save=$ac_clean_files
+ac_clean_files="$ac_clean_files $CONFIG_STATUS"
+{ echo "$as_me:$LINENO: creating $CONFIG_STATUS" >&5
+echo "$as_me: creating $CONFIG_STATUS" >&6;}
+cat >$CONFIG_STATUS <<_ACEOF
+#! $SHELL
+# Generated by $as_me.
+# Run this file to recreate the current configuration.
+# Compiler output produced by configure, useful for debugging
+# configure, is in config.log if it exists.
+
+debug=false
+ac_cs_recheck=false
+ac_cs_silent=false
+SHELL=\${CONFIG_SHELL-$SHELL}
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+## --------------------- ##
+## M4sh Initialization.  ##
+## --------------------- ##
+
+# Be Bourne compatible
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then
+  emulate sh
+  NULLCMD=:
+  # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which
+  # is contrary to our usage.  Disable this feature.
+  alias -g '${1+"$@"}'='"$@"'
+elif test -n "${BASH_VERSION+set}" && (set -o posix) >/dev/null 2>&1; then
+  set -o posix
+fi
+DUALCASE=1; export DUALCASE # for MKS sh
+
+# Support unset when possible.
+if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then
+  as_unset=unset
+else
+  as_unset=false
+fi
+
+
+# Work around bugs in pre-3.0 UWIN ksh.
+$as_unset ENV MAIL MAILPATH
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+for as_var in \
+  LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \
+  LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \
+  LC_TELEPHONE LC_TIME
+do
+  if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then
+    eval $as_var=C; export $as_var
+  else
+    $as_unset $as_var
+  fi
+done
+
+# Required to use basename.
+if expr a : '\(a\)' >/dev/null 2>&1; then
+  as_expr=expr
+else
+  as_expr=false
+fi
+
+if (basename /) >/dev/null 2>&1 && test "X`basename / 2>&1`" = "X/"; then
+  as_basename=basename
+else
+  as_basename=false
+fi
+
+
+# Name of the executable.
+as_me=`$as_basename "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+	 X"$0" : 'X\(//\)$' \| \
+	 X"$0" : 'X\(/\)$' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X/"$0" |
+    sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/; q; }
+  	  /^X\/\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\/\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+
+
+# PATH needs CR, and LINENO needs CR and PATH.
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+  echo "#! /bin/sh" >conf$$.sh
+  echo  "exit 0"   >>conf$$.sh
+  chmod +x conf$$.sh
+  if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then
+    PATH_SEPARATOR=';'
+  else
+    PATH_SEPARATOR=:
+  fi
+  rm -f conf$$.sh
+fi
+
+
+  as_lineno_1=$LINENO
+  as_lineno_2=$LINENO
+  as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null`
+  test "x$as_lineno_1" != "x$as_lineno_2" &&
+  test "x$as_lineno_3"  = "x$as_lineno_2"  || {
+  # Find who we are.  Look in the path if we contain no path at all
+  # relative or not.
+  case $0 in
+    *[\\/]* ) as_myself=$0 ;;
+    *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+done
+
+       ;;
+  esac
+  # We did not find ourselves, most probably we were run as `sh COMMAND'
+  # in which case we are not to be found in the path.
+  if test "x$as_myself" = x; then
+    as_myself=$0
+  fi
+  if test ! -f "$as_myself"; then
+    { { echo "$as_me:$LINENO: error: cannot find myself; rerun with an absolute path" >&5
+echo "$as_me: error: cannot find myself; rerun with an absolute path" >&2;}
+   { (exit 1); exit 1; }; }
+  fi
+  case $CONFIG_SHELL in
+  '')
+    as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH
+do
+  IFS=$as_save_IFS
+  test -z "$as_dir" && as_dir=.
+  for as_base in sh bash ksh sh5; do
+	 case $as_dir in
+	 /*)
+	   if ("$as_dir/$as_base" -c '
+  as_lineno_1=$LINENO
+  as_lineno_2=$LINENO
+  as_lineno_3=`(expr $as_lineno_1 + 1) 2>/dev/null`
+  test "x$as_lineno_1" != "x$as_lineno_2" &&
+  test "x$as_lineno_3"  = "x$as_lineno_2" ') 2>/dev/null; then
+	     $as_unset BASH_ENV || test "${BASH_ENV+set}" != set || { BASH_ENV=; export BASH_ENV; }
+	     $as_unset ENV || test "${ENV+set}" != set || { ENV=; export ENV; }
+	     CONFIG_SHELL=$as_dir/$as_base
+	     export CONFIG_SHELL
+	     exec "$CONFIG_SHELL" "$0" ${1+"$@"}
+	   fi;;
+	 esac
+       done
+done
+;;
+  esac
+
+  # Create $as_me.lineno as a copy of $as_myself, but with $LINENO
+  # uniformly replaced by the line number.  The first 'sed' inserts a
+  # line-number line before each line; the second 'sed' does the real
+  # work.  The second script uses 'N' to pair each line-number line
+  # with the numbered line, and appends trailing '-' during
+  # substitution so that $LINENO is not a special case at line end.
+  # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the
+  # second 'sed' script.  Blame Lee E. McMahon for sed's syntax.  :-)
+  sed '=' <$as_myself |
+    sed '
+      N
+      s,$,-,
+      : loop
+      s,^\(['$as_cr_digits']*\)\(.*\)[$]LINENO\([^'$as_cr_alnum'_]\),\1\2\1\3,
+      t loop
+      s,-$,,
+      s,^['$as_cr_digits']*\n,,
+    ' >$as_me.lineno &&
+  chmod +x $as_me.lineno ||
+    { { echo "$as_me:$LINENO: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&5
+echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2;}
+   { (exit 1); exit 1; }; }
+
+  # Don't try to exec as it changes $[0], causing all sort of problems
+  # (the dirname of $[0] is not the place where we might find the
+  # original and so on.  Autoconf is especially sensible to this).
+  . ./$as_me.lineno
+  # Exit status is that of the last command.
+  exit
+}
+
+
+case `echo "testing\c"; echo 1,2,3`,`echo -n testing; echo 1,2,3` in
+  *c*,-n*) ECHO_N= ECHO_C='
+' ECHO_T='	' ;;
+  *c*,*  ) ECHO_N=-n ECHO_C= ECHO_T= ;;
+  *)       ECHO_N= ECHO_C='\c' ECHO_T= ;;
+esac
+
+if expr a : '\(a\)' >/dev/null 2>&1; then
+  as_expr=expr
+else
+  as_expr=false
+fi
+
+rm -f conf$$ conf$$.exe conf$$.file
+echo >conf$$.file
+if ln -s conf$$.file conf$$ 2>/dev/null; then
+  # We could just check for DJGPP; but this test a) works b) is more generic
+  # and c) will remain valid once DJGPP supports symlinks (DJGPP 2.04).
+  if test -f conf$$.exe; then
+    # Don't use ln at all; we don't have any links
+    as_ln_s='cp -p'
+  else
+    as_ln_s='ln -s'
+  fi
+elif ln conf$$.file conf$$ 2>/dev/null; then
+  as_ln_s=ln
+else
+  as_ln_s='cp -p'
+fi
+rm -f conf$$ conf$$.exe conf$$.file
+
+if mkdir -p . 2>/dev/null; then
+  as_mkdir_p=:
+else
+  test -d ./-p && rmdir ./-p
+  as_mkdir_p=false
+fi
+
+as_executable_p="test -f"
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+# IFS
+# We need space, tab and new line, in precisely that order.
+as_nl='
+'
+IFS=" 	$as_nl"
+
+# CDPATH.
+$as_unset CDPATH
+
+exec 6>&1
+
+# Open the log real soon, to keep \$[0] and so on meaningful, and to
+# report actual input values of CONFIG_FILES etc. instead of their
+# values after options handling.  Logging --version etc. is OK.
+exec 5>>config.log
+{
+  echo
+  sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX
+## Running $as_me. ##
+_ASBOX
+} >&5
+cat >&5 <<_CSEOF
+
+This file was extended by toppred $as_me 1.10, which was
+generated by GNU Autoconf 2.59.  Invocation command line was
+
+  CONFIG_FILES    = $CONFIG_FILES
+  CONFIG_HEADERS  = $CONFIG_HEADERS
+  CONFIG_LINKS    = $CONFIG_LINKS
+  CONFIG_COMMANDS = $CONFIG_COMMANDS
+  $ $0 $@
+
+_CSEOF
+echo "on `(hostname || uname -n) 2>/dev/null | sed 1q`" >&5
+echo >&5
+_ACEOF
+
+# Files that config.status was made for.
+if test -n "$ac_config_files"; then
+  echo "config_files=\"$ac_config_files\"" >>$CONFIG_STATUS
+fi
+
+if test -n "$ac_config_headers"; then
+  echo "config_headers=\"$ac_config_headers\"" >>$CONFIG_STATUS
+fi
+
+if test -n "$ac_config_links"; then
+  echo "config_links=\"$ac_config_links\"" >>$CONFIG_STATUS
+fi
+
+if test -n "$ac_config_commands"; then
+  echo "config_commands=\"$ac_config_commands\"" >>$CONFIG_STATUS
+fi
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+
+ac_cs_usage="\
+\`$as_me' instantiates files from templates according to the
+current configuration.
+
+Usage: $0 [OPTIONS] [FILE]...
+
+  -h, --help       print this help, then exit
+  -V, --version    print version number, then exit
+  -q, --quiet      do not print progress messages
+  -d, --debug      don't remove temporary files
+      --recheck    update $as_me by reconfiguring in the same conditions
+  --file=FILE[:TEMPLATE]
+		   instantiate the configuration file FILE
+  --header=FILE[:TEMPLATE]
+		   instantiate the configuration header FILE
+
+Configuration files:
+$config_files
+
+Configuration headers:
+$config_headers
+
+Configuration commands:
+$config_commands
+
+Report bugs to <bug-autoconf at gnu.org>."
+_ACEOF
+
+cat >>$CONFIG_STATUS <<_ACEOF
+ac_cs_version="\\
+toppred config.status 1.10
+configured by $0, generated by GNU Autoconf 2.59,
+  with options \\"`echo "$ac_configure_args" | sed 's/[\\""\`\$]/\\\\&/g'`\\"
+
+Copyright (C) 2003 Free Software Foundation, Inc.
+This config.status script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it."
+srcdir=$srcdir
+INSTALL="$INSTALL"
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+# If no file are specified by the user, then we need to provide default
+# value.  By we need to know if files were specified by the user.
+ac_need_defaults=:
+while test $# != 0
+do
+  case $1 in
+  --*=*)
+    ac_option=`expr "x$1" : 'x\([^=]*\)='`
+    ac_optarg=`expr "x$1" : 'x[^=]*=\(.*\)'`
+    ac_shift=:
+    ;;
+  -*)
+    ac_option=$1
+    ac_optarg=$2
+    ac_shift=shift
+    ;;
+  *) # This is not an option, so the user has probably given explicit
+     # arguments.
+     ac_option=$1
+     ac_need_defaults=false;;
+  esac
+
+  case $ac_option in
+  # Handling of the options.
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF
+  -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r)
+    ac_cs_recheck=: ;;
+  --version | --vers* | -V )
+    echo "$ac_cs_version"; exit 0 ;;
+  --he | --h)
+    # Conflict between --help and --header
+    { { echo "$as_me:$LINENO: error: ambiguous option: $1
+Try \`$0 --help' for more information." >&5
+echo "$as_me: error: ambiguous option: $1
+Try \`$0 --help' for more information." >&2;}
+   { (exit 1); exit 1; }; };;
+  --help | --hel | -h )
+    echo "$ac_cs_usage"; exit 0 ;;
+  --debug | --d* | -d )
+    debug=: ;;
+  --file | --fil | --fi | --f )
+    $ac_shift
+    CONFIG_FILES="$CONFIG_FILES $ac_optarg"
+    ac_need_defaults=false;;
+  --header | --heade | --head | --hea )
+    $ac_shift
+    CONFIG_HEADERS="$CONFIG_HEADERS $ac_optarg"
+    ac_need_defaults=false;;
+  -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+  | -silent | --silent | --silen | --sile | --sil | --si | --s)
+    ac_cs_silent=: ;;
+
+  # This is an error.
+  -*) { { echo "$as_me:$LINENO: error: unrecognized option: $1
+Try \`$0 --help' for more information." >&5
+echo "$as_me: error: unrecognized option: $1
+Try \`$0 --help' for more information." >&2;}
+   { (exit 1); exit 1; }; } ;;
+
+  *) ac_config_targets="$ac_config_targets $1" ;;
+
+  esac
+  shift
+done
+
+ac_configure_extra_args=
+
+if $ac_cs_silent; then
+  exec 6>/dev/null
+  ac_configure_extra_args="$ac_configure_extra_args --silent"
+fi
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF
+if \$ac_cs_recheck; then
+  echo "running $SHELL $0 " $ac_configure_args \$ac_configure_extra_args " --no-create --no-recursion" >&6
+  exec $SHELL $0 $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion
+fi
+
+_ACEOF
+
+cat >>$CONFIG_STATUS <<_ACEOF
+#
+# INIT-COMMANDS section.
+#
+
+AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir"
+
+_ACEOF
+
+
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+for ac_config_target in $ac_config_targets
+do
+  case "$ac_config_target" in
+  # Handling of arguments.
+  "Makefile" ) CONFIG_FILES="$CONFIG_FILES Makefile" ;;
+  "m4/Makefile" ) CONFIG_FILES="$CONFIG_FILES m4/Makefile" ;;
+  "src/Makefile" ) CONFIG_FILES="$CONFIG_FILES src/Makefile" ;;
+  "data/Makefile" ) CONFIG_FILES="$CONFIG_FILES data/Makefile" ;;
+  "doc/Makefile" ) CONFIG_FILES="$CONFIG_FILES doc/Makefile" ;;
+  "test/Makefile" ) CONFIG_FILES="$CONFIG_FILES test/Makefile" ;;
+  "depfiles" ) CONFIG_COMMANDS="$CONFIG_COMMANDS depfiles" ;;
+  "src/config.h" ) CONFIG_HEADERS="$CONFIG_HEADERS src/config.h" ;;
+  *) { { echo "$as_me:$LINENO: error: invalid argument: $ac_config_target" >&5
+echo "$as_me: error: invalid argument: $ac_config_target" >&2;}
+   { (exit 1); exit 1; }; };;
+  esac
+done
+
+# If the user did not use the arguments to specify the items to instantiate,
+# then the envvar interface is used.  Set only those that are not.
+# We use the long form for the default assignment because of an extremely
+# bizarre bug on SunOS 4.1.3.
+if $ac_need_defaults; then
+  test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files
+  test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers
+  test "${CONFIG_COMMANDS+set}" = set || CONFIG_COMMANDS=$config_commands
+fi
+
+# Have a temporary directory for convenience.  Make it in the build tree
+# simply because there is no reason to put it here, and in addition,
+# creating and moving files from /tmp can sometimes cause problems.
+# Create a temporary directory, and hook for its removal unless debugging.
+$debug ||
+{
+  trap 'exit_status=$?; rm -rf $tmp && exit $exit_status' 0
+  trap '{ (exit 1); exit 1; }' 1 2 13 15
+}
+
+# Create a (secure) tmp directory for tmp files.
+
+{
+  tmp=`(umask 077 && mktemp -d -q "./confstatXXXXXX") 2>/dev/null` &&
+  test -n "$tmp" && test -d "$tmp"
+}  ||
+{
+  tmp=./confstat$$-$RANDOM
+  (umask 077 && mkdir $tmp)
+} ||
+{
+   echo "$me: cannot create a temporary directory in ." >&2
+   { (exit 1); exit 1; }
+}
+
+_ACEOF
+
+cat >>$CONFIG_STATUS <<_ACEOF
+
+#
+# CONFIG_FILES section.
+#
+
+# No need to generate the scripts if there are no CONFIG_FILES.
+# This happens for instance when ./config.status config.h
+if test -n "\$CONFIG_FILES"; then
+  # Protect against being on the right side of a sed subst in config.status.
+  sed 's/,@/@@/; s/@,/@@/; s/,;t t\$/@;t t/; /@;t t\$/s/[\\\\&,]/\\\\&/g;
+   s/@@/,@/; s/@@/@,/; s/@;t t\$/,;t t/' >\$tmp/subs.sed <<\\CEOF
+s, at SHELL@,$SHELL,;t t
+s, at PATH_SEPARATOR@,$PATH_SEPARATOR,;t t
+s, at PACKAGE_NAME@,$PACKAGE_NAME,;t t
+s, at PACKAGE_TARNAME@,$PACKAGE_TARNAME,;t t
+s, at PACKAGE_VERSION@,$PACKAGE_VERSION,;t t
+s, at PACKAGE_STRING@,$PACKAGE_STRING,;t t
+s, at PACKAGE_BUGREPORT@,$PACKAGE_BUGREPORT,;t t
+s, at exec_prefix@,$exec_prefix,;t t
+s, at prefix@,$prefix,;t t
+s, at program_transform_name@,$program_transform_name,;t t
+s, at bindir@,$bindir,;t t
+s, at sbindir@,$sbindir,;t t
+s, at libexecdir@,$libexecdir,;t t
+s, at datadir@,$datadir,;t t
+s, at sysconfdir@,$sysconfdir,;t t
+s, at sharedstatedir@,$sharedstatedir,;t t
+s, at localstatedir@,$localstatedir,;t t
+s, at libdir@,$libdir,;t t
+s, at includedir@,$includedir,;t t
+s, at oldincludedir@,$oldincludedir,;t t
+s, at infodir@,$infodir,;t t
+s, at mandir@,$mandir,;t t
+s, at build_alias@,$build_alias,;t t
+s, at host_alias@,$host_alias,;t t
+s, at target_alias@,$target_alias,;t t
+s, at DEFS@,$DEFS,;t t
+s, at ECHO_C@,$ECHO_C,;t t
+s, at ECHO_N@,$ECHO_N,;t t
+s, at ECHO_T@,$ECHO_T,;t t
+s, at LIBS@,$LIBS,;t t
+s, at INSTALL_PROGRAM@,$INSTALL_PROGRAM,;t t
+s, at INSTALL_SCRIPT@,$INSTALL_SCRIPT,;t t
+s, at INSTALL_DATA@,$INSTALL_DATA,;t t
+s, at CYGPATH_W@,$CYGPATH_W,;t t
+s, at PACKAGE@,$PACKAGE,;t t
+s, at VERSION@,$VERSION,;t t
+s, at ACLOCAL@,$ACLOCAL,;t t
+s, at AUTOCONF@,$AUTOCONF,;t t
+s, at AUTOMAKE@,$AUTOMAKE,;t t
+s, at AUTOHEADER@,$AUTOHEADER,;t t
+s, at MAKEINFO@,$MAKEINFO,;t t
+s, at install_sh@,$install_sh,;t t
+s, at STRIP@,$STRIP,;t t
+s, at ac_ct_STRIP@,$ac_ct_STRIP,;t t
+s, at INSTALL_STRIP_PROGRAM@,$INSTALL_STRIP_PROGRAM,;t t
+s, at mkdir_p@,$mkdir_p,;t t
+s, at AWK@,$AWK,;t t
+s, at SET_MAKE@,$SET_MAKE,;t t
+s, at am__leading_dot@,$am__leading_dot,;t t
+s, at AMTAR@,$AMTAR,;t t
+s, at am__tar@,$am__tar,;t t
+s, at am__untar@,$am__untar,;t t
+s, at CC@,$CC,;t t
+s, at CFLAGS@,$CFLAGS,;t t
+s, at LDFLAGS@,$LDFLAGS,;t t
+s, at CPPFLAGS@,$CPPFLAGS,;t t
+s, at ac_ct_CC@,$ac_ct_CC,;t t
+s, at EXEEXT@,$EXEEXT,;t t
+s, at OBJEXT@,$OBJEXT,;t t
+s, at DEPDIR@,$DEPDIR,;t t
+s, at am__include@,$am__include,;t t
+s, at am__quote@,$am__quote,;t t
+s, at AMDEP_TRUE@,$AMDEP_TRUE,;t t
+s, at AMDEP_FALSE@,$AMDEP_FALSE,;t t
+s, at AMDEPBACKSLASH@,$AMDEPBACKSLASH,;t t
+s, at CCDEPMODE@,$CCDEPMODE,;t t
+s, at am__fastdepCC_TRUE@,$am__fastdepCC_TRUE,;t t
+s, at am__fastdepCC_FALSE@,$am__fastdepCC_FALSE,;t t
+s, at POD2MAN@,$POD2MAN,;t t
+s, at GNUPLOT@,$GNUPLOT,;t t
+s, at CPP@,$CPP,;t t
+s, at EGREP@,$EGREP,;t t
+s, at LIBOBJS@,$LIBOBJS,;t t
+s, at USE_GD_LIB_SRC_TRUE@,$USE_GD_LIB_SRC_TRUE,;t t
+s, at USE_GD_LIB_SRC_FALSE@,$USE_GD_LIB_SRC_FALSE,;t t
+s, at build@,$build,;t t
+s, at build_cpu@,$build_cpu,;t t
+s, at build_vendor@,$build_vendor,;t t
+s, at build_os@,$build_os,;t t
+s, at host@,$host,;t t
+s, at host_cpu@,$host_cpu,;t t
+s, at host_vendor@,$host_vendor,;t t
+s, at host_os@,$host_os,;t t
+s, at OS_CPPFLAGS@,$OS_CPPFLAGS,;t t
+s, at LTLIBOBJS@,$LTLIBOBJS,;t t
+CEOF
+
+_ACEOF
+
+  cat >>$CONFIG_STATUS <<\_ACEOF
+  # Split the substitutions into bite-sized pieces for seds with
+  # small command number limits, like on Digital OSF/1 and HP-UX.
+  ac_max_sed_lines=48
+  ac_sed_frag=1 # Number of current file.
+  ac_beg=1 # First line for current file.
+  ac_end=$ac_max_sed_lines # Line after last line for current file.
+  ac_more_lines=:
+  ac_sed_cmds=
+  while $ac_more_lines; do
+    if test $ac_beg -gt 1; then
+      sed "1,${ac_beg}d; ${ac_end}q" $tmp/subs.sed >$tmp/subs.frag
+    else
+      sed "${ac_end}q" $tmp/subs.sed >$tmp/subs.frag
+    fi
+    if test ! -s $tmp/subs.frag; then
+      ac_more_lines=false
+    else
+      # The purpose of the label and of the branching condition is to
+      # speed up the sed processing (if there are no `@' at all, there
+      # is no need to browse any of the substitutions).
+      # These are the two extra sed commands mentioned above.
+      (echo ':t
+  /@[a-zA-Z_][a-zA-Z_0-9]*@/!b' && cat $tmp/subs.frag) >$tmp/subs-$ac_sed_frag.sed
+      if test -z "$ac_sed_cmds"; then
+	ac_sed_cmds="sed -f $tmp/subs-$ac_sed_frag.sed"
+      else
+	ac_sed_cmds="$ac_sed_cmds | sed -f $tmp/subs-$ac_sed_frag.sed"
+      fi
+      ac_sed_frag=`expr $ac_sed_frag + 1`
+      ac_beg=$ac_end
+      ac_end=`expr $ac_end + $ac_max_sed_lines`
+    fi
+  done
+  if test -z "$ac_sed_cmds"; then
+    ac_sed_cmds=cat
+  fi
+fi # test -n "$CONFIG_FILES"
+
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF
+for ac_file in : $CONFIG_FILES; do test "x$ac_file" = x: && continue
+  # Support "outfile[:infile[:infile...]]", defaulting infile="outfile.in".
+  case $ac_file in
+  - | *:- | *:-:* ) # input from stdin
+	cat >$tmp/stdin
+	ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'`
+	ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;;
+  *:* ) ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'`
+	ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;;
+  * )   ac_file_in=$ac_file.in ;;
+  esac
+
+  # Compute @srcdir@, @top_srcdir@, and @INSTALL@ for subdirectories.
+  ac_dir=`(dirname "$ac_file") 2>/dev/null ||
+$as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$ac_file" : 'X\(//\)[^/]' \| \
+	 X"$ac_file" : 'X\(//\)$' \| \
+	 X"$ac_file" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$ac_file" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+  { if $as_mkdir_p; then
+    mkdir -p "$ac_dir"
+  else
+    as_dir="$ac_dir"
+    as_dirs=
+    while test ! -d "$as_dir"; do
+      as_dirs="$as_dir $as_dirs"
+      as_dir=`(dirname "$as_dir") 2>/dev/null ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$as_dir" : 'X\(//\)[^/]' \| \
+	 X"$as_dir" : 'X\(//\)$' \| \
+	 X"$as_dir" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$as_dir" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+    done
+    test ! -n "$as_dirs" || mkdir $as_dirs
+  fi || { { echo "$as_me:$LINENO: error: cannot create directory \"$ac_dir\"" >&5
+echo "$as_me: error: cannot create directory \"$ac_dir\"" >&2;}
+   { (exit 1); exit 1; }; }; }
+
+  ac_builddir=.
+
+if test "$ac_dir" != .; then
+  ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'`
+  # A "../" for each directory in $ac_dir_suffix.
+  ac_top_builddir=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,../,g'`
+else
+  ac_dir_suffix= ac_top_builddir=
+fi
+
+case $srcdir in
+  .)  # No --srcdir option.  We are building in place.
+    ac_srcdir=.
+    if test -z "$ac_top_builddir"; then
+       ac_top_srcdir=.
+    else
+       ac_top_srcdir=`echo $ac_top_builddir | sed 's,/$,,'`
+    fi ;;
+  [\\/]* | ?:[\\/]* )  # Absolute path.
+    ac_srcdir=$srcdir$ac_dir_suffix;
+    ac_top_srcdir=$srcdir ;;
+  *) # Relative path.
+    ac_srcdir=$ac_top_builddir$srcdir$ac_dir_suffix
+    ac_top_srcdir=$ac_top_builddir$srcdir ;;
+esac
+
+# Do not use `cd foo && pwd` to compute absolute paths, because
+# the directories may not exist.
+case `pwd` in
+.) ac_abs_builddir="$ac_dir";;
+*)
+  case "$ac_dir" in
+  .) ac_abs_builddir=`pwd`;;
+  [\\/]* | ?:[\\/]* ) ac_abs_builddir="$ac_dir";;
+  *) ac_abs_builddir=`pwd`/"$ac_dir";;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_top_builddir=${ac_top_builddir}.;;
+*)
+  case ${ac_top_builddir}. in
+  .) ac_abs_top_builddir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_top_builddir=${ac_top_builddir}.;;
+  *) ac_abs_top_builddir=$ac_abs_builddir/${ac_top_builddir}.;;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_srcdir=$ac_srcdir;;
+*)
+  case $ac_srcdir in
+  .) ac_abs_srcdir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_srcdir=$ac_srcdir;;
+  *) ac_abs_srcdir=$ac_abs_builddir/$ac_srcdir;;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_top_srcdir=$ac_top_srcdir;;
+*)
+  case $ac_top_srcdir in
+  .) ac_abs_top_srcdir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_top_srcdir=$ac_top_srcdir;;
+  *) ac_abs_top_srcdir=$ac_abs_builddir/$ac_top_srcdir;;
+  esac;;
+esac
+
+
+  case $INSTALL in
+  [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;;
+  *) ac_INSTALL=$ac_top_builddir$INSTALL ;;
+  esac
+
+  if test x"$ac_file" != x-; then
+    { echo "$as_me:$LINENO: creating $ac_file" >&5
+echo "$as_me: creating $ac_file" >&6;}
+    rm -f "$ac_file"
+  fi
+  # Let's still pretend it is `configure' which instantiates (i.e., don't
+  # use $as_me), people would be surprised to read:
+  #    /* config.h.  Generated by config.status.  */
+  if test x"$ac_file" = x-; then
+    configure_input=
+  else
+    configure_input="$ac_file.  "
+  fi
+  configure_input=$configure_input"Generated from `echo $ac_file_in |
+				     sed 's,.*/,,'` by configure."
+
+  # First look for the input files in the build tree, otherwise in the
+  # src tree.
+  ac_file_inputs=`IFS=:
+    for f in $ac_file_in; do
+      case $f in
+      -) echo $tmp/stdin ;;
+      [\\/$]*)
+	 # Absolute (can't be DOS-style, as IFS=:)
+	 test -f "$f" || { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5
+echo "$as_me: error: cannot find input file: $f" >&2;}
+   { (exit 1); exit 1; }; }
+	 echo "$f";;
+      *) # Relative
+	 if test -f "$f"; then
+	   # Build tree
+	   echo "$f"
+	 elif test -f "$srcdir/$f"; then
+	   # Source tree
+	   echo "$srcdir/$f"
+	 else
+	   # /dev/null tree
+	   { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5
+echo "$as_me: error: cannot find input file: $f" >&2;}
+   { (exit 1); exit 1; }; }
+	 fi;;
+      esac
+    done` || { (exit 1); exit 1; }
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF
+  sed "$ac_vpsub
+$extrasub
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF
+:t
+/@[a-zA-Z_][a-zA-Z_0-9]*@/!b
+s, at configure_input@,$configure_input,;t t
+s, at srcdir@,$ac_srcdir,;t t
+s, at abs_srcdir@,$ac_abs_srcdir,;t t
+s, at top_srcdir@,$ac_top_srcdir,;t t
+s, at abs_top_srcdir@,$ac_abs_top_srcdir,;t t
+s, at builddir@,$ac_builddir,;t t
+s, at abs_builddir@,$ac_abs_builddir,;t t
+s, at top_builddir@,$ac_top_builddir,;t t
+s, at abs_top_builddir@,$ac_abs_top_builddir,;t t
+s, at INSTALL@,$ac_INSTALL,;t t
+" $ac_file_inputs | (eval "$ac_sed_cmds") >$tmp/out
+  rm -f $tmp/stdin
+  if test x"$ac_file" != x-; then
+    mv $tmp/out $ac_file
+  else
+    cat $tmp/out
+    rm -f $tmp/out
+  fi
+
+done
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF
+
+#
+# CONFIG_HEADER section.
+#
+
+# These sed commands are passed to sed as "A NAME B NAME C VALUE D", where
+# NAME is the cpp macro being defined and VALUE is the value it is being given.
+#
+# ac_d sets the value in "#define NAME VALUE" lines.
+ac_dA='s,^\([	 ]*\)#\([	 ]*define[	 ][	 ]*\)'
+ac_dB='[	 ].*$,\1#\2'
+ac_dC=' '
+ac_dD=',;t'
+# ac_u turns "#undef NAME" without trailing blanks into "#define NAME VALUE".
+ac_uA='s,^\([	 ]*\)#\([	 ]*\)undef\([	 ][	 ]*\)'
+ac_uB='$,\1#\2define\3'
+ac_uC=' '
+ac_uD=',;t'
+
+for ac_file in : $CONFIG_HEADERS; do test "x$ac_file" = x: && continue
+  # Support "outfile[:infile[:infile...]]", defaulting infile="outfile.in".
+  case $ac_file in
+  - | *:- | *:-:* ) # input from stdin
+	cat >$tmp/stdin
+	ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'`
+	ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;;
+  *:* ) ac_file_in=`echo "$ac_file" | sed 's,[^:]*:,,'`
+	ac_file=`echo "$ac_file" | sed 's,:.*,,'` ;;
+  * )   ac_file_in=$ac_file.in ;;
+  esac
+
+  test x"$ac_file" != x- && { echo "$as_me:$LINENO: creating $ac_file" >&5
+echo "$as_me: creating $ac_file" >&6;}
+
+  # First look for the input files in the build tree, otherwise in the
+  # src tree.
+  ac_file_inputs=`IFS=:
+    for f in $ac_file_in; do
+      case $f in
+      -) echo $tmp/stdin ;;
+      [\\/$]*)
+	 # Absolute (can't be DOS-style, as IFS=:)
+	 test -f "$f" || { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5
+echo "$as_me: error: cannot find input file: $f" >&2;}
+   { (exit 1); exit 1; }; }
+	 # Do quote $f, to prevent DOS paths from being IFS'd.
+	 echo "$f";;
+      *) # Relative
+	 if test -f "$f"; then
+	   # Build tree
+	   echo "$f"
+	 elif test -f "$srcdir/$f"; then
+	   # Source tree
+	   echo "$srcdir/$f"
+	 else
+	   # /dev/null tree
+	   { { echo "$as_me:$LINENO: error: cannot find input file: $f" >&5
+echo "$as_me: error: cannot find input file: $f" >&2;}
+   { (exit 1); exit 1; }; }
+	 fi;;
+      esac
+    done` || { (exit 1); exit 1; }
+  # Remove the trailing spaces.
+  sed 's/[	 ]*$//' $ac_file_inputs >$tmp/in
+
+_ACEOF
+
+# Transform confdefs.h into two sed scripts, `conftest.defines' and
+# `conftest.undefs', that substitutes the proper values into
+# config.h.in to produce config.h.  The first handles `#define'
+# templates, and the second `#undef' templates.
+# And first: Protect against being on the right side of a sed subst in
+# config.status.  Protect against being in an unquoted here document
+# in config.status.
+rm -f conftest.defines conftest.undefs
+# Using a here document instead of a string reduces the quoting nightmare.
+# Putting comments in sed scripts is not portable.
+#
+# `end' is used to avoid that the second main sed command (meant for
+# 0-ary CPP macros) applies to n-ary macro definitions.
+# See the Autoconf documentation for `clear'.
+cat >confdef2sed.sed <<\_ACEOF
+s/[\\&,]/\\&/g
+s,[\\$`],\\&,g
+t clear
+: clear
+s,^[	 ]*#[	 ]*define[	 ][	 ]*\([^	 (][^	 (]*\)\(([^)]*)\)[	 ]*\(.*\)$,${ac_dA}\1${ac_dB}\1\2${ac_dC}\3${ac_dD},gp
+t end
+s,^[	 ]*#[	 ]*define[	 ][	 ]*\([^	 ][^	 ]*\)[	 ]*\(.*\)$,${ac_dA}\1${ac_dB}\1${ac_dC}\2${ac_dD},gp
+: end
+_ACEOF
+# If some macros were called several times there might be several times
+# the same #defines, which is useless.  Nevertheless, we may not want to
+# sort them, since we want the *last* AC-DEFINE to be honored.
+uniq confdefs.h | sed -n -f confdef2sed.sed >conftest.defines
+sed 's/ac_d/ac_u/g' conftest.defines >conftest.undefs
+rm -f confdef2sed.sed
+
+# This sed command replaces #undef with comments.  This is necessary, for
+# example, in the case of _POSIX_SOURCE, which is predefined and required
+# on some systems where configure will not decide to define it.
+cat >>conftest.undefs <<\_ACEOF
+s,^[	 ]*#[	 ]*undef[	 ][	 ]*[a-zA-Z_][a-zA-Z_0-9]*,/* & */,
+_ACEOF
+
+# Break up conftest.defines because some shells have a limit on the size
+# of here documents, and old seds have small limits too (100 cmds).
+echo '  # Handle all the #define templates only if necessary.' >>$CONFIG_STATUS
+echo '  if grep "^[	 ]*#[	 ]*define" $tmp/in >/dev/null; then' >>$CONFIG_STATUS
+echo '  # If there are no defines, we may have an empty if/fi' >>$CONFIG_STATUS
+echo '  :' >>$CONFIG_STATUS
+rm -f conftest.tail
+while grep . conftest.defines >/dev/null
+do
+  # Write a limited-size here document to $tmp/defines.sed.
+  echo '  cat >$tmp/defines.sed <<CEOF' >>$CONFIG_STATUS
+  # Speed up: don't consider the non `#define' lines.
+  echo '/^[	 ]*#[	 ]*define/!b' >>$CONFIG_STATUS
+  # Work around the forget-to-reset-the-flag bug.
+  echo 't clr' >>$CONFIG_STATUS
+  echo ': clr' >>$CONFIG_STATUS
+  sed ${ac_max_here_lines}q conftest.defines >>$CONFIG_STATUS
+  echo 'CEOF
+  sed -f $tmp/defines.sed $tmp/in >$tmp/out
+  rm -f $tmp/in
+  mv $tmp/out $tmp/in
+' >>$CONFIG_STATUS
+  sed 1,${ac_max_here_lines}d conftest.defines >conftest.tail
+  rm -f conftest.defines
+  mv conftest.tail conftest.defines
+done
+rm -f conftest.defines
+echo '  fi # grep' >>$CONFIG_STATUS
+echo >>$CONFIG_STATUS
+
+# Break up conftest.undefs because some shells have a limit on the size
+# of here documents, and old seds have small limits too (100 cmds).
+echo '  # Handle all the #undef templates' >>$CONFIG_STATUS
+rm -f conftest.tail
+while grep . conftest.undefs >/dev/null
+do
+  # Write a limited-size here document to $tmp/undefs.sed.
+  echo '  cat >$tmp/undefs.sed <<CEOF' >>$CONFIG_STATUS
+  # Speed up: don't consider the non `#undef'
+  echo '/^[	 ]*#[	 ]*undef/!b' >>$CONFIG_STATUS
+  # Work around the forget-to-reset-the-flag bug.
+  echo 't clr' >>$CONFIG_STATUS
+  echo ': clr' >>$CONFIG_STATUS
+  sed ${ac_max_here_lines}q conftest.undefs >>$CONFIG_STATUS
+  echo 'CEOF
+  sed -f $tmp/undefs.sed $tmp/in >$tmp/out
+  rm -f $tmp/in
+  mv $tmp/out $tmp/in
+' >>$CONFIG_STATUS
+  sed 1,${ac_max_here_lines}d conftest.undefs >conftest.tail
+  rm -f conftest.undefs
+  mv conftest.tail conftest.undefs
+done
+rm -f conftest.undefs
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+  # Let's still pretend it is `configure' which instantiates (i.e., don't
+  # use $as_me), people would be surprised to read:
+  #    /* config.h.  Generated by config.status.  */
+  if test x"$ac_file" = x-; then
+    echo "/* Generated by configure.  */" >$tmp/config.h
+  else
+    echo "/* $ac_file.  Generated by configure.  */" >$tmp/config.h
+  fi
+  cat $tmp/in >>$tmp/config.h
+  rm -f $tmp/in
+  if test x"$ac_file" != x-; then
+    if diff $ac_file $tmp/config.h >/dev/null 2>&1; then
+      { echo "$as_me:$LINENO: $ac_file is unchanged" >&5
+echo "$as_me: $ac_file is unchanged" >&6;}
+    else
+      ac_dir=`(dirname "$ac_file") 2>/dev/null ||
+$as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$ac_file" : 'X\(//\)[^/]' \| \
+	 X"$ac_file" : 'X\(//\)$' \| \
+	 X"$ac_file" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$ac_file" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+      { if $as_mkdir_p; then
+    mkdir -p "$ac_dir"
+  else
+    as_dir="$ac_dir"
+    as_dirs=
+    while test ! -d "$as_dir"; do
+      as_dirs="$as_dir $as_dirs"
+      as_dir=`(dirname "$as_dir") 2>/dev/null ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$as_dir" : 'X\(//\)[^/]' \| \
+	 X"$as_dir" : 'X\(//\)$' \| \
+	 X"$as_dir" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$as_dir" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+    done
+    test ! -n "$as_dirs" || mkdir $as_dirs
+  fi || { { echo "$as_me:$LINENO: error: cannot create directory \"$ac_dir\"" >&5
+echo "$as_me: error: cannot create directory \"$ac_dir\"" >&2;}
+   { (exit 1); exit 1; }; }; }
+
+      rm -f $ac_file
+      mv $tmp/config.h $ac_file
+    fi
+  else
+    cat $tmp/config.h
+    rm -f $tmp/config.h
+  fi
+# Compute $ac_file's index in $config_headers.
+_am_stamp_count=1
+for _am_header in $config_headers :; do
+  case $_am_header in
+    $ac_file | $ac_file:* )
+      break ;;
+    * )
+      _am_stamp_count=`expr $_am_stamp_count + 1` ;;
+  esac
+done
+echo "timestamp for $ac_file" >`(dirname $ac_file) 2>/dev/null ||
+$as_expr X$ac_file : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X$ac_file : 'X\(//\)[^/]' \| \
+	 X$ac_file : 'X\(//\)$' \| \
+	 X$ac_file : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X$ac_file |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`/stamp-h$_am_stamp_count
+done
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF
+
+#
+# CONFIG_COMMANDS section.
+#
+for ac_file in : $CONFIG_COMMANDS; do test "x$ac_file" = x: && continue
+  ac_dest=`echo "$ac_file" | sed 's,:.*,,'`
+  ac_source=`echo "$ac_file" | sed 's,[^:]*:,,'`
+  ac_dir=`(dirname "$ac_dest") 2>/dev/null ||
+$as_expr X"$ac_dest" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$ac_dest" : 'X\(//\)[^/]' \| \
+	 X"$ac_dest" : 'X\(//\)$' \| \
+	 X"$ac_dest" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$ac_dest" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+  { if $as_mkdir_p; then
+    mkdir -p "$ac_dir"
+  else
+    as_dir="$ac_dir"
+    as_dirs=
+    while test ! -d "$as_dir"; do
+      as_dirs="$as_dir $as_dirs"
+      as_dir=`(dirname "$as_dir") 2>/dev/null ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$as_dir" : 'X\(//\)[^/]' \| \
+	 X"$as_dir" : 'X\(//\)$' \| \
+	 X"$as_dir" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$as_dir" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+    done
+    test ! -n "$as_dirs" || mkdir $as_dirs
+  fi || { { echo "$as_me:$LINENO: error: cannot create directory \"$ac_dir\"" >&5
+echo "$as_me: error: cannot create directory \"$ac_dir\"" >&2;}
+   { (exit 1); exit 1; }; }; }
+
+  ac_builddir=.
+
+if test "$ac_dir" != .; then
+  ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'`
+  # A "../" for each directory in $ac_dir_suffix.
+  ac_top_builddir=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,../,g'`
+else
+  ac_dir_suffix= ac_top_builddir=
+fi
+
+case $srcdir in
+  .)  # No --srcdir option.  We are building in place.
+    ac_srcdir=.
+    if test -z "$ac_top_builddir"; then
+       ac_top_srcdir=.
+    else
+       ac_top_srcdir=`echo $ac_top_builddir | sed 's,/$,,'`
+    fi ;;
+  [\\/]* | ?:[\\/]* )  # Absolute path.
+    ac_srcdir=$srcdir$ac_dir_suffix;
+    ac_top_srcdir=$srcdir ;;
+  *) # Relative path.
+    ac_srcdir=$ac_top_builddir$srcdir$ac_dir_suffix
+    ac_top_srcdir=$ac_top_builddir$srcdir ;;
+esac
+
+# Do not use `cd foo && pwd` to compute absolute paths, because
+# the directories may not exist.
+case `pwd` in
+.) ac_abs_builddir="$ac_dir";;
+*)
+  case "$ac_dir" in
+  .) ac_abs_builddir=`pwd`;;
+  [\\/]* | ?:[\\/]* ) ac_abs_builddir="$ac_dir";;
+  *) ac_abs_builddir=`pwd`/"$ac_dir";;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_top_builddir=${ac_top_builddir}.;;
+*)
+  case ${ac_top_builddir}. in
+  .) ac_abs_top_builddir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_top_builddir=${ac_top_builddir}.;;
+  *) ac_abs_top_builddir=$ac_abs_builddir/${ac_top_builddir}.;;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_srcdir=$ac_srcdir;;
+*)
+  case $ac_srcdir in
+  .) ac_abs_srcdir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_srcdir=$ac_srcdir;;
+  *) ac_abs_srcdir=$ac_abs_builddir/$ac_srcdir;;
+  esac;;
+esac
+case $ac_abs_builddir in
+.) ac_abs_top_srcdir=$ac_top_srcdir;;
+*)
+  case $ac_top_srcdir in
+  .) ac_abs_top_srcdir=$ac_abs_builddir;;
+  [\\/]* | ?:[\\/]* ) ac_abs_top_srcdir=$ac_top_srcdir;;
+  *) ac_abs_top_srcdir=$ac_abs_builddir/$ac_top_srcdir;;
+  esac;;
+esac
+
+
+  { echo "$as_me:$LINENO: executing $ac_dest commands" >&5
+echo "$as_me: executing $ac_dest commands" >&6;}
+  case $ac_dest in
+    depfiles ) test x"$AMDEP_TRUE" != x"" || for mf in $CONFIG_FILES; do
+  # Strip MF so we end up with the name of the file.
+  mf=`echo "$mf" | sed -e 's/:.*$//'`
+  # Check whether this is an Automake generated Makefile or not.
+  # We used to match only the files named `Makefile.in', but
+  # some people rename them; so instead we look at the file content.
+  # Grep'ing the first line is not enough: some people post-process
+  # each Makefile.in and add a new line on top of each file to say so.
+  # So let's grep whole file.
+  if grep '^#.*generated by automake' $mf > /dev/null 2>&1; then
+    dirpart=`(dirname "$mf") 2>/dev/null ||
+$as_expr X"$mf" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$mf" : 'X\(//\)[^/]' \| \
+	 X"$mf" : 'X\(//\)$' \| \
+	 X"$mf" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$mf" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+  else
+    continue
+  fi
+  # Extract the definition of DEPDIR, am__include, and am__quote
+  # from the Makefile without running `make'.
+  DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"`
+  test -z "$DEPDIR" && continue
+  am__include=`sed -n 's/^am__include = //p' < "$mf"`
+  test -z "am__include" && continue
+  am__quote=`sed -n 's/^am__quote = //p' < "$mf"`
+  # When using ansi2knr, U may be empty or an underscore; expand it
+  U=`sed -n 's/^U = //p' < "$mf"`
+  # Find all dependency output files, they are included files with
+  # $(DEPDIR) in their names.  We invoke sed twice because it is the
+  # simplest approach to changing $(DEPDIR) to its actual value in the
+  # expansion.
+  for file in `sed -n "
+    s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \
+       sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do
+    # Make sure the directory exists.
+    test -f "$dirpart/$file" && continue
+    fdir=`(dirname "$file") 2>/dev/null ||
+$as_expr X"$file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$file" : 'X\(//\)[^/]' \| \
+	 X"$file" : 'X\(//\)$' \| \
+	 X"$file" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$file" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+    { if $as_mkdir_p; then
+    mkdir -p $dirpart/$fdir
+  else
+    as_dir=$dirpart/$fdir
+    as_dirs=
+    while test ! -d "$as_dir"; do
+      as_dirs="$as_dir $as_dirs"
+      as_dir=`(dirname "$as_dir") 2>/dev/null ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+	 X"$as_dir" : 'X\(//\)[^/]' \| \
+	 X"$as_dir" : 'X\(//\)$' \| \
+	 X"$as_dir" : 'X\(/\)' \| \
+	 .     : '\(.\)' 2>/dev/null ||
+echo X"$as_dir" |
+    sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/; q; }
+  	  /^X\(\/\/\)[^/].*/{ s//\1/; q; }
+  	  /^X\(\/\/\)$/{ s//\1/; q; }
+  	  /^X\(\/\).*/{ s//\1/; q; }
+  	  s/.*/./; q'`
+    done
+    test ! -n "$as_dirs" || mkdir $as_dirs
+  fi || { { echo "$as_me:$LINENO: error: cannot create directory $dirpart/$fdir" >&5
+echo "$as_me: error: cannot create directory $dirpart/$fdir" >&2;}
+   { (exit 1); exit 1; }; }; }
+
+    # echo "creating $dirpart/$file"
+    echo '# dummy' > "$dirpart/$file"
+  done
+done
+ ;;
+  esac
+done
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+
+{ (exit 0); exit 0; }
+_ACEOF
+chmod +x $CONFIG_STATUS
+ac_clean_files=$ac_clean_files_save
+
+
+# configure is writing to config.log, and then calls config.status.
+# config.status does its own redirection, appending to config.log.
+# Unfortunately, on DOS this fails, as config.log is still kept open
+# by configure, so config.status won't be able to write to it; its
+# output is simply discarded.  So we exec the FD to /dev/null,
+# effectively closing config.log, so it can be properly (re)opened and
+# appended to by config.status.  When coming back to configure, we
+# need to make the FD available again.
+if test "$no_create" != yes; then
+  ac_cs_success=:
+  ac_config_status_args=
+  test "$silent" = yes &&
+    ac_config_status_args="$ac_config_status_args --quiet"
+  exec 5>/dev/null
+  $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false
+  exec 5>>config.log
+  # Use ||, not &&, to avoid exiting from the if with $? = 1, which
+  # would make configure fail if this is the last instruction.
+  $ac_cs_success || { (exit 1); exit 1; }
+fi
+
diff --git a/configure.in b/configure.in
new file mode 100644
index 0000000..dae5dea
--- /dev/null
+++ b/configure.in
@@ -0,0 +1,48 @@
+# Process this file with autoconf to produce a configure script.
+AC_INIT([toppred], [1.10])
+AM_INIT_AUTOMAKE
+AM_CONFIG_HEADER([src/config.h])
+
+# Checks for programs.
+AC_PROG_CC
+AC_CHECK_PROG(POD2MAN, pod2man, pod2man, :)
+AC_CHECK_PROG(GNUPLOT, gnuplot, gnuplot)
+if test "$GNUPLOT" = "gnuplot"; then
+ AC_DEFINE(HAVE_GNUPLOT, 1, is gnuplot present)
+else
+ AC_MSG_WARN([gnuplot not found, Hydrophobic profile will be unavailable])
+fi
+
+# Checks for libraries.
+AC_CHECK_LIB(m, pow)
+
+# Checks for header files.
+AC_HEADER_STDC
+AC_CHECK_HEADERS([errno.h stdlib.h string.h unistd.h])
+
+# Checks for typedefs, structures, and compiler characteristics.
+AC_C_CONST
+AC_TYPE_SIZE_T
+AC_STRUCT_TM
+
+# Checks for library functions.
+# AC_FUNC_MALLOC # tru64 problem
+AC_FUNC_STAT
+AC_CHECK_FUNCS([pow sqrt strchr strerror strrchr])
+
+# Checks for png driver
+GD_CHECK
+
+# Host specific stuff
+OS_CPPFLAGS=""
+AC_CANONICAL_HOST
+case $host in
+  *-*osf*)
+    OS_CPPFLAGS="-D_XOPEN_SOURCE_EXTENDED"
+    break
+esac
+AC_SUBST([OS_CPPFLAGS])
+
+AC_CONFIG_FILES([Makefile m4/Makefile src/Makefile data/Makefile doc/Makefile
+                 test/Makefile])
+AC_OUTPUT
diff --git a/data/CYTEXT-scale b/data/CYTEXT-scale
new file mode 100644
index 0000000..66494d8
--- /dev/null
+++ b/data/CYTEXT-scale
@@ -0,0 +1,24 @@
+#___________________________________________________________________________
+#
+# aa	cyt	ext	sd
+#___________________________________________________________________________
+A	8.387	8.097	3.7
+C 	3.226	0	2.3
+D 	7.419	6.005	2.2 
+E 	7.742	5.533	3.0
+F 	2.581	3.171	1.9
+G 	7.419	8.907	3.4
+H 	0.968	1.417	1.6
+I  	5.484	4.926	2.5
+K	5.484	5.533	3.4
+L	9.032	7.422	3.4
+M 	3.226	3.171	1.4
+N 	3.871	4.858	2.3
+P 	4.194	6.545	3.2
+Q 	3.548	3.306	2.4
+R 	9.032	5.938	3.3
+S 	4.516	6.883	2.8
+T 	6.129 	5.263	2.6
+V 	4.516	8.165	2.5
+W 	0.968	1.282	1.2
+Y 	2.258	3.576	1.8
diff --git a/data/GES-scale b/data/GES-scale
new file mode 100644
index 0000000..61d82c8
--- /dev/null
+++ b/data/GES-scale
@@ -0,0 +1,25 @@
+# ___________________________________________________________________________
+#
+# Hphobe Values Goldman Engelman Steitz
+# Ann Rev Biophys. Biophys. Chem. 1986 15/ 321 53 
+#___________________________________________________________________________
+A	1.6
+C	2.0
+D	-9.2
+E	-8.2
+F	3.7
+G	1.0
+H	-3.0
+I	3.1
+K	-8.8
+L	2.8
+M	3.4
+N	-4.8
+P	-0.2
+Q	-4.1
+R	-12.3
+S	0.6
+T	1.2
+V	2.6
+W	1.9
+Y	-0.7
diff --git a/data/GVH-scale b/data/GVH-scale
new file mode 100644
index 0000000..b428c1a
--- /dev/null
+++ b/data/GVH-scale
@@ -0,0 +1,25 @@
+#___________________________________________________________________________
+#
+# Hphobe Values Gunnar von Heijne
+# Gunnar von Heijne J. Mol/ Biol (1992) 225, 487-494
+#___________________________________________________________________________
+A 	 0.267
+C  	 1.806
+D 	-2.303
+E 	-2.442
+F 	 0.427
+G 	 0.160
+H 	-2.189
+I 	 0.971
+K 	-2.996
+L 	 0.623
+M 	 0.136
+N 	-1.988
+P 	-0.451
+Q 	-1.814
+R 	-2.749
+S 	-0.119
+T 	-0.083
+V 	 0.721
+W 	-0.875
+Y 	-0.386
diff --git a/data/KD-scale b/data/KD-scale
new file mode 100644
index 0000000..6871794
--- /dev/null
+++ b/data/KD-scale
@@ -0,0 +1,25 @@
+#___________________________________________________________________________
+#
+# Hphobe Values Kyte & Doolittle
+# Kyte and Doolittle, J.Mol.Biol.157 (1982) 105-132 
+#___________________________________________________________________________
+A 	1.8
+C  	.5
+D 	-3.5
+E 	-3.5
+F 	2.8
+G 	-0.4
+H 	-3.2 
+I 	4.5 
+K 	-3.9
+L 	3.8
+M 	1.9
+N 	-3.5
+P 	-1.6
+Q 	-3.5  
+R 	-4.5
+S 	-0.8
+T 	-0.7
+V 	4.2
+W 	-0.9
+Y 	-1.3
diff --git a/data/Makefile.am b/data/Makefile.am
new file mode 100644
index 0000000..f8959a9
--- /dev/null
+++ b/data/Makefile.am
@@ -0,0 +1,3 @@
+pkgdata_DATA = GES-scale GVH-scale KD-scale CYTEXT-scale toppred.dtd
+
+EXTRA_DIST = $(pkgdata_DATA)
diff --git a/data/Makefile.in b/data/Makefile.in
new file mode 100644
index 0000000..8417f82
--- /dev/null
+++ b/data/Makefile.in
@@ -0,0 +1,319 @@
+# Makefile.in generated by automake 1.9.2 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004  Free Software Foundation, Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+
+srcdir = @srcdir@
+top_srcdir = @top_srcdir@
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+top_builddir = ..
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+INSTALL = @INSTALL@
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+build_triplet = @build@
+host_triplet = @host@
+subdir = data
+DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/m4/aclibgd.m4 \
+	$(top_srcdir)/configure.in
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs
+CONFIG_HEADER = $(top_builddir)/src/config.h
+CONFIG_CLEAN_FILES =
+SOURCES =
+DIST_SOURCES =
+am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`;
+am__vpath_adj = case $$p in \
+    $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \
+    *) f=$$p;; \
+  esac;
+am__strip_dir = `echo $$p | sed -e 's|^.*/||'`;
+am__installdirs = "$(DESTDIR)$(pkgdatadir)"
+pkgdataDATA_INSTALL = $(INSTALL_DATA)
+DATA = $(pkgdata_DATA)
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+ACLOCAL = @ACLOCAL@
+AMDEP_FALSE = @AMDEP_FALSE@
+AMDEP_TRUE = @AMDEP_TRUE@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CC = @CC@
+CCDEPMODE = @CCDEPMODE@
+CFLAGS = @CFLAGS@
+CPP = @CPP@
+CPPFLAGS = @CPPFLAGS@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+DEPDIR = @DEPDIR@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+EGREP = @EGREP@
+EXEEXT = @EXEEXT@
+GNUPLOT = @GNUPLOT@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LDFLAGS = @LDFLAGS@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+OBJEXT = @OBJEXT@
+OS_CPPFLAGS = @OS_CPPFLAGS@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+POD2MAN = @POD2MAN@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+USE_GD_LIB_SRC_FALSE = @USE_GD_LIB_SRC_FALSE@
+USE_GD_LIB_SRC_TRUE = @USE_GD_LIB_SRC_TRUE@
+VERSION = @VERSION@
+ac_ct_CC = @ac_ct_CC@
+ac_ct_STRIP = @ac_ct_STRIP@
+am__fastdepCC_FALSE = @am__fastdepCC_FALSE@
+am__fastdepCC_TRUE = @am__fastdepCC_TRUE@
+am__include = @am__include@
+am__leading_dot = @am__leading_dot@
+am__quote = @am__quote@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build = @build@
+build_alias = @build_alias@
+build_cpu = @build_cpu@
+build_os = @build_os@
+build_vendor = @build_vendor@
+datadir = @datadir@
+exec_prefix = @exec_prefix@
+host = @host@
+host_alias = @host_alias@
+host_cpu = @host_cpu@
+host_os = @host_os@
+host_vendor = @host_vendor@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+pkgdata_DATA = GES-scale GVH-scale KD-scale CYTEXT-scale toppred.dtd
+EXTRA_DIST = $(pkgdata_DATA)
+all: all-am
+
+.SUFFIXES:
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \
+		&& exit 0; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu  data/Makefile'; \
+	cd $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu  data/Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+uninstall-info-am:
+install-pkgdataDATA: $(pkgdata_DATA)
+	@$(NORMAL_INSTALL)
+	test -z "$(pkgdatadir)" || $(mkdir_p) "$(DESTDIR)$(pkgdatadir)"
+	@list='$(pkgdata_DATA)'; for p in $$list; do \
+	  if test -f "$$p"; then d=; else d="$(srcdir)/"; fi; \
+	  f=$(am__strip_dir) \
+	  echo " $(pkgdataDATA_INSTALL) '$$d$$p' '$(DESTDIR)$(pkgdatadir)/$$f'"; \
+	  $(pkgdataDATA_INSTALL) "$$d$$p" "$(DESTDIR)$(pkgdatadir)/$$f"; \
+	done
+
+uninstall-pkgdataDATA:
+	@$(NORMAL_UNINSTALL)
+	@list='$(pkgdata_DATA)'; for p in $$list; do \
+	  f=$(am__strip_dir) \
+	  echo " rm -f '$(DESTDIR)$(pkgdatadir)/$$f'"; \
+	  rm -f "$(DESTDIR)$(pkgdatadir)/$$f"; \
+	done
+tags: TAGS
+TAGS:
+
+ctags: CTAGS
+CTAGS:
+
+
+distdir: $(DISTFILES)
+	@srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \
+	list='$(DISTFILES)'; for file in $$list; do \
+	  case $$file in \
+	    $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \
+	    $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \
+	  esac; \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \
+	  if test "$$dir" != "$$file" && test "$$dir" != "."; then \
+	    dir="/$$dir"; \
+	    $(mkdir_p) "$(distdir)$$dir"; \
+	  else \
+	    dir=''; \
+	  fi; \
+	  if test -d $$d/$$file; then \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \
+	    fi; \
+	    cp -pR $$d/$$file $(distdir)$$dir || exit 1; \
+	  else \
+	    test -f $(distdir)/$$file \
+	    || cp -p $$d/$$file $(distdir)/$$file \
+	    || exit 1; \
+	  fi; \
+	done
+check-am: all-am
+check: check-am
+all-am: Makefile $(DATA)
+installdirs:
+	for dir in "$(DESTDIR)$(pkgdatadir)"; do \
+	  test -z "$$dir" || $(mkdir_p) "$$dir"; \
+	done
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-am
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+info: info-am
+
+info-am:
+
+install-data-am: install-pkgdataDATA
+
+install-exec-am:
+
+install-info: install-info-am
+
+install-man:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-info-am uninstall-pkgdataDATA
+
+.PHONY: all all-am check check-am clean clean-generic distclean \
+	distclean-generic distdir dvi dvi-am html html-am info info-am \
+	install install-am install-data install-data-am install-exec \
+	install-exec-am install-info install-info-am install-man \
+	install-pkgdataDATA install-strip installcheck installcheck-am \
+	installdirs maintainer-clean maintainer-clean-generic \
+	mostlyclean mostlyclean-generic pdf pdf-am ps ps-am uninstall \
+	uninstall-am uninstall-info-am uninstall-pkgdataDATA
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:
diff --git a/data/toppred.dtd b/data/toppred.dtd
new file mode 100644
index 0000000..0a92e23
--- /dev/null
+++ b/data/toppred.dtd
@@ -0,0 +1,101 @@
+<!-- DTD for toppred output   -->
+<!ELEMENT  toppreds (parameters?, toppred+)>
+
+<!ELEMENT toppred  (parameters?, sequence?, annotation?, plot?, tmsummary, topologies?)>
+
+<!-- parameters of the toppred algorithm -->
+<!ELEMENT  parameters   (corewindow, wedgewindow, certain, putative, distsegments, looplength, eucaryotes, hydrophobycity)>
+
+<!ELEMENT corewindow (#PCDATA)>
+<!ATTLIST corewindow
+        default (true|false) "false">
+<!ELEMENT wedgewindow (#PCDATA)>
+<!ATTLIST wedgewindow
+        default (true|false) "false">
+<!ELEMENT certain (#PCDATA)>
+<!ATTLIST certain
+        default (true|false) "false">
+<!ELEMENT putative (#PCDATA)>
+<!ATTLIST putative
+        default (true|false) "false">  
+<!ELEMENT distsegments (#PCDATA)>
+<!ATTLIST distsegments
+        default (true|false) "false">
+<!ELEMENT looplength (#PCDATA)>
+<!ATTLIST distsegments
+        default (true|false) "false">
+<!ELEMENT kingdom (#PCDATA)>
+<!ATTLIST kingdom
+        default (true|false) "false">
+<!ELEMENT hydrophobycity (#PCDATA)>
+<!ATTLIST hydrophobycity
+        default (true|false) "false">
+
+<!-- programme results -->
+<!ELEMENT  results (sequence)+>
+
+
+<!ATTLIST sequence
+        id  ID    #IMPLIED
+        len CDATA #IMPLIED>
+
+<!ELEMENT annotation (#PCDATA)>
+
+<!ELEMENT plot EMPTY>
+<!ATTLIST plot
+        hydro CDATA  #REQUIRED
+        gplot CDATA  #IMPLIED>
+
+<!ELEMENT tmsummary (segment*)>
+<!ATTLIST tmsummary
+        segments  CDATA "0">
+        
+
+<!ELEMENT segment EMPTY>
+<!ATTLIST segment 
+        start CDATA  #REQUIRED 
+        stop  CDATA  #IMPLIED
+        hp    CDATA  #REQUIRED
+        type  (putative|certain) "certain">
+
+<!ELEMENT topologies (toppology+)>
+<!ATTLIST topologies
+        maxtopos  CDATA #IMPLIED
+        topoprint CDATA #IMPLIED>
+
+<!ELEMENT topology (loop?, (transmem, loop)+, transmem?)>
+<!ATTLIST topology 
+        nr       ID     #IMPLIED
+        prob     CDATA  #IMPLIED
+        darglys  CDATA  #REQUIRED
+        dcytext  CDATA  #IMPLIED
+        dncharge CDATA  #IMPLIED
+        dnnegpos CDATA  #IMPLIED
+        image    CDATA  #IMPLIED
+        orient   CDATA  #IMPLIED>
+
+<!ELEMENT transmem EMPTY>
+<!ATTLIST transmem
+        start CDATA  #REQUIRED
+        stop  CDATA  #IMPLIED
+        prob  CDATA  #IMPLIED
+        hp    CDATA  #REQUIRED>
+
+<!ELEMENT loop EMPTY>
+<!ATTLIST loop  
+        type (ext|cyt|unknown) "unknown"    
+        start   CDATA  #REQUIRED
+        stop    CDATA  #IMPLIED
+        darglys CDATA  #REQUIRED
+        dcytext CDATA  #IMPLIED
+        decisive (darglys|dcytext) "darglys">
+
+
+
+
+
+
+
+
+
+
diff --git a/depcomp b/depcomp
new file mode 100755
index 0000000..04701da
--- /dev/null
+++ b/depcomp
@@ -0,0 +1,530 @@
+#! /bin/sh
+# depcomp - compile a program generating dependencies as side-effects
+
+scriptversion=2005-07-09.11
+
+# Copyright (C) 1999, 2000, 2003, 2004, 2005 Free Software Foundation, Inc.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA
+# 02110-1301, USA.
+
+# As a special exception to the GNU General Public License, if you
+# distribute this file as part of a program that contains a
+# configuration script generated by Autoconf, you may include it under
+# the same distribution terms that you use for the rest of that program.
+
+# Originally written by Alexandre Oliva <oliva at dcc.unicamp.br>.
+
+case $1 in
+  '')
+     echo "$0: No command.  Try \`$0 --help' for more information." 1>&2
+     exit 1;
+     ;;
+  -h | --h*)
+    cat <<\EOF
+Usage: depcomp [--help] [--version] PROGRAM [ARGS]
+
+Run PROGRAMS ARGS to compile a file, generating dependencies
+as side-effects.
+
+Environment variables:
+  depmode     Dependency tracking mode.
+  source      Source file read by `PROGRAMS ARGS'.
+  object      Object file output by `PROGRAMS ARGS'.
+  DEPDIR      directory where to store dependencies.
+  depfile     Dependency file to output.
+  tmpdepfile  Temporary file to use when outputing dependencies.
+  libtool     Whether libtool is used (yes/no).
+
+Report bugs to <bug-automake at gnu.org>.
+EOF
+    exit $?
+    ;;
+  -v | --v*)
+    echo "depcomp $scriptversion"
+    exit $?
+    ;;
+esac
+
+if test -z "$depmode" || test -z "$source" || test -z "$object"; then
+  echo "depcomp: Variables source, object and depmode must be set" 1>&2
+  exit 1
+fi
+
+# Dependencies for sub/bar.o or sub/bar.obj go into sub/.deps/bar.Po.
+depfile=${depfile-`echo "$object" |
+  sed 's|[^\\/]*$|'${DEPDIR-.deps}'/&|;s|\.\([^.]*\)$|.P\1|;s|Pobj$|Po|'`}
+tmpdepfile=${tmpdepfile-`echo "$depfile" | sed 's/\.\([^.]*\)$/.T\1/'`}
+
+rm -f "$tmpdepfile"
+
+# Some modes work just like other modes, but use different flags.  We
+# parameterize here, but still list the modes in the big case below,
+# to make depend.m4 easier to write.  Note that we *cannot* use a case
+# here, because this file can only contain one case statement.
+if test "$depmode" = hp; then
+  # HP compiler uses -M and no extra arg.
+  gccflag=-M
+  depmode=gcc
+fi
+
+if test "$depmode" = dashXmstdout; then
+   # This is just like dashmstdout with a different argument.
+   dashmflag=-xM
+   depmode=dashmstdout
+fi
+
+case "$depmode" in
+gcc3)
+## gcc 3 implements dependency tracking that does exactly what
+## we want.  Yay!  Note: for some reason libtool 1.4 doesn't like
+## it if -MD -MP comes after the -MF stuff.  Hmm.
+  "$@" -MT "$object" -MD -MP -MF "$tmpdepfile"
+  stat=$?
+  if test $stat -eq 0; then :
+  else
+    rm -f "$tmpdepfile"
+    exit $stat
+  fi
+  mv "$tmpdepfile" "$depfile"
+  ;;
+
+gcc)
+## There are various ways to get dependency output from gcc.  Here's
+## why we pick this rather obscure method:
+## - Don't want to use -MD because we'd like the dependencies to end
+##   up in a subdir.  Having to rename by hand is ugly.
+##   (We might end up doing this anyway to support other compilers.)
+## - The DEPENDENCIES_OUTPUT environment variable makes gcc act like
+##   -MM, not -M (despite what the docs say).
+## - Using -M directly means running the compiler twice (even worse
+##   than renaming).
+  if test -z "$gccflag"; then
+    gccflag=-MD,
+  fi
+  "$@" -Wp,"$gccflag$tmpdepfile"
+  stat=$?
+  if test $stat -eq 0; then :
+  else
+    rm -f "$tmpdepfile"
+    exit $stat
+  fi
+  rm -f "$depfile"
+  echo "$object : \\" > "$depfile"
+  alpha=ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz
+## The second -e expression handles DOS-style file names with drive letters.
+  sed -e 's/^[^:]*: / /' \
+      -e 's/^['$alpha']:\/[^:]*: / /' < "$tmpdepfile" >> "$depfile"
+## This next piece of magic avoids the `deleted header file' problem.
+## The problem is that when a header file which appears in a .P file
+## is deleted, the dependency causes make to die (because there is
+## typically no way to rebuild the header).  We avoid this by adding
+## dummy dependencies for each header file.  Too bad gcc doesn't do
+## this for us directly.
+  tr ' ' '
+' < "$tmpdepfile" |
+## Some versions of gcc put a space before the `:'.  On the theory
+## that the space means something, we add a space to the output as
+## well.
+## Some versions of the HPUX 10.20 sed can't process this invocation
+## correctly.  Breaking it into two sed invocations is a workaround.
+    sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile"
+  rm -f "$tmpdepfile"
+  ;;
+
+hp)
+  # This case exists only to let depend.m4 do its work.  It works by
+  # looking at the text of this script.  This case will never be run,
+  # since it is checked for above.
+  exit 1
+  ;;
+
+sgi)
+  if test "$libtool" = yes; then
+    "$@" "-Wp,-MDupdate,$tmpdepfile"
+  else
+    "$@" -MDupdate "$tmpdepfile"
+  fi
+  stat=$?
+  if test $stat -eq 0; then :
+  else
+    rm -f "$tmpdepfile"
+    exit $stat
+  fi
+  rm -f "$depfile"
+
+  if test -f "$tmpdepfile"; then  # yes, the sourcefile depend on other files
+    echo "$object : \\" > "$depfile"
+
+    # Clip off the initial element (the dependent).  Don't try to be
+    # clever and replace this with sed code, as IRIX sed won't handle
+    # lines with more than a fixed number of characters (4096 in
+    # IRIX 6.2 sed, 8192 in IRIX 6.5).  We also remove comment lines;
+    # the IRIX cc adds comments like `#:fec' to the end of the
+    # dependency line.
+    tr ' ' '
+' < "$tmpdepfile" \
+    | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' | \
+    tr '
+' ' ' >> $depfile
+    echo >> $depfile
+
+    # The second pass generates a dummy entry for each header file.
+    tr ' ' '
+' < "$tmpdepfile" \
+   | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' -e 's/$/:/' \
+   >> $depfile
+  else
+    # The sourcefile does not contain any dependencies, so just
+    # store a dummy comment line, to avoid errors with the Makefile
+    # "include basename.Plo" scheme.
+    echo "#dummy" > "$depfile"
+  fi
+  rm -f "$tmpdepfile"
+  ;;
+
+aix)
+  # The C for AIX Compiler uses -M and outputs the dependencies
+  # in a .u file.  In older versions, this file always lives in the
+  # current directory.  Also, the AIX compiler puts `$object:' at the
+  # start of each line; $object doesn't have directory information.
+  # Version 6 uses the directory in both cases.
+  stripped=`echo "$object" | sed 's/\(.*\)\..*$/\1/'`
+  tmpdepfile="$stripped.u"
+  if test "$libtool" = yes; then
+    "$@" -Wc,-M
+  else
+    "$@" -M
+  fi
+  stat=$?
+
+  if test -f "$tmpdepfile"; then :
+  else
+    stripped=`echo "$stripped" | sed 's,^.*/,,'`
+    tmpdepfile="$stripped.u"
+  fi
+
+  if test $stat -eq 0; then :
+  else
+    rm -f "$tmpdepfile"
+    exit $stat
+  fi
+
+  if test -f "$tmpdepfile"; then
+    outname="$stripped.o"
+    # Each line is of the form `foo.o: dependent.h'.
+    # Do two passes, one to just change these to
+    # `$object: dependent.h' and one to simply `dependent.h:'.
+    sed -e "s,^$outname:,$object :," < "$tmpdepfile" > "$depfile"
+    sed -e "s,^$outname: \(.*\)$,\1:," < "$tmpdepfile" >> "$depfile"
+  else
+    # The sourcefile does not contain any dependencies, so just
+    # store a dummy comment line, to avoid errors with the Makefile
+    # "include basename.Plo" scheme.
+    echo "#dummy" > "$depfile"
+  fi
+  rm -f "$tmpdepfile"
+  ;;
+
+icc)
+  # Intel's C compiler understands `-MD -MF file'.  However on
+  #    icc -MD -MF foo.d -c -o sub/foo.o sub/foo.c
+  # ICC 7.0 will fill foo.d with something like
+  #    foo.o: sub/foo.c
+  #    foo.o: sub/foo.h
+  # which is wrong.  We want:
+  #    sub/foo.o: sub/foo.c
+  #    sub/foo.o: sub/foo.h
+  #    sub/foo.c:
+  #    sub/foo.h:
+  # ICC 7.1 will output
+  #    foo.o: sub/foo.c sub/foo.h
+  # and will wrap long lines using \ :
+  #    foo.o: sub/foo.c ... \
+  #     sub/foo.h ... \
+  #     ...
+
+  "$@" -MD -MF "$tmpdepfile"
+  stat=$?
+  if test $stat -eq 0; then :
+  else
+    rm -f "$tmpdepfile"
+    exit $stat
+  fi
+  rm -f "$depfile"
+  # Each line is of the form `foo.o: dependent.h',
+  # or `foo.o: dep1.h dep2.h \', or ` dep3.h dep4.h \'.
+  # Do two passes, one to just change these to
+  # `$object: dependent.h' and one to simply `dependent.h:'.
+  sed "s,^[^:]*:,$object :," < "$tmpdepfile" > "$depfile"
+  # Some versions of the HPUX 10.20 sed can't process this invocation
+  # correctly.  Breaking it into two sed invocations is a workaround.
+  sed 's,^[^:]*: \(.*\)$,\1,;s/^\\$//;/^$/d;/:$/d' < "$tmpdepfile" |
+    sed -e 's/$/ :/' >> "$depfile"
+  rm -f "$tmpdepfile"
+  ;;
+
+tru64)
+   # The Tru64 compiler uses -MD to generate dependencies as a side
+   # effect.  `cc -MD -o foo.o ...' puts the dependencies into `foo.o.d'.
+   # At least on Alpha/Redhat 6.1, Compaq CCC V6.2-504 seems to put
+   # dependencies in `foo.d' instead, so we check for that too.
+   # Subdirectories are respected.
+   dir=`echo "$object" | sed -e 's|/[^/]*$|/|'`
+   test "x$dir" = "x$object" && dir=
+   base=`echo "$object" | sed -e 's|^.*/||' -e 's/\.o$//' -e 's/\.lo$//'`
+
+   if test "$libtool" = yes; then
+      # With Tru64 cc, shared objects can also be used to make a
+      # static library.  This mecanism is used in libtool 1.4 series to
+      # handle both shared and static libraries in a single compilation.
+      # With libtool 1.4, dependencies were output in $dir.libs/$base.lo.d.
+      #
+      # With libtool 1.5 this exception was removed, and libtool now
+      # generates 2 separate objects for the 2 libraries.  These two
+      # compilations output dependencies in in $dir.libs/$base.o.d and
+      # in $dir$base.o.d.  We have to check for both files, because
+      # one of the two compilations can be disabled.  We should prefer
+      # $dir$base.o.d over $dir.libs/$base.o.d because the latter is
+      # automatically cleaned when .libs/ is deleted, while ignoring
+      # the former would cause a distcleancheck panic.
+      tmpdepfile1=$dir.libs/$base.lo.d   # libtool 1.4
+      tmpdepfile2=$dir$base.o.d          # libtool 1.5
+      tmpdepfile3=$dir.libs/$base.o.d    # libtool 1.5
+      tmpdepfile4=$dir.libs/$base.d      # Compaq CCC V6.2-504
+      "$@" -Wc,-MD
+   else
+      tmpdepfile1=$dir$base.o.d
+      tmpdepfile2=$dir$base.d
+      tmpdepfile3=$dir$base.d
+      tmpdepfile4=$dir$base.d
+      "$@" -MD
+   fi
+
+   stat=$?
+   if test $stat -eq 0; then :
+   else
+      rm -f "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" "$tmpdepfile4"
+      exit $stat
+   fi
+
+   for tmpdepfile in "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" "$tmpdepfile4"
+   do
+     test -f "$tmpdepfile" && break
+   done
+   if test -f "$tmpdepfile"; then
+      sed -e "s,^.*\.[a-z]*:,$object:," < "$tmpdepfile" > "$depfile"
+      # That's a tab and a space in the [].
+      sed -e 's,^.*\.[a-z]*:[	 ]*,,' -e 's,$,:,' < "$tmpdepfile" >> "$depfile"
+   else
+      echo "#dummy" > "$depfile"
+   fi
+   rm -f "$tmpdepfile"
+   ;;
+
+#nosideeffect)
+  # This comment above is used by automake to tell side-effect
+  # dependency tracking mechanisms from slower ones.
+
+dashmstdout)
+  # Important note: in order to support this mode, a compiler *must*
+  # always write the preprocessed file to stdout, regardless of -o.
+  "$@" || exit $?
+
+  # Remove the call to Libtool.
+  if test "$libtool" = yes; then
+    while test $1 != '--mode=compile'; do
+      shift
+    done
+    shift
+  fi
+
+  # Remove `-o $object'.
+  IFS=" "
+  for arg
+  do
+    case $arg in
+    -o)
+      shift
+      ;;
+    $object)
+      shift
+      ;;
+    *)
+      set fnord "$@" "$arg"
+      shift # fnord
+      shift # $arg
+      ;;
+    esac
+  done
+
+  test -z "$dashmflag" && dashmflag=-M
+  # Require at least two characters before searching for `:'
+  # in the target name.  This is to cope with DOS-style filenames:
+  # a dependency such as `c:/foo/bar' could be seen as target `c' otherwise.
+  "$@" $dashmflag |
+    sed 's:^[  ]*[^: ][^:][^:]*\:[    ]*:'"$object"'\: :' > "$tmpdepfile"
+  rm -f "$depfile"
+  cat < "$tmpdepfile" > "$depfile"
+  tr ' ' '
+' < "$tmpdepfile" | \
+## Some versions of the HPUX 10.20 sed can't process this invocation
+## correctly.  Breaking it into two sed invocations is a workaround.
+    sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile"
+  rm -f "$tmpdepfile"
+  ;;
+
+dashXmstdout)
+  # This case only exists to satisfy depend.m4.  It is never actually
+  # run, as this mode is specially recognized in the preamble.
+  exit 1
+  ;;
+
+makedepend)
+  "$@" || exit $?
+  # Remove any Libtool call
+  if test "$libtool" = yes; then
+    while test $1 != '--mode=compile'; do
+      shift
+    done
+    shift
+  fi
+  # X makedepend
+  shift
+  cleared=no
+  for arg in "$@"; do
+    case $cleared in
+    no)
+      set ""; shift
+      cleared=yes ;;
+    esac
+    case "$arg" in
+    -D*|-I*)
+      set fnord "$@" "$arg"; shift ;;
+    # Strip any option that makedepend may not understand.  Remove
+    # the object too, otherwise makedepend will parse it as a source file.
+    -*|$object)
+      ;;
+    *)
+      set fnord "$@" "$arg"; shift ;;
+    esac
+  done
+  obj_suffix="`echo $object | sed 's/^.*\././'`"
+  touch "$tmpdepfile"
+  ${MAKEDEPEND-makedepend} -o"$obj_suffix" -f"$tmpdepfile" "$@"
+  rm -f "$depfile"
+  cat < "$tmpdepfile" > "$depfile"
+  sed '1,2d' "$tmpdepfile" | tr ' ' '
+' | \
+## Some versions of the HPUX 10.20 sed can't process this invocation
+## correctly.  Breaking it into two sed invocations is a workaround.
+    sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile"
+  rm -f "$tmpdepfile" "$tmpdepfile".bak
+  ;;
+
+cpp)
+  # Important note: in order to support this mode, a compiler *must*
+  # always write the preprocessed file to stdout.
+  "$@" || exit $?
+
+  # Remove the call to Libtool.
+  if test "$libtool" = yes; then
+    while test $1 != '--mode=compile'; do
+      shift
+    done
+    shift
+  fi
+
+  # Remove `-o $object'.
+  IFS=" "
+  for arg
+  do
+    case $arg in
+    -o)
+      shift
+      ;;
+    $object)
+      shift
+      ;;
+    *)
+      set fnord "$@" "$arg"
+      shift # fnord
+      shift # $arg
+      ;;
+    esac
+  done
+
+  "$@" -E |
+    sed -n -e '/^# [0-9][0-9]* "\([^"]*\)".*/ s:: \1 \\:p' \
+       -e '/^#line [0-9][0-9]* "\([^"]*\)".*/ s:: \1 \\:p' |
+    sed '$ s: \\$::' > "$tmpdepfile"
+  rm -f "$depfile"
+  echo "$object : \\" > "$depfile"
+  cat < "$tmpdepfile" >> "$depfile"
+  sed < "$tmpdepfile" '/^$/d;s/^ //;s/ \\$//;s/$/ :/' >> "$depfile"
+  rm -f "$tmpdepfile"
+  ;;
+
+msvisualcpp)
+  # Important note: in order to support this mode, a compiler *must*
+  # always write the preprocessed file to stdout, regardless of -o,
+  # because we must use -o when running libtool.
+  "$@" || exit $?
+  IFS=" "
+  for arg
+  do
+    case "$arg" in
+    "-Gm"|"/Gm"|"-Gi"|"/Gi"|"-ZI"|"/ZI")
+	set fnord "$@"
+	shift
+	shift
+	;;
+    *)
+	set fnord "$@" "$arg"
+	shift
+	shift
+	;;
+    esac
+  done
+  "$@" -E |
+  sed -n '/^#line [0-9][0-9]* "\([^"]*\)"/ s::echo "`cygpath -u \\"\1\\"`":p' | sort | uniq > "$tmpdepfile"
+  rm -f "$depfile"
+  echo "$object : \\" > "$depfile"
+  . "$tmpdepfile" | sed 's% %\\ %g' | sed -n '/^\(.*\)$/ s::	\1 \\:p' >> "$depfile"
+  echo "	" >> "$depfile"
+  . "$tmpdepfile" | sed 's% %\\ %g' | sed -n '/^\(.*\)$/ s::\1\::p' >> "$depfile"
+  rm -f "$tmpdepfile"
+  ;;
+
+none)
+  exec "$@"
+  ;;
+
+*)
+  echo "Unknown depmode $depmode" 1>&2
+  exit 1
+  ;;
+esac
+
+exit 0
+
+# Local Variables:
+# mode: shell-script
+# sh-indentation: 2
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "scriptversion="
+# time-stamp-format: "%:y-%02m-%02d.%02H"
+# time-stamp-end: "$"
+# End:
diff --git a/doc/Makefile.am b/doc/Makefile.am
new file mode 100644
index 0000000..fe5acc9
--- /dev/null
+++ b/doc/Makefile.am
@@ -0,0 +1,14 @@
+SUFFIXES = .pod .1
+
+man_MANS = toppred.1
+
+EXTRA_DIST = $(man_MANS) toppred.pod
+
+PODARGS = --center='User Manuals' --release='Unix'
+
+.pod.1:
+	$(POD2MAN) $(PODARGS) $< > $@ && touch $@
+
+## Maintainer parano checks
+parano:
+	(for p in *.pod; do podchecker --warnings --warnings $$p; done)
diff --git a/doc/Makefile.in b/doc/Makefile.in
new file mode 100644
index 0000000..efab90c
--- /dev/null
+++ b/doc/Makefile.in
@@ -0,0 +1,352 @@
+# Makefile.in generated by automake 1.9.2 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004  Free Software Foundation, Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+srcdir = @srcdir@
+top_srcdir = @top_srcdir@
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+top_builddir = ..
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+INSTALL = @INSTALL@
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+build_triplet = @build@
+host_triplet = @host@
+subdir = doc
+DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/m4/aclibgd.m4 \
+	$(top_srcdir)/configure.in
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs
+CONFIG_HEADER = $(top_builddir)/src/config.h
+CONFIG_CLEAN_FILES =
+SOURCES =
+DIST_SOURCES =
+man1dir = $(mandir)/man1
+am__installdirs = "$(DESTDIR)$(man1dir)"
+NROFF = nroff
+MANS = $(man_MANS)
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+ACLOCAL = @ACLOCAL@
+AMDEP_FALSE = @AMDEP_FALSE@
+AMDEP_TRUE = @AMDEP_TRUE@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CC = @CC@
+CCDEPMODE = @CCDEPMODE@
+CFLAGS = @CFLAGS@
+CPP = @CPP@
+CPPFLAGS = @CPPFLAGS@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+DEPDIR = @DEPDIR@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+EGREP = @EGREP@
+EXEEXT = @EXEEXT@
+GNUPLOT = @GNUPLOT@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LDFLAGS = @LDFLAGS@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+OBJEXT = @OBJEXT@
+OS_CPPFLAGS = @OS_CPPFLAGS@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+POD2MAN = @POD2MAN@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+USE_GD_LIB_SRC_FALSE = @USE_GD_LIB_SRC_FALSE@
+USE_GD_LIB_SRC_TRUE = @USE_GD_LIB_SRC_TRUE@
+VERSION = @VERSION@
+ac_ct_CC = @ac_ct_CC@
+ac_ct_STRIP = @ac_ct_STRIP@
+am__fastdepCC_FALSE = @am__fastdepCC_FALSE@
+am__fastdepCC_TRUE = @am__fastdepCC_TRUE@
+am__include = @am__include@
+am__leading_dot = @am__leading_dot@
+am__quote = @am__quote@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build = @build@
+build_alias = @build_alias@
+build_cpu = @build_cpu@
+build_os = @build_os@
+build_vendor = @build_vendor@
+datadir = @datadir@
+exec_prefix = @exec_prefix@
+host = @host@
+host_alias = @host_alias@
+host_cpu = @host_cpu@
+host_os = @host_os@
+host_vendor = @host_vendor@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+SUFFIXES = .pod .1
+man_MANS = toppred.1
+EXTRA_DIST = $(man_MANS) toppred.pod
+PODARGS = --center='User Manuals' --release='Unix'
+all: all-am
+
+.SUFFIXES:
+.SUFFIXES: .pod .1
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \
+		&& exit 0; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu  doc/Makefile'; \
+	cd $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu  doc/Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+uninstall-info-am:
+install-man1: $(man1_MANS) $(man_MANS)
+	@$(NORMAL_INSTALL)
+	test -z "$(man1dir)" || $(mkdir_p) "$(DESTDIR)$(man1dir)"
+	@list='$(man1_MANS) $(dist_man1_MANS) $(nodist_man1_MANS)'; \
+	l2='$(man_MANS) $(dist_man_MANS) $(nodist_man_MANS)'; \
+	for i in $$l2; do \
+	  case "$$i" in \
+	    *.1*) list="$$list $$i" ;; \
+	  esac; \
+	done; \
+	for i in $$list; do \
+	  if test -f $(srcdir)/$$i; then file=$(srcdir)/$$i; \
+	  else file=$$i; fi; \
+	  ext=`echo $$i | sed -e 's/^.*\\.//'`; \
+	  case "$$ext" in \
+	    1*) ;; \
+	    *) ext='1' ;; \
+	  esac; \
+	  inst=`echo $$i | sed -e 's/\\.[0-9a-z]*$$//'`; \
+	  inst=`echo $$inst | sed -e 's/^.*\///'`; \
+	  inst=`echo $$inst | sed '$(transform)'`.$$ext; \
+	  echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man1dir)/$$inst'"; \
+	  $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man1dir)/$$inst"; \
+	done
+uninstall-man1:
+	@$(NORMAL_UNINSTALL)
+	@list='$(man1_MANS) $(dist_man1_MANS) $(nodist_man1_MANS)'; \
+	l2='$(man_MANS) $(dist_man_MANS) $(nodist_man_MANS)'; \
+	for i in $$l2; do \
+	  case "$$i" in \
+	    *.1*) list="$$list $$i" ;; \
+	  esac; \
+	done; \
+	for i in $$list; do \
+	  ext=`echo $$i | sed -e 's/^.*\\.//'`; \
+	  case "$$ext" in \
+	    1*) ;; \
+	    *) ext='1' ;; \
+	  esac; \
+	  inst=`echo $$i | sed -e 's/\\.[0-9a-z]*$$//'`; \
+	  inst=`echo $$inst | sed -e 's/^.*\///'`; \
+	  inst=`echo $$inst | sed '$(transform)'`.$$ext; \
+	  echo " rm -f '$(DESTDIR)$(man1dir)/$$inst'"; \
+	  rm -f "$(DESTDIR)$(man1dir)/$$inst"; \
+	done
+tags: TAGS
+TAGS:
+
+ctags: CTAGS
+CTAGS:
+
+
+distdir: $(DISTFILES)
+	@srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \
+	list='$(DISTFILES)'; for file in $$list; do \
+	  case $$file in \
+	    $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \
+	    $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \
+	  esac; \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \
+	  if test "$$dir" != "$$file" && test "$$dir" != "."; then \
+	    dir="/$$dir"; \
+	    $(mkdir_p) "$(distdir)$$dir"; \
+	  else \
+	    dir=''; \
+	  fi; \
+	  if test -d $$d/$$file; then \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \
+	    fi; \
+	    cp -pR $$d/$$file $(distdir)$$dir || exit 1; \
+	  else \
+	    test -f $(distdir)/$$file \
+	    || cp -p $$d/$$file $(distdir)/$$file \
+	    || exit 1; \
+	  fi; \
+	done
+check-am: all-am
+check: check-am
+all-am: Makefile $(MANS)
+installdirs:
+	for dir in "$(DESTDIR)$(man1dir)"; do \
+	  test -z "$$dir" || $(mkdir_p) "$$dir"; \
+	done
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-am
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+info: info-am
+
+info-am:
+
+install-data-am: install-man
+
+install-exec-am:
+
+install-info: install-info-am
+
+install-man: install-man1
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-info-am uninstall-man
+
+uninstall-man: uninstall-man1
+
+.PHONY: all all-am check check-am clean clean-generic distclean \
+	distclean-generic distdir dvi dvi-am html html-am info info-am \
+	install install-am install-data install-data-am install-exec \
+	install-exec-am install-info install-info-am install-man \
+	install-man1 install-strip installcheck installcheck-am \
+	installdirs maintainer-clean maintainer-clean-generic \
+	mostlyclean mostlyclean-generic pdf pdf-am ps ps-am uninstall \
+	uninstall-am uninstall-info-am uninstall-man uninstall-man1
+
+
+.pod.1:
+	$(POD2MAN) $(PODARGS) $< > $@ && touch $@
+
+parano:
+	(for p in *.pod; do podchecker --warnings --warnings $$p; done)
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:
diff --git a/doc/toppred.1 b/doc/toppred.1
new file mode 100644
index 0000000..5e65bb6
--- /dev/null
+++ b/doc/toppred.1
@@ -0,0 +1,341 @@
+.\" Automatically generated by Pod::Man v1.37, Pod::Parser v1.3
+.\"
+.\" Standard preamble:
+.\" ========================================================================
+.de Sh \" Subsection heading
+.br
+.if t .Sp
+.ne 5
+.PP
+\fB\\$1\fR
+.PP
+..
+.de Sp \" Vertical space (when we can't use .PP)
+.if t .sp .5v
+.if n .sp
+..
+.de Vb \" Begin verbatim text
+.ft CW
+.nf
+.ne \\$1
+..
+.de Ve \" End verbatim text
+.ft R
+.fi
+..
+.\" Set up some character translations and predefined strings.  \*(-- will
+.\" give an unbreakable dash, \*(PI will give pi, \*(L" will give a left
+.\" double quote, and \*(R" will give a right double quote.  | will give a
+.\" real vertical bar.  \*(C+ will give a nicer C++.  Capital omega is used to
+.\" do unbreakable dashes and therefore won't be available.  \*(C` and \*(C'
+.\" expand to `' in nroff, nothing in troff, for use with C<>.
+.tr \(*W-|\(bv\*(Tr
+.ds C+ C\v'-.1v'\h'-1p'\s-2+\h'-1p'+\s0\v'.1v'\h'-1p'
+.ie n \{\
+.    ds -- \(*W-
+.    ds PI pi
+.    if (\n(.H=4u)&(1m=24u) .ds -- \(*W\h'-12u'\(*W\h'-12u'-\" diablo 10 pitch
+.    if (\n(.H=4u)&(1m=20u) .ds -- \(*W\h'-12u'\(*W\h'-8u'-\"  diablo 12 pitch
+.    ds L" ""
+.    ds R" ""
+.    ds C` ""
+.    ds C' ""
+'br\}
+.el\{\
+.    ds -- \|\(em\|
+.    ds PI \(*p
+.    ds L" ``
+.    ds R" ''
+'br\}
+.\"
+.\" If the F register is turned on, we'll generate index entries on stderr for
+.\" titles (.TH), headers (.SH), subsections (.Sh), items (.Ip), and index
+.\" entries marked with X<> in POD.  Of course, you'll have to process the
+.\" output yourself in some meaningful fashion.
+.if \nF \{\
+.    de IX
+.    tm Index:\\$1\t\\n%\t"\\$2"
+..
+.    nr % 0
+.    rr F
+.\}
+.\"
+.\" For nroff, turn off justification.  Always turn off hyphenation; it makes
+.\" way too many mistakes in technical documents.
+.hy 0
+.if n .na
+.\"
+.\" Accent mark definitions (@(#)ms.acc 1.5 88/02/08 SMI; from UCB 4.2).
+.\" Fear.  Run.  Save yourself.  No user-serviceable parts.
+.    \" fudge factors for nroff and troff
+.if n \{\
+.    ds #H 0
+.    ds #V .8m
+.    ds #F .3m
+.    ds #[ \f1
+.    ds #] \fP
+.\}
+.if t \{\
+.    ds #H ((1u-(\\\\n(.fu%2u))*.13m)
+.    ds #V .6m
+.    ds #F 0
+.    ds #[ \&
+.    ds #] \&
+.\}
+.    \" simple accents for nroff and troff
+.if n \{\
+.    ds ' \&
+.    ds ` \&
+.    ds ^ \&
+.    ds , \&
+.    ds ~ ~
+.    ds /
+.\}
+.if t \{\
+.    ds ' \\k:\h'-(\\n(.wu*8/10-\*(#H)'\'\h"|\\n:u"
+.    ds ` \\k:\h'-(\\n(.wu*8/10-\*(#H)'\`\h'|\\n:u'
+.    ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'^\h'|\\n:u'
+.    ds , \\k:\h'-(\\n(.wu*8/10)',\h'|\\n:u'
+.    ds ~ \\k:\h'-(\\n(.wu-\*(#H-.1m)'~\h'|\\n:u'
+.    ds / \\k:\h'-(\\n(.wu*8/10-\*(#H)'\z\(sl\h'|\\n:u'
+.\}
+.    \" troff and (daisy-wheel) nroff accents
+.ds : \\k:\h'-(\\n(.wu*8/10-\*(#H+.1m+\*(#F)'\v'-\*(#V'\z.\h'.2m+\*(#F'.\h'|\\n:u'\v'\*(#V'
+.ds 8 \h'\*(#H'\(*b\h'-\*(#H'
+.ds o \\k:\h'-(\\n(.wu+\w'\(de'u-\*(#H)/2u'\v'-.3n'\*(#[\z\(de\v'.3n'\h'|\\n:u'\*(#]
+.ds d- \h'\*(#H'\(pd\h'-\w'~'u'\v'-.25m'\f2\(hy\fP\v'.25m'\h'-\*(#H'
+.ds D- D\\k:\h'-\w'D'u'\v'-.11m'\z\(hy\v'.11m'\h'|\\n:u'
+.ds th \*(#[\v'.3m'\s+1I\s-1\v'-.3m'\h'-(\w'I'u*2/3)'\s-1o\s+1\*(#]
+.ds Th \*(#[\s+2I\s-2\h'-\w'I'u*3/5'\v'-.3m'o\v'.3m'\*(#]
+.ds ae a\h'-(\w'a'u*4/10)'e
+.ds Ae A\h'-(\w'A'u*4/10)'E
+.    \" corrections for vroff
+.if v .ds ~ \\k:\h'-(\\n(.wu*9/10-\*(#H)'\s-2\u~\d\s+2\h'|\\n:u'
+.if v .ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'\v'-.4m'^\v'.4m'\h'|\\n:u'
+.    \" for low resolution devices (crt and lpr)
+.if \n(.H>23 .if \n(.V>19 \
+\{\
+.    ds : e
+.    ds 8 ss
+.    ds o a
+.    ds d- d\h'-1'\(ga
+.    ds D- D\h'-1'\(hy
+.    ds th \o'bp'
+.    ds Th \o'LP'
+.    ds ae ae
+.    ds Ae AE
+.\}
+.rm #[ #] #H #V #F C
+.\" ========================================================================
+.\"
+.IX Title "TOPPRED 1"
+.TH TOPPRED 1 "2008-05-06" "Unix" "User Manuals"
+.SH "NAME"
+.IP "\fBtoppred\fR \- Transmembrane topology prediction." 4
+.IX Item "toppred - Transmembrane topology prediction."
+.SH "SYNOPSIS"
+.IX Header "SYNOPSIS"
+.PD 0
+.IP "\fBtoppred\fR [options] <\fIseq data\fR> ..." 4
+.IX Item "toppred [options] <seq data> ..."
+.PD
+.SH "OPTIONS"
+.IX Header "OPTIONS"
+Following command line options are allowed:
+.IP "\-c \fIvalue\fR" 4
+.IX Item "-c value"
+Use \fIvalue\fR as certain cut-off value. Default is 1.
+.IP "\-d \fIval\fR" 4
+.IX Item "-d val"
+Use \fIval\fR as critical distance between 2 transmembrane segments.
+If 2 calculated segments are separated by a distance smaller than
+\&\fIval\fR amino-acids only the segment with best hydrophobicity value is
+taken in account. Default is 2.
+.IP "\-e" 4
+.IX Item "-e"
+switch the cyt-ext calculus to Eucaryotes. Default is Procaryotes.
+.IP "\-g \fIformat\fR" 4
+.IX Item "-g format"
+Produce or display hydrophobic profile in specified \fIformat\fR.
+Currently the supported values for format are:
+.RS 4
+.IP "\fBx11\fR  : display the graph on screen (default)." 1
+.IX Item "x11  : display the graph on screen (default)."
+.PD 0
+.IP "\fBps\fR   : produce a .ps file." 1
+.IX Item "ps   : produce a .ps file."
+.IP "\fBpng\fR  : produce a .png file." 1
+.IX Item "png  : produce a .png file."
+.IP "\fBppm\fR  : produce a .ppm file." 1
+.IX Item "ppm  : produce a .ppm file."
+.IP "\fBnone\fR : no profile is produced." 1
+.IX Item "none : no profile is produced."
+.RE
+.RS 4
+.PD
+.Sp
+\&\fBWarning:\fR this option and the related values are \fBonly\fR available
+if toppred is compiled with the gnuplot support.
+.RE
+.IP "\-h" 4
+.IX Item "-h"
+Usage display.
+.IP "\-H \fIfile\fR" 4
+.IX Item "-H file"
+Load hydrophobicity scale from \fIfile\fR, default is GES\-scale.
+Accepted values are either:
+.RS 4
+.IP "\fBKD-scale\fR  : (Kyte and Doolittle, J. Mol. Biol (1982) 157, 105\-132 )" 1
+.IX Item "KD-scale  : (Kyte and Doolittle, J. Mol. Biol (1982) 157, 105-132 )"
+.PD 0
+.IP "\fBGES-scale\fR : (Goldman Engelman Steitz Ann. Rev. Biophys. Biophys. Chem. 1986 15/ 321 53)" 1
+.IX Item "GES-scale : (Goldman Engelman Steitz Ann. Rev. Biophys. Biophys. Chem. 1986 15/ 321 53)"
+.IP "\fBGVH-scale\fR : (Gunnar von Heijne J. Mol. Biol. (1992) 225, 487\-494)" 1
+.IX Item "GVH-scale : (Gunnar von Heijne J. Mol. Biol. (1992) 225, 487-494)"
+.IP "either your own hydrophobicity scale file. In this case the hydrophobicity scale file must be located in the working directory." 1
+.IX Item "either your own hydrophobicity scale file. In this case the hydrophobicity scale file must be located in the working directory."
+.RE
+.RS 4
+.PD
+.Sp
+In order to use your own hydrophobicity scale file, see the format of
+the supported scale files in the toppred data directory on your
+system; look in \fI/usr/share/toppred/\fRor \fI/usr/local/share/toppred/\fR,
+or ask your system administrator.
+.RE
+.IP "\-n \fIvalue\fR" 4
+.IX Item "-n value"
+Use \fIvalue\fR as a core window length, default is 11.
+.IP "\-o \fIfile\fR" 4
+.IX Item "-o file"
+Place the output into \fIfile\fR, and store all other files to the same
+directory than \fIfile\fR.
+.IP "\-O \fIformat\fR" 4
+.IX Item "-O format"
+Print output in the specified \fIformat\fR. Supported values are: \fBold\fR:
+old toppred output format, \fBnew\fR: new toppred output format (the
+default value), \fBhtml\fR: produce an html page per sequence, note that
+if not specified hydrophobic profile and topologies representation are
+forced in png format.
+.IP "\-p \fIvalue\fR" 4
+.IX Item "-p value"
+Use \fIvalue\fR as putative cut\-off, default is 0.6.
+.IP "\-q \fIvalue\fR" 4
+.IX Item "-q value"
+Use \fIvalue\fR as wedge window length, default is 5.
+.IP "\-s \fIvalue\fR" 4
+.IX Item "-s value"
+Use \fIvalue\fR as critical loop length. If a loop between 2
+transmembrane segments has a length greater than \fIval\fR the Lys/Arg
+ratio is not taken in account to determine the topologies. Default is
+60.
+.IP "\-t \fIformat\fR" 4
+.IX Item "-t format"
+Produce images of the topologies in specified \fIformat\fR. Currently the
+supported values for format are: \fBpng\fR: produces images of the
+topologies in png format, \fBnone\fR: no graphic representation of the
+topologies is produced. Default is png.
+.Sp
+\&\fBWarning:\fR this option and the related values are \fBonly\fR available
+if toppred is compiled with the libgdb support.
+.IP "\-v" 4
+.IX Item "-v"
+Display the version number.
+.SH "FORMAT"
+.IX Header "FORMAT"
+\&\fBtoppred\fR only handles fasta sequence format as input.
+.PP
+\&\fBtoppred\fR handles 2 output format via the \fB\-O\fR flag.
+.SH "DESCRIPTION"
+.IX Header "DESCRIPTION"
+\&\fBtoppred\fR is a program to determine the topology of a transmembrane
+protein based on G. von Heijne algorithm.
+.PP
+\&\*(L"Membrane protein structure prediction. Hydrophobicity analysis
+and the positive-inside rule.\*(R"
+J. Mol. Biol. 1992 225,487\-494.
+.PP
+Each sequence from \fIseq data\fR in fasta format is processed, and
+\&\fBtoppred\fR generate the Hydrophobycity profile of the sequence, and
+the corresponding hydrophobycities values in the file
+<\fBsequence-ID\fR>\fB.hydro\fR.
+.PP
+Furthermore, the predicted topologies are represented as png images.
+Each topology is stored in file
+<\fBsequence-ID\fR>\fB\-\fR<\fBnumber\fR>\fB.png\fR
+.PP
+The hydrophobicity profile is computed using a window formed by a core
+rectangular window of size n, flanked by 2 triangular windows of size
+q. \s-1NB\s0 rectangular and triangular mean that the ponderation values
+inside those windows are respectively constant and variable.
+.PP
+The hydrophobicity profile is computed using the following window
+.PP
+.Vb 7
+\&        ->     n     <-
+\&          ___________
+\&         /|         |\e
+\&        / |         | \e
+\&       /__|_________|__\e
+\&     -> q  <-     -> q  <-
+\&     ->   l = n + 2q    <-
+.Ve
+.PP
+Thus one can use a rectangular window by setting q to 0.
+.PP
+\&\fBtoppred\fR produces the following output files, depending on the
+command line options
+.IP "\fBfoo.hydro\fR" 4
+.IX Item "foo.hydro"
+File containing the hydrophobic values for the sequence \fBfoo\fR.
+.IP "\fBfoo.ps\fR, \fBfoo.ppm\fR, \fBfoo.png\fR" 4
+.IX Item "foo.ps, foo.ppm, foo.png"
+Image representing the hydrophobic profile for the sequence \fBfoo\fR in
+postcript, ppm or png format depending on the \-g option value
+specified on command line, respectively \-g ps, \-g ppm or \-g png.
+.IP "\fBfoo\-1.png\fR ... \fBfoo\-n.png\fR" 4
+.IX Item "foo-1.png ... foo-n.png"
+Image representing the graphic representation of the predicted
+topology \fB1\fR... \fBn\fR for the sequence \fBfoo\fR in png format if the \-t
+png option is given on the command line.
+.SH "ENVIRONMENT"
+.IX Header "ENVIRONMENT"
+\&\fB\s-1TOPPREDDATA\s0\fR could be used to specify an alternate toppred data
+folder
+.SH "EXAMPLES"
+.IX Header "EXAMPLES"
+Consider the fasta formated sequence \fBfoo\fR in file \fBbar\fR.
+.IP "\fBtoppred\fR \fIbar\fR" 4
+.IX Item "toppred bar"
+Process all sequences in fasta format from \fIbar\fR, display for each
+sequence the hydrophobicity profile, produce the corresponding
+\&\fBfoo.hydro\fR and the corresponding \fBfoo\fR\fB\-\fR<\fB#\fR>\fB.png\fR
+graphical topologies representation as png images.
+.IP "\fBtoppred\fR \-g ps \fIbar\fR" 4
+.IX Item "toppred -g ps bar"
+Same as previous, except that instead of displaying the hydrophobicity
+profile on screen, this one is produced in a postcript format image
+\&\fBfoo.ps\fR
+.IP "\fBtoppred\fR \-g none \fIbar\fR" 4
+.IX Item "toppred -g none bar"
+Same a previous, except that the hydrophobicity profile is not
+displayed neither produced.
+.IP "\fBtoppred\fR \-g none \-t none \fIbar\fR" 4
+.IX Item "toppred -g none -t none bar"
+Same a previous, except that neither the hydrophobicity profile
+neither the graphical topologies representation are not produced
+.IP "\fBtoppred\fR \-H KD-scale \fIbar\fR" 4
+.IX Item "toppred -H KD-scale bar"
+Use \s-1KD\s0 scale instead of default \s-1GES\s0 scale, while processing sequences.
+.IP "\fBtoppred\fR \-O html \-g png \-t none \-o result \fIbar\fR" 4
+.IX Item "toppred -O html -g png -t none -o result bar"
+Write html outpout in file \fIresult\fR, furthermore the hydrophobicity
+profile is produced in \s-1PNG\s0 format and graphics topologies are not
+produced.
+.IP "cat \fIbar\fR | \fBtoppred\fR \-" 4
+.IX Item "cat bar | toppred -"
+\&\fBtoppred\fR is able to read data from stdin.
+.SH "AUTHORS"
+.IX Header "AUTHORS"
+Eric Deveaud <edeveaud at pasteur.fr>, Institut Pasteur and
+Katja Schuerer.
diff --git a/doc/toppred.pod b/doc/toppred.pod
new file mode 100644
index 0000000..7eb9dff
--- /dev/null
+++ b/doc/toppred.pod
@@ -0,0 +1,257 @@
+=pod
+
+=head1 NAME
+
+=over 4
+
+=item B<toppred> - Transmembrane topology prediction.
+
+=back
+
+=head1 SYNOPSIS
+
+=over 4
+
+=item B<toppred> [options] E<lt>F<seq data>E<gt> ...
+
+=back
+
+=head1 OPTIONS
+
+Following command line options are allowed:
+
+=over 4
+
+=item -c F<value>
+
+Use F<value> as certain cut-off value. Default is 1.
+
+=item -d F<val>
+
+Use F<val> as critical distance between 2 transmembrane segments.
+If 2 calculated segments are separated by a distance smaller than
+F<val> amino-acids only the segment with best hydrophobicity value is
+taken in account. Default is 2.
+
+=item -e
+
+switch the cyt-ext calculus to Eucaryotes. Default is Procaryotes.
+
+=item -g F<format>
+
+Produce or display hydrophobic profile in specified F<format>.
+Currently the supported values for format are:
+
+=over 1
+
+=item B<x11>  : display the graph on screen (default).
+
+=item B<ps>   : produce a .ps file.
+
+=item B<png>  : produce a .png file.
+
+=item B<ppm>  : produce a .ppm file.
+
+=item B<none> : no profile is produced.
+
+=back
+
+B<Warning:> this option and the related values are B<only> available
+if toppred is compiled with the gnuplot support.
+
+=item -h
+
+Usage display.
+
+=item -H F<file>
+
+Load hydrophobicity scale from F<file>, default is GES-scale.
+Accepted values are either:
+
+=over 1
+
+=item B<KD-scale>  : (Kyte and Doolittle, J. Mol. Biol (1982) 157, 105-132 )
+
+=item B<GES-scale> : (Goldman Engelman Steitz Ann. Rev. Biophys. Biophys. Chem. 1986 15/ 321 53)
+
+=item B<GVH-scale> : (Gunnar von Heijne J. Mol. Biol. (1992) 225, 487-494)
+
+=item either your own hydrophobicity scale file. In this case the
+hydrophobicity scale file must be located in the working directory.
+
+=back
+
+In order to use your own hydrophobicity scale file, see the format of
+the supported scale files in the toppred data directory on your
+system; look in F</usr/share/toppred/>or F</usr/local/share/toppred/>,
+or ask your system administrator.
+
+=item -n F<value>
+
+Use F<value> as a core window length, default is 11.
+
+=item -o F<file>
+
+Place the output into F<file>, and store all other files to the same
+directory than F<file>.
+
+=item -O F<format>
+
+Print output in the specified F<format>. Supported values are: B<old>:
+old toppred output format, B<new>: new toppred output format (the
+default value), B<html>: produce an html page per sequence, note that
+if not specified hydrophobic profile and topologies representation are
+forced in png format.
+
+=item -p F<value>
+
+Use F<value> as putative cut-off, default is 0.6.
+
+=item -q F<value>
+
+Use F<value> as wedge window length, default is 5.
+
+=item -s F<value>
+
+Use F<value> as critical loop length. If a loop between 2
+transmembrane segments has a length greater than F<val> the Lys/Arg
+ratio is not taken in account to determine the topologies. Default is
+60.
+
+=item -t F<format>
+
+Produce images of the topologies in specified F<format>. Currently the
+supported values for format are: B<png>: produces images of the
+topologies in png format, B<none>: no graphic representation of the
+topologies is produced. Default is png.
+
+B<Warning:> this option and the related values are B<only> available
+if toppred is compiled with the libgdb support.
+
+=item -v
+
+Display the version number.
+
+=back
+
+=head1 FORMAT
+
+B<toppred> only handles fasta sequence format as input.
+
+B<toppred> handles 2 output format via the B<-O> flag.
+
+
+=head1 DESCRIPTION
+
+B<toppred> is a program to determine the topology of a transmembrane
+protein based on G. von Heijne algorithm.
+
+"Membrane protein structure prediction. Hydrophobicity analysis
+and the positive-inside rule."
+J. Mol. Biol. 1992 225,487-494.
+
+Each sequence from F<seq data> in fasta format is processed, and
+B<toppred> generate the Hydrophobycity profile of the sequence, and
+the corresponding hydrophobycities values in the file
+E<lt>B<sequence-ID>E<gt>B<.hydro>.
+
+Furthermore, the predicted topologies are represented as png images.
+Each topology is stored in file
+E<lt>B<sequence-ID>E<gt>B<->E<lt>B<number>E<gt>B<.png>
+
+The hydrophobicity profile is computed using a window formed by a core
+rectangular window of size n, flanked by 2 triangular windows of size
+q. NB rectangular and triangular mean that the ponderation values
+inside those windows are respectively constant and variable.
+
+The hydrophobicity profile is computed using the following window
+
+        ->     n     <-
+	  ___________
+         /|         |\
+        / |         | \
+       /__|_________|__\
+     -> q  <-     -> q  <-
+     ->   l = n + 2q    <-
+
+Thus one can use a rectangular window by setting q to 0.
+
+B<toppred> produces the following output files, depending on the
+command line options
+
+=over 4
+
+=item B<foo.hydro>
+
+File containing the hydrophobic values for the sequence B<foo>.
+
+=item B<foo.ps>, B<foo.ppm>, B<foo.png>
+
+Image representing the hydrophobic profile for the sequence B<foo> in
+postcript, ppm or png format depending on the -g option value
+specified on command line, respectively -g ps, -g ppm or -g png.
+
+=item B<foo-1.png> ... B<foo-n.png>
+
+Image representing the graphic representation of the predicted
+topology B<1>... B<n> for the sequence B<foo> in png format if the -t
+png option is given on the command line.
+
+=back
+
+=head1 ENVIRONMENT
+
+B<TOPPREDDATA> could be used to specify an alternate toppred data
+folder
+
+=head1 EXAMPLES
+
+Consider the fasta formated sequence B<foo> in file B<bar>.
+
+=over 4
+
+=item B<toppred> F<bar>
+
+Process all sequences in fasta format from F<bar>, display for each
+sequence the hydrophobicity profile, produce the corresponding
+B<foo.hydro> and the corresponding B<foo>B<->E<lt>B<#>E<gt>B<.png>
+graphical topologies representation as png images.
+
+=item B<toppred> -g ps F<bar>
+
+Same as previous, except that instead of displaying the hydrophobicity
+profile on screen, this one is produced in a postcript format image
+B<foo.ps>
+
+=item B<toppred> -g none F<bar>
+
+Same a previous, except that the hydrophobicity profile is not
+displayed neither produced.
+
+=item B<toppred> -g none -t none F<bar>
+
+Same a previous, except that neither the hydrophobicity profile
+neither the graphical topologies representation are not produced
+
+=item B<toppred> -H KD-scale F<bar>
+
+Use KD scale instead of default GES scale, while processing sequences.
+
+=item B<toppred> -O html -g png -t none -o result F<bar>
+
+Write html outpout in file F<result>, furthermore the hydrophobicity
+profile is produced in PNG format and graphics topologies are not
+produced.
+
+=item cat F<bar> | B<toppred> -
+
+B<toppred> is able to read data from stdin.
+
+=back
+
+=head1 AUTHORS
+
+Eric Deveaud E<lt>edeveaud at pasteur.frE<gt>, Institut Pasteur and
+Katja Schuerer.
+
+=cut
diff --git a/install-sh b/install-sh
new file mode 100755
index 0000000..4d4a951
--- /dev/null
+++ b/install-sh
@@ -0,0 +1,323 @@
+#!/bin/sh
+# install - install a program, script, or datafile
+
+scriptversion=2005-05-14.22
+
+# This originates from X11R5 (mit/util/scripts/install.sh), which was
+# later released in X11R6 (xc/config/util/install.sh) with the
+# following copyright and license.
+#
+# Copyright (C) 1994 X Consortium
+#
+# Permission is hereby granted, free of charge, to any person obtaining a copy
+# of this software and associated documentation files (the "Software"), to
+# deal in the Software without restriction, including without limitation the
+# rights to use, copy, modify, merge, publish, distribute, sublicense, and/or
+# sell copies of the Software, and to permit persons to whom the Software is
+# furnished to do so, subject to the following conditions:
+#
+# The above copyright notice and this permission notice shall be included in
+# all copies or substantial portions of the Software.
+#
+# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
+# IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
+# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.  IN NO EVENT SHALL THE
+# X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN
+# AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC-
+# TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+#
+# Except as contained in this notice, the name of the X Consortium shall not
+# be used in advertising or otherwise to promote the sale, use or other deal-
+# ings in this Software without prior written authorization from the X Consor-
+# tium.
+#
+#
+# FSF changes to this file are in the public domain.
+#
+# Calling this script install-sh is preferred over install.sh, to prevent
+# `make' implicit rules from creating a file called install from it
+# when there is no Makefile.
+#
+# This script is compatible with the BSD install script, but was written
+# from scratch.  It can only install one file at a time, a restriction
+# shared with many OS's install programs.
+
+# set DOITPROG to echo to test this script
+
+# Don't use :- since 4.3BSD and earlier shells don't like it.
+doit="${DOITPROG-}"
+
+# put in absolute paths if you don't have them in your path; or use env. vars.
+
+mvprog="${MVPROG-mv}"
+cpprog="${CPPROG-cp}"
+chmodprog="${CHMODPROG-chmod}"
+chownprog="${CHOWNPROG-chown}"
+chgrpprog="${CHGRPPROG-chgrp}"
+stripprog="${STRIPPROG-strip}"
+rmprog="${RMPROG-rm}"
+mkdirprog="${MKDIRPROG-mkdir}"
+
+chmodcmd="$chmodprog 0755"
+chowncmd=
+chgrpcmd=
+stripcmd=
+rmcmd="$rmprog -f"
+mvcmd="$mvprog"
+src=
+dst=
+dir_arg=
+dstarg=
+no_target_directory=
+
+usage="Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE
+   or: $0 [OPTION]... SRCFILES... DIRECTORY
+   or: $0 [OPTION]... -t DIRECTORY SRCFILES...
+   or: $0 [OPTION]... -d DIRECTORIES...
+
+In the 1st form, copy SRCFILE to DSTFILE.
+In the 2nd and 3rd, copy all SRCFILES to DIRECTORY.
+In the 4th, create DIRECTORIES.
+
+Options:
+-c         (ignored)
+-d         create directories instead of installing files.
+-g GROUP   $chgrpprog installed files to GROUP.
+-m MODE    $chmodprog installed files to MODE.
+-o USER    $chownprog installed files to USER.
+-s         $stripprog installed files.
+-t DIRECTORY  install into DIRECTORY.
+-T         report an error if DSTFILE is a directory.
+--help     display this help and exit.
+--version  display version info and exit.
+
+Environment variables override the default commands:
+  CHGRPPROG CHMODPROG CHOWNPROG CPPROG MKDIRPROG MVPROG RMPROG STRIPPROG
+"
+
+while test -n "$1"; do
+  case $1 in
+    -c) shift
+        continue;;
+
+    -d) dir_arg=true
+        shift
+        continue;;
+
+    -g) chgrpcmd="$chgrpprog $2"
+        shift
+        shift
+        continue;;
+
+    --help) echo "$usage"; exit $?;;
+
+    -m) chmodcmd="$chmodprog $2"
+        shift
+        shift
+        continue;;
+
+    -o) chowncmd="$chownprog $2"
+        shift
+        shift
+        continue;;
+
+    -s) stripcmd=$stripprog
+        shift
+        continue;;
+
+    -t) dstarg=$2
+	shift
+	shift
+	continue;;
+
+    -T) no_target_directory=true
+	shift
+	continue;;
+
+    --version) echo "$0 $scriptversion"; exit $?;;
+
+    *)  # When -d is used, all remaining arguments are directories to create.
+	# When -t is used, the destination is already specified.
+	test -n "$dir_arg$dstarg" && break
+        # Otherwise, the last argument is the destination.  Remove it from $@.
+	for arg
+	do
+          if test -n "$dstarg"; then
+	    # $@ is not empty: it contains at least $arg.
+	    set fnord "$@" "$dstarg"
+	    shift # fnord
+	  fi
+	  shift # arg
+	  dstarg=$arg
+	done
+	break;;
+  esac
+done
+
+if test -z "$1"; then
+  if test -z "$dir_arg"; then
+    echo "$0: no input file specified." >&2
+    exit 1
+  fi
+  # It's OK to call `install-sh -d' without argument.
+  # This can happen when creating conditional directories.
+  exit 0
+fi
+
+for src
+do
+  # Protect names starting with `-'.
+  case $src in
+    -*) src=./$src ;;
+  esac
+
+  if test -n "$dir_arg"; then
+    dst=$src
+    src=
+
+    if test -d "$dst"; then
+      mkdircmd=:
+      chmodcmd=
+    else
+      mkdircmd=$mkdirprog
+    fi
+  else
+    # Waiting for this to be detected by the "$cpprog $src $dsttmp" command
+    # might cause directories to be created, which would be especially bad
+    # if $src (and thus $dsttmp) contains '*'.
+    if test ! -f "$src" && test ! -d "$src"; then
+      echo "$0: $src does not exist." >&2
+      exit 1
+    fi
+
+    if test -z "$dstarg"; then
+      echo "$0: no destination specified." >&2
+      exit 1
+    fi
+
+    dst=$dstarg
+    # Protect names starting with `-'.
+    case $dst in
+      -*) dst=./$dst ;;
+    esac
+
+    # If destination is a directory, append the input filename; won't work
+    # if double slashes aren't ignored.
+    if test -d "$dst"; then
+      if test -n "$no_target_directory"; then
+	echo "$0: $dstarg: Is a directory" >&2
+	exit 1
+      fi
+      dst=$dst/`basename "$src"`
+    fi
+  fi
+
+  # This sed command emulates the dirname command.
+  dstdir=`echo "$dst" | sed -e 's,/*$,,;s,[^/]*$,,;s,/*$,,;s,^$,.,'`
+
+  # Make sure that the destination directory exists.
+
+  # Skip lots of stat calls in the usual case.
+  if test ! -d "$dstdir"; then
+    defaultIFS='
+	 '
+    IFS="${IFS-$defaultIFS}"
+
+    oIFS=$IFS
+    # Some sh's can't handle IFS=/ for some reason.
+    IFS='%'
+    set x `echo "$dstdir" | sed -e 's@/@%@g' -e 's@^%@/@'`
+    shift
+    IFS=$oIFS
+
+    pathcomp=
+
+    while test $# -ne 0 ; do
+      pathcomp=$pathcomp$1
+      shift
+      if test ! -d "$pathcomp"; then
+        $mkdirprog "$pathcomp"
+	# mkdir can fail with a `File exist' error in case several
+	# install-sh are creating the directory concurrently.  This
+	# is OK.
+	test -d "$pathcomp" || exit
+      fi
+      pathcomp=$pathcomp/
+    done
+  fi
+
+  if test -n "$dir_arg"; then
+    $doit $mkdircmd "$dst" \
+      && { test -z "$chowncmd" || $doit $chowncmd "$dst"; } \
+      && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } \
+      && { test -z "$stripcmd" || $doit $stripcmd "$dst"; } \
+      && { test -z "$chmodcmd" || $doit $chmodcmd "$dst"; }
+
+  else
+    dstfile=`basename "$dst"`
+
+    # Make a couple of temp file names in the proper directory.
+    dsttmp=$dstdir/_inst.$$_
+    rmtmp=$dstdir/_rm.$$_
+
+    # Trap to clean up those temp files at exit.
+    trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0
+    trap '(exit $?); exit' 1 2 13 15
+
+    # Copy the file name to the temp name.
+    $doit $cpprog "$src" "$dsttmp" &&
+
+    # and set any options; do chmod last to preserve setuid bits.
+    #
+    # If any of these fail, we abort the whole thing.  If we want to
+    # ignore errors from any of these, just make sure not to ignore
+    # errors from the above "$doit $cpprog $src $dsttmp" command.
+    #
+    { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } \
+      && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } \
+      && { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } \
+      && { test -z "$chmodcmd" || $doit $chmodcmd "$dsttmp"; } &&
+
+    # Now rename the file to the real destination.
+    { $doit $mvcmd -f "$dsttmp" "$dstdir/$dstfile" 2>/dev/null \
+      || {
+	   # The rename failed, perhaps because mv can't rename something else
+	   # to itself, or perhaps because mv is so ancient that it does not
+	   # support -f.
+
+	   # Now remove or move aside any old file at destination location.
+	   # We try this two ways since rm can't unlink itself on some
+	   # systems and the destination file might be busy for other
+	   # reasons.  In this case, the final cleanup might fail but the new
+	   # file should still install successfully.
+	   {
+	     if test -f "$dstdir/$dstfile"; then
+	       $doit $rmcmd -f "$dstdir/$dstfile" 2>/dev/null \
+	       || $doit $mvcmd -f "$dstdir/$dstfile" "$rmtmp" 2>/dev/null \
+	       || {
+		 echo "$0: cannot unlink or rename $dstdir/$dstfile" >&2
+		 (exit 1); exit 1
+	       }
+	     else
+	       :
+	     fi
+	   } &&
+
+	   # Now rename the file to the real destination.
+	   $doit $mvcmd "$dsttmp" "$dstdir/$dstfile"
+	 }
+    }
+  fi || { (exit 1); exit 1; }
+done
+
+# The final little trick to "correctly" pass the exit status to the exit trap.
+{
+  (exit 0); exit 0
+}
+
+# Local variables:
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "scriptversion="
+# time-stamp-format: "%:y-%02m-%02d.%02H"
+# time-stamp-end: "$"
+# End:
diff --git a/m4/Makefile.am b/m4/Makefile.am
new file mode 100644
index 0000000..cf32e83
--- /dev/null
+++ b/m4/Makefile.am
@@ -0,0 +1,2 @@
+# EXTRA_DIST = chek_pngdriver.m4
+EXTRA_DIST = aclibgd.m4
diff --git a/m4/Makefile.in b/m4/Makefile.in
new file mode 100644
index 0000000..80a057d
--- /dev/null
+++ b/m4/Makefile.in
@@ -0,0 +1,290 @@
+# Makefile.in generated by automake 1.9.2 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004  Free Software Foundation, Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+srcdir = @srcdir@
+top_srcdir = @top_srcdir@
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+top_builddir = ..
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+INSTALL = @INSTALL@
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+build_triplet = @build@
+host_triplet = @host@
+subdir = m4
+DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/m4/aclibgd.m4 \
+	$(top_srcdir)/configure.in
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs
+CONFIG_HEADER = $(top_builddir)/src/config.h
+CONFIG_CLEAN_FILES =
+SOURCES =
+DIST_SOURCES =
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+ACLOCAL = @ACLOCAL@
+AMDEP_FALSE = @AMDEP_FALSE@
+AMDEP_TRUE = @AMDEP_TRUE@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CC = @CC@
+CCDEPMODE = @CCDEPMODE@
+CFLAGS = @CFLAGS@
+CPP = @CPP@
+CPPFLAGS = @CPPFLAGS@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+DEPDIR = @DEPDIR@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+EGREP = @EGREP@
+EXEEXT = @EXEEXT@
+GNUPLOT = @GNUPLOT@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LDFLAGS = @LDFLAGS@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+OBJEXT = @OBJEXT@
+OS_CPPFLAGS = @OS_CPPFLAGS@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+POD2MAN = @POD2MAN@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+USE_GD_LIB_SRC_FALSE = @USE_GD_LIB_SRC_FALSE@
+USE_GD_LIB_SRC_TRUE = @USE_GD_LIB_SRC_TRUE@
+VERSION = @VERSION@
+ac_ct_CC = @ac_ct_CC@
+ac_ct_STRIP = @ac_ct_STRIP@
+am__fastdepCC_FALSE = @am__fastdepCC_FALSE@
+am__fastdepCC_TRUE = @am__fastdepCC_TRUE@
+am__include = @am__include@
+am__leading_dot = @am__leading_dot@
+am__quote = @am__quote@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build = @build@
+build_alias = @build_alias@
+build_cpu = @build_cpu@
+build_os = @build_os@
+build_vendor = @build_vendor@
+datadir = @datadir@
+exec_prefix = @exec_prefix@
+host = @host@
+host_alias = @host_alias@
+host_cpu = @host_cpu@
+host_os = @host_os@
+host_vendor = @host_vendor@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+
+# EXTRA_DIST = chek_pngdriver.m4
+EXTRA_DIST = aclibgd.m4
+all: all-am
+
+.SUFFIXES:
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \
+		&& exit 0; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu  m4/Makefile'; \
+	cd $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu  m4/Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+uninstall-info-am:
+tags: TAGS
+TAGS:
+
+ctags: CTAGS
+CTAGS:
+
+
+distdir: $(DISTFILES)
+	@srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \
+	list='$(DISTFILES)'; for file in $$list; do \
+	  case $$file in \
+	    $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \
+	    $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \
+	  esac; \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \
+	  if test "$$dir" != "$$file" && test "$$dir" != "."; then \
+	    dir="/$$dir"; \
+	    $(mkdir_p) "$(distdir)$$dir"; \
+	  else \
+	    dir=''; \
+	  fi; \
+	  if test -d $$d/$$file; then \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \
+	    fi; \
+	    cp -pR $$d/$$file $(distdir)$$dir || exit 1; \
+	  else \
+	    test -f $(distdir)/$$file \
+	    || cp -p $$d/$$file $(distdir)/$$file \
+	    || exit 1; \
+	  fi; \
+	done
+check-am: all-am
+check: check-am
+all-am: Makefile
+installdirs:
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-am
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+info: info-am
+
+info-am:
+
+install-data-am:
+
+install-exec-am:
+
+install-info: install-info-am
+
+install-man:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-info-am
+
+.PHONY: all all-am check check-am clean clean-generic distclean \
+	distclean-generic distdir dvi dvi-am html html-am info info-am \
+	install install-am install-data install-data-am install-exec \
+	install-exec-am install-info install-info-am install-man \
+	install-strip installcheck installcheck-am installdirs \
+	maintainer-clean maintainer-clean-generic mostlyclean \
+	mostlyclean-generic pdf pdf-am ps ps-am uninstall uninstall-am \
+	uninstall-info-am
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:
diff --git a/m4/aclibgd.m4 b/m4/aclibgd.m4
new file mode 100644
index 0000000..e852f2b
--- /dev/null
+++ b/m4/aclibgd.m4
@@ -0,0 +1,92 @@
+dnl libgd checker for autoconf.
+dnl
+dnl Cheks for the gd/png/zlib library and all necessary stuff.
+dnl
+
+AC_DEFUN([GD_CHECK],
+#
+# Handle user hints
+#
+[
+ AC_MSG_CHECKING([if libgd is wanted])
+ 
+ AC_ARG_WITH([libgd],
+  [  --with-libgd=DIR root directory path of libgd installation
+		   defaults to /usr and /usr/local
+  --without-libgd to disable libgd usage completely (not yet implemented)],
+  [
+    #
+    # Run this if -with or -without was specified
+    #
+    if test "$withval" != no ; then
+       AC_MSG_RESULT(yes)
+       LIBGD_WANTED=yes
+       if test "$withval" != yes ; then
+         LIBGD_HOME_DIR="$withval"
+       fi
+    else
+       LIBGD_WANTED=no
+       AC_MSG_RESULT(no)
+    fi]
+  ,[
+   # Nothing was said I assume libgd is needed
+   
+    LIBGD_WANTED=yes
+    AC_MSG_RESULT(yes)
+  ])
+
+
+
+# just do the job if libgd is wanted
+if test $LIBGD_WANTED = yes; then
+ 
+    # save the state at begining
+    _old_LDFLAGS=$LDFLAGS
+    _old_CPPFLAGS=$CPPFLAGS
+
+    # perform search in various directory.
+    AC_MSG_CHECKING([for libgd with png support])
+    for _search_dir_to_inc in "$LIBGD_HOME_DIR"  /usr /usr/local ; do
+
+	LDFLAGS="$_old_LDFLAGS -L${_search_dir_to_inc}/lib"
+	CPPFLAGS="$_old_CPPFLAGS -I${_search_dir_to_inc}/include"
+
+    
+	AC_TRY_COMPILE([#include "gd.h"] , 
+		       [ gdImagePtr im;
+			 FILE *pngout;
+			 gdImagePng(im, pngout);
+		       ] ,
+		       _compil_ok="yes" )  
+	if test "$_compil_ok" = yes ; then
+	    break
+	fi
+    done
+
+    # if OK, then just add the library to $LIBS, 
+    # else reset to the initial state
+
+    if test "$_compil_ok" = yes ; then
+	AC_MSG_RESULT([yes])
+	AC_DEFINE(HAVE_LIBGD, 1, is libgd present)
+	LIBS="$LIBS -lgd -lpng -lz"
+	if  test -z "$_search_dir_to_inc" ; then
+       	   LDFLAGS=$_old_LDFLAGS
+	   CPPFLAGS=$_old_CPPFLAGS
+	fi
+    else
+	AC_MSG_RESULT([no])
+	AC_MSG_WARN([libgd not found, graphic topologies will be unavailable])
+    fi
+    AM_CONDITIONAL(USE_GD_LIB_SRC, test "$_compil_ok")
+    # if libgd is not wanted, disable some piece of code
+    # still to implement
+    # I'm thinking about 
+    # setting up a #define and check for it in the code.
+
+fi
+])
+
+
+
+
diff --git a/missing b/missing
new file mode 100755
index 0000000..894e786
--- /dev/null
+++ b/missing
@@ -0,0 +1,360 @@
+#! /bin/sh
+# Common stub for a few missing GNU programs while installing.
+
+scriptversion=2005-06-08.21
+
+# Copyright (C) 1996, 1997, 1999, 2000, 2002, 2003, 2004, 2005
+#   Free Software Foundation, Inc.
+# Originally by Fran,cois Pinard <pinard at iro.umontreal.ca>, 1996.
+
+# This program is free software; you can redistribute it and/or modify
+# it under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 2, or (at your option)
+# any later version.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software
+# Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA
+# 02110-1301, USA.
+
+# As a special exception to the GNU General Public License, if you
+# distribute this file as part of a program that contains a
+# configuration script generated by Autoconf, you may include it under
+# the same distribution terms that you use for the rest of that program.
+
+if test $# -eq 0; then
+  echo 1>&2 "Try \`$0 --help' for more information"
+  exit 1
+fi
+
+run=:
+
+# In the cases where this matters, `missing' is being run in the
+# srcdir already.
+if test -f configure.ac; then
+  configure_ac=configure.ac
+else
+  configure_ac=configure.in
+fi
+
+msg="missing on your system"
+
+case "$1" in
+--run)
+  # Try to run requested program, and just exit if it succeeds.
+  run=
+  shift
+  "$@" && exit 0
+  # Exit code 63 means version mismatch.  This often happens
+  # when the user try to use an ancient version of a tool on
+  # a file that requires a minimum version.  In this case we
+  # we should proceed has if the program had been absent, or
+  # if --run hadn't been passed.
+  if test $? = 63; then
+    run=:
+    msg="probably too old"
+  fi
+  ;;
+
+  -h|--h|--he|--hel|--help)
+    echo "\
+$0 [OPTION]... PROGRAM [ARGUMENT]...
+
+Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an
+error status if there is no known handling for PROGRAM.
+
+Options:
+  -h, --help      display this help and exit
+  -v, --version   output version information and exit
+  --run           try to run the given command, and emulate it if it fails
+
+Supported PROGRAM values:
+  aclocal      touch file \`aclocal.m4'
+  autoconf     touch file \`configure'
+  autoheader   touch file \`config.h.in'
+  automake     touch all \`Makefile.in' files
+  bison        create \`y.tab.[ch]', if possible, from existing .[ch]
+  flex         create \`lex.yy.c', if possible, from existing .c
+  help2man     touch the output file
+  lex          create \`lex.yy.c', if possible, from existing .c
+  makeinfo     touch the output file
+  tar          try tar, gnutar, gtar, then tar without non-portable flags
+  yacc         create \`y.tab.[ch]', if possible, from existing .[ch]
+
+Send bug reports to <bug-automake at gnu.org>."
+    exit $?
+    ;;
+
+  -v|--v|--ve|--ver|--vers|--versi|--versio|--version)
+    echo "missing $scriptversion (GNU Automake)"
+    exit $?
+    ;;
+
+  -*)
+    echo 1>&2 "$0: Unknown \`$1' option"
+    echo 1>&2 "Try \`$0 --help' for more information"
+    exit 1
+    ;;
+
+esac
+
+# Now exit if we have it, but it failed.  Also exit now if we
+# don't have it and --version was passed (most likely to detect
+# the program).
+case "$1" in
+  lex|yacc)
+    # Not GNU programs, they don't have --version.
+    ;;
+
+  tar)
+    if test -n "$run"; then
+       echo 1>&2 "ERROR: \`tar' requires --run"
+       exit 1
+    elif test "x$2" = "x--version" || test "x$2" = "x--help"; then
+       exit 1
+    fi
+    ;;
+
+  *)
+    if test -z "$run" && ($1 --version) > /dev/null 2>&1; then
+       # We have it, but it failed.
+       exit 1
+    elif test "x$2" = "x--version" || test "x$2" = "x--help"; then
+       # Could not run --version or --help.  This is probably someone
+       # running `$TOOL --version' or `$TOOL --help' to check whether
+       # $TOOL exists and not knowing $TOOL uses missing.
+       exit 1
+    fi
+    ;;
+esac
+
+# If it does not exist, or fails to run (possibly an outdated version),
+# try to emulate it.
+case "$1" in
+  aclocal*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`acinclude.m4' or \`${configure_ac}'.  You might want
+         to install the \`Automake' and \`Perl' packages.  Grab them from
+         any GNU archive site."
+    touch aclocal.m4
+    ;;
+
+  autoconf)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`${configure_ac}'.  You might want to install the
+         \`Autoconf' and \`GNU m4' packages.  Grab them from any GNU
+         archive site."
+    touch configure
+    ;;
+
+  autoheader)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`acconfig.h' or \`${configure_ac}'.  You might want
+         to install the \`Autoconf' and \`GNU m4' packages.  Grab them
+         from any GNU archive site."
+    files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' ${configure_ac}`
+    test -z "$files" && files="config.h"
+    touch_files=
+    for f in $files; do
+      case "$f" in
+      *:*) touch_files="$touch_files "`echo "$f" |
+				       sed -e 's/^[^:]*://' -e 's/:.*//'`;;
+      *) touch_files="$touch_files $f.in";;
+      esac
+    done
+    touch $touch_files
+    ;;
+
+  automake*)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified \`Makefile.am', \`acinclude.m4' or \`${configure_ac}'.
+         You might want to install the \`Automake' and \`Perl' packages.
+         Grab them from any GNU archive site."
+    find . -type f -name Makefile.am -print |
+	   sed 's/\.am$/.in/' |
+	   while read f; do touch "$f"; done
+    ;;
+
+  autom4te)
+    echo 1>&2 "\
+WARNING: \`$1' is needed, but is $msg.
+         You might have modified some files without having the
+         proper tools for further handling them.
+         You can get \`$1' as part of \`Autoconf' from any GNU
+         archive site."
+
+    file=`echo "$*" | sed -n 's/.*--output[ =]*\([^ ]*\).*/\1/p'`
+    test -z "$file" && file=`echo "$*" | sed -n 's/.*-o[ ]*\([^ ]*\).*/\1/p'`
+    if test -f "$file"; then
+	touch $file
+    else
+	test -z "$file" || exec >$file
+	echo "#! /bin/sh"
+	echo "# Created by GNU Automake missing as a replacement of"
+	echo "#  $ $@"
+	echo "exit 0"
+	chmod +x $file
+	exit 1
+    fi
+    ;;
+
+  bison|yacc)
+    echo 1>&2 "\
+WARNING: \`$1' $msg.  You should only need it if
+         you modified a \`.y' file.  You may need the \`Bison' package
+         in order for those modifications to take effect.  You can get
+         \`Bison' from any GNU archive site."
+    rm -f y.tab.c y.tab.h
+    if [ $# -ne 1 ]; then
+        eval LASTARG="\${$#}"
+	case "$LASTARG" in
+	*.y)
+	    SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'`
+	    if [ -f "$SRCFILE" ]; then
+	         cp "$SRCFILE" y.tab.c
+	    fi
+	    SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'`
+	    if [ -f "$SRCFILE" ]; then
+	         cp "$SRCFILE" y.tab.h
+	    fi
+	  ;;
+	esac
+    fi
+    if [ ! -f y.tab.h ]; then
+	echo >y.tab.h
+    fi
+    if [ ! -f y.tab.c ]; then
+	echo 'main() { return 0; }' >y.tab.c
+    fi
+    ;;
+
+  lex|flex)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified a \`.l' file.  You may need the \`Flex' package
+         in order for those modifications to take effect.  You can get
+         \`Flex' from any GNU archive site."
+    rm -f lex.yy.c
+    if [ $# -ne 1 ]; then
+        eval LASTARG="\${$#}"
+	case "$LASTARG" in
+	*.l)
+	    SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'`
+	    if [ -f "$SRCFILE" ]; then
+	         cp "$SRCFILE" lex.yy.c
+	    fi
+	  ;;
+	esac
+    fi
+    if [ ! -f lex.yy.c ]; then
+	echo 'main() { return 0; }' >lex.yy.c
+    fi
+    ;;
+
+  help2man)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+	 you modified a dependency of a manual page.  You may need the
+	 \`Help2man' package in order for those modifications to take
+	 effect.  You can get \`Help2man' from any GNU archive site."
+
+    file=`echo "$*" | sed -n 's/.*-o \([^ ]*\).*/\1/p'`
+    if test -z "$file"; then
+	file=`echo "$*" | sed -n 's/.*--output=\([^ ]*\).*/\1/p'`
+    fi
+    if [ -f "$file" ]; then
+	touch $file
+    else
+	test -z "$file" || exec >$file
+	echo ".ab help2man is required to generate this page"
+	exit 1
+    fi
+    ;;
+
+  makeinfo)
+    echo 1>&2 "\
+WARNING: \`$1' is $msg.  You should only need it if
+         you modified a \`.texi' or \`.texinfo' file, or any other file
+         indirectly affecting the aspect of the manual.  The spurious
+         call might also be the consequence of using a buggy \`make' (AIX,
+         DU, IRIX).  You might want to install the \`Texinfo' package or
+         the \`GNU make' package.  Grab either from any GNU archive site."
+    # The file to touch is that specified with -o ...
+    file=`echo "$*" | sed -n 's/.*-o \([^ ]*\).*/\1/p'`
+    if test -z "$file"; then
+      # ... or it is the one specified with @setfilename ...
+      infile=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'`
+      file=`sed -n '/^@setfilename/ { s/.* \([^ ]*\) *$/\1/; p; q; }' $infile`
+      # ... or it is derived from the source name (dir/f.texi becomes f.info)
+      test -z "$file" && file=`echo "$infile" | sed 's,.*/,,;s,.[^.]*$,,'`.info
+    fi
+    # If the file does not exist, the user really needs makeinfo;
+    # let's fail without touching anything.
+    test -f $file || exit 1
+    touch $file
+    ;;
+
+  tar)
+    shift
+
+    # We have already tried tar in the generic part.
+    # Look for gnutar/gtar before invocation to avoid ugly error
+    # messages.
+    if (gnutar --version > /dev/null 2>&1); then
+       gnutar "$@" && exit 0
+    fi
+    if (gtar --version > /dev/null 2>&1); then
+       gtar "$@" && exit 0
+    fi
+    firstarg="$1"
+    if shift; then
+	case "$firstarg" in
+	*o*)
+	    firstarg=`echo "$firstarg" | sed s/o//`
+	    tar "$firstarg" "$@" && exit 0
+	    ;;
+	esac
+	case "$firstarg" in
+	*h*)
+	    firstarg=`echo "$firstarg" | sed s/h//`
+	    tar "$firstarg" "$@" && exit 0
+	    ;;
+	esac
+    fi
+
+    echo 1>&2 "\
+WARNING: I can't seem to be able to run \`tar' with the given arguments.
+         You may want to install GNU tar or Free paxutils, or check the
+         command line arguments."
+    exit 1
+    ;;
+
+  *)
+    echo 1>&2 "\
+WARNING: \`$1' is needed, and is $msg.
+         You might have modified some files without having the
+         proper tools for further handling them.  Check the \`README' file,
+         it often tells you about the needed prerequisites for installing
+         this package.  You may also peek at any GNU archive site, in case
+         some other package would contain this missing \`$1' program."
+    exit 1
+    ;;
+esac
+
+exit 0
+
+# Local variables:
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "scriptversion="
+# time-stamp-format: "%:y-%02m-%02d.%02H"
+# time-stamp-end: "$"
+# End:
diff --git a/mkinstalldirs b/mkinstalldirs
new file mode 100755
index 0000000..259dbfc
--- /dev/null
+++ b/mkinstalldirs
@@ -0,0 +1,158 @@
+#! /bin/sh
+# mkinstalldirs --- make directory hierarchy
+
+scriptversion=2005-06-29.22
+
+# Original author: Noah Friedman <friedman at prep.ai.mit.edu>
+# Created: 1993-05-16
+# Public domain.
+#
+# This file is maintained in Automake, please report
+# bugs to <bug-automake at gnu.org> or send patches to
+# <automake-patches at gnu.org>.
+
+errstatus=0
+dirmode=
+
+usage="\
+Usage: mkinstalldirs [-h] [--help] [--version] [-m MODE] DIR ...
+
+Create each directory DIR (with mode MODE, if specified), including all
+leading file name components.
+
+Report bugs to <bug-automake at gnu.org>."
+
+# process command line arguments
+while test $# -gt 0 ; do
+  case $1 in
+    -h | --help | --h*)         # -h for help
+      echo "$usage"
+      exit $?
+      ;;
+    -m)                         # -m PERM arg
+      shift
+      test $# -eq 0 && { echo "$usage" 1>&2; exit 1; }
+      dirmode=$1
+      shift
+      ;;
+    --version)
+      echo "$0 $scriptversion"
+      exit $?
+      ;;
+    --)                         # stop option processing
+      shift
+      break
+      ;;
+    -*)                         # unknown option
+      echo "$usage" 1>&2
+      exit 1
+      ;;
+    *)                          # first non-opt arg
+      break
+      ;;
+  esac
+done
+
+for file
+do
+  if test -d "$file"; then
+    shift
+  else
+    break
+  fi
+done
+
+case $# in
+  0) exit 0 ;;
+esac
+
+# Solaris 8's mkdir -p isn't thread-safe.  If you mkdir -p a/b and
+# mkdir -p a/c at the same time, both will detect that a is missing,
+# one will create a, then the other will try to create a and die with
+# a "File exists" error.  This is a problem when calling mkinstalldirs
+# from a parallel make.  We use --version in the probe to restrict
+# ourselves to GNU mkdir, which is thread-safe.
+case $dirmode in
+  '')
+    if mkdir -p --version . >/dev/null 2>&1 && test ! -d ./--version; then
+      echo "mkdir -p -- $*"
+      exec mkdir -p -- "$@"
+    else
+      # On NextStep and OpenStep, the `mkdir' command does not
+      # recognize any option.  It will interpret all options as
+      # directories to create, and then abort because `.' already
+      # exists.
+      test -d ./-p && rmdir ./-p
+      test -d ./--version && rmdir ./--version
+    fi
+    ;;
+  *)
+    if mkdir -m "$dirmode" -p --version . >/dev/null 2>&1 &&
+       test ! -d ./--version; then
+      echo "mkdir -m $dirmode -p -- $*"
+      exec mkdir -m "$dirmode" -p -- "$@"
+    else
+      # Clean up after NextStep and OpenStep mkdir.
+      for d in ./-m ./-p ./--version "./$dirmode";
+      do
+        test -d $d && rmdir $d
+      done
+    fi
+    ;;
+esac
+
+for file
+do
+  case $file in
+    /*) pathcomp=/ ;;
+    *)  pathcomp= ;;
+  esac
+  oIFS=$IFS
+  IFS=/
+  set fnord $file
+  shift
+  IFS=$oIFS
+
+  for d
+  do
+    test "x$d" = x && continue
+
+    pathcomp=$pathcomp$d
+    case $pathcomp in
+      -*) pathcomp=./$pathcomp ;;
+    esac
+
+    if test ! -d "$pathcomp"; then
+      echo "mkdir $pathcomp"
+
+      mkdir "$pathcomp" || lasterr=$?
+
+      if test ! -d "$pathcomp"; then
+	errstatus=$lasterr
+      else
+	if test ! -z "$dirmode"; then
+	  echo "chmod $dirmode $pathcomp"
+	  lasterr=
+	  chmod "$dirmode" "$pathcomp" || lasterr=$?
+
+	  if test ! -z "$lasterr"; then
+	    errstatus=$lasterr
+	  fi
+	fi
+      fi
+    fi
+
+    pathcomp=$pathcomp/
+  done
+done
+
+exit $errstatus
+
+# Local Variables:
+# mode: shell-script
+# sh-indentation: 2
+# eval: (add-hook 'write-file-hooks 'time-stamp)
+# time-stamp-start: "scriptversion="
+# time-stamp-format: "%:y-%02m-%02d.%02H"
+# time-stamp-end: "$"
+# End:
diff --git a/src/Makefile.am b/src/Makefile.am
new file mode 100644
index 0000000..466fce2
--- /dev/null
+++ b/src/Makefile.am
@@ -0,0 +1,27 @@
+
+AM_CPPFLAGS = -DDATADIR=\"$(pkgdatadir)\" $(OS_CPPFLAGS)
+
+bin_PROGRAMS = toppred
+
+if USE_GD_LIB_SRC
+extra_src=graph.c
+extra_header=graph.h
+else
+extra_src=
+extra_header=
+endif
+
+EXTRA_DIST = graph.c graph.h
+
+toppred_SOURCES = error.c main.c usage.c profile.c seq-reader.c	loop.c \
+	charge.c topology.c topoprint.c	output.c mloutput.c $(extra_src)
+
+noinst_HEADERS = error.h main.h usage.h profile.h seq-reader.h loop.h \
+	params.h charge.h topology.h topoprint.h output.h mloutput.h \
+	$(extra_header)
+
+## Maintainer parano check
+LINTDEFS = $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS)
+
+parano:
+	$(LINT) $(LINTFLAGS) $(LINTDEFS) $(toppred_SOURCES)
diff --git a/src/Makefile.in b/src/Makefile.in
new file mode 100644
index 0000000..8f4b788
--- /dev/null
+++ b/src/Makefile.in
@@ -0,0 +1,465 @@
+# Makefile.in generated by automake 1.9.2 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004  Free Software Foundation, Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+
+
+SOURCES = $(toppred_SOURCES)
+
+srcdir = @srcdir@
+top_srcdir = @top_srcdir@
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+top_builddir = ..
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+INSTALL = @INSTALL@
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+build_triplet = @build@
+host_triplet = @host@
+bin_PROGRAMS = toppred$(EXEEXT)
+subdir = src
+DIST_COMMON = $(am__noinst_HEADERS_DIST) $(srcdir)/Makefile.am \
+	$(srcdir)/Makefile.in $(srcdir)/config.h.in
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/m4/aclibgd.m4 \
+	$(top_srcdir)/configure.in
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs
+CONFIG_HEADER = config.h
+CONFIG_CLEAN_FILES =
+am__installdirs = "$(DESTDIR)$(bindir)"
+binPROGRAMS_INSTALL = $(INSTALL_PROGRAM)
+PROGRAMS = $(bin_PROGRAMS)
+am__toppred_SOURCES_DIST = error.c main.c usage.c profile.c \
+	seq-reader.c loop.c charge.c topology.c topoprint.c output.c \
+	mloutput.c graph.c
+ at USE_GD_LIB_SRC_TRUE@am__objects_1 = graph.$(OBJEXT)
+am_toppred_OBJECTS = error.$(OBJEXT) main.$(OBJEXT) usage.$(OBJEXT) \
+	profile.$(OBJEXT) seq-reader.$(OBJEXT) loop.$(OBJEXT) \
+	charge.$(OBJEXT) topology.$(OBJEXT) topoprint.$(OBJEXT) \
+	output.$(OBJEXT) mloutput.$(OBJEXT) $(am__objects_1)
+toppred_OBJECTS = $(am_toppred_OBJECTS)
+toppred_LDADD = $(LDADD)
+DEFAULT_INCLUDES = -I. -I$(srcdir) -I.
+depcomp = $(SHELL) $(top_srcdir)/depcomp
+am__depfiles_maybe = depfiles
+COMPILE = $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) \
+	$(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS)
+CCLD = $(CC)
+LINK = $(CCLD) $(AM_CFLAGS) $(CFLAGS) $(AM_LDFLAGS) $(LDFLAGS) -o $@
+SOURCES = $(toppred_SOURCES)
+DIST_SOURCES = $(am__toppred_SOURCES_DIST)
+am__noinst_HEADERS_DIST = error.h main.h usage.h profile.h \
+	seq-reader.h loop.h params.h charge.h topology.h topoprint.h \
+	output.h mloutput.h graph.h
+HEADERS = $(noinst_HEADERS)
+ETAGS = etags
+CTAGS = ctags
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+ACLOCAL = @ACLOCAL@
+AMDEP_FALSE = @AMDEP_FALSE@
+AMDEP_TRUE = @AMDEP_TRUE@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CC = @CC@
+CCDEPMODE = @CCDEPMODE@
+CFLAGS = @CFLAGS@
+CPP = @CPP@
+CPPFLAGS = @CPPFLAGS@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+DEPDIR = @DEPDIR@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+EGREP = @EGREP@
+EXEEXT = @EXEEXT@
+GNUPLOT = @GNUPLOT@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LDFLAGS = @LDFLAGS@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+OBJEXT = @OBJEXT@
+OS_CPPFLAGS = @OS_CPPFLAGS@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+POD2MAN = @POD2MAN@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+USE_GD_LIB_SRC_FALSE = @USE_GD_LIB_SRC_FALSE@
+USE_GD_LIB_SRC_TRUE = @USE_GD_LIB_SRC_TRUE@
+VERSION = @VERSION@
+ac_ct_CC = @ac_ct_CC@
+ac_ct_STRIP = @ac_ct_STRIP@
+am__fastdepCC_FALSE = @am__fastdepCC_FALSE@
+am__fastdepCC_TRUE = @am__fastdepCC_TRUE@
+am__include = @am__include@
+am__leading_dot = @am__leading_dot@
+am__quote = @am__quote@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build = @build@
+build_alias = @build_alias@
+build_cpu = @build_cpu@
+build_os = @build_os@
+build_vendor = @build_vendor@
+datadir = @datadir@
+exec_prefix = @exec_prefix@
+host = @host@
+host_alias = @host_alias@
+host_cpu = @host_cpu@
+host_os = @host_os@
+host_vendor = @host_vendor@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+AM_CPPFLAGS = -DDATADIR=\"$(pkgdatadir)\" $(OS_CPPFLAGS)
+ at USE_GD_LIB_SRC_FALSE@extra_src = 
+ at USE_GD_LIB_SRC_TRUE@extra_src = graph.c
+ at USE_GD_LIB_SRC_FALSE@extra_header = 
+ at USE_GD_LIB_SRC_TRUE@extra_header = graph.h
+EXTRA_DIST = graph.c graph.h
+toppred_SOURCES = error.c main.c usage.c profile.c seq-reader.c	loop.c \
+	charge.c topology.c topoprint.c	output.c mloutput.c $(extra_src)
+
+noinst_HEADERS = error.h main.h usage.h profile.h seq-reader.h loop.h \
+	params.h charge.h topology.h topoprint.h output.h mloutput.h \
+	$(extra_header)
+
+LINTDEFS = $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) $(CPPFLAGS)
+all: config.h
+	$(MAKE) $(AM_MAKEFLAGS) all-am
+
+.SUFFIXES:
+.SUFFIXES: .c .o .obj
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \
+		&& exit 0; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu  src/Makefile'; \
+	cd $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu  src/Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+config.h: stamp-h1
+	@if test ! -f $@; then \
+	  rm -f stamp-h1; \
+	  $(MAKE) stamp-h1; \
+	else :; fi
+
+stamp-h1: $(srcdir)/config.h.in $(top_builddir)/config.status
+	@rm -f stamp-h1
+	cd $(top_builddir) && $(SHELL) ./config.status src/config.h
+$(srcdir)/config.h.in:  $(am__configure_deps) 
+	cd $(top_srcdir) && $(AUTOHEADER)
+	rm -f stamp-h1
+	touch $@
+
+distclean-hdr:
+	-rm -f config.h stamp-h1
+install-binPROGRAMS: $(bin_PROGRAMS)
+	@$(NORMAL_INSTALL)
+	test -z "$(bindir)" || $(mkdir_p) "$(DESTDIR)$(bindir)"
+	@list='$(bin_PROGRAMS)'; for p in $$list; do \
+	  p1=`echo $$p|sed 's/$(EXEEXT)$$//'`; \
+	  if test -f $$p \
+	  ; then \
+	    f=`echo "$$p1" | sed 's,^.*/,,;$(transform);s/$$/$(EXEEXT)/'`; \
+	   echo " $(INSTALL_PROGRAM_ENV) $(binPROGRAMS_INSTALL) '$$p' '$(DESTDIR)$(bindir)/$$f'"; \
+	   $(INSTALL_PROGRAM_ENV) $(binPROGRAMS_INSTALL) "$$p" "$(DESTDIR)$(bindir)/$$f" || exit 1; \
+	  else :; fi; \
+	done
+
+uninstall-binPROGRAMS:
+	@$(NORMAL_UNINSTALL)
+	@list='$(bin_PROGRAMS)'; for p in $$list; do \
+	  f=`echo "$$p" | sed 's,^.*/,,;s/$(EXEEXT)$$//;$(transform);s/$$/$(EXEEXT)/'`; \
+	  echo " rm -f '$(DESTDIR)$(bindir)/$$f'"; \
+	  rm -f "$(DESTDIR)$(bindir)/$$f"; \
+	done
+
+clean-binPROGRAMS:
+	-test -z "$(bin_PROGRAMS)" || rm -f $(bin_PROGRAMS)
+toppred$(EXEEXT): $(toppred_OBJECTS) $(toppred_DEPENDENCIES) 
+	@rm -f toppred$(EXEEXT)
+	$(LINK) $(toppred_LDFLAGS) $(toppred_OBJECTS) $(toppred_LDADD) $(LIBS)
+
+mostlyclean-compile:
+	-rm -f *.$(OBJEXT)
+
+distclean-compile:
+	-rm -f *.tab.c
+
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/charge.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/error.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/graph.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/loop.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/main.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/mloutput.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/output.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/profile.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/seq-reader.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/topology.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/topoprint.Po at am__quote@
+ at AMDEP_TRUE@@am__include@ @am__quote at ./$(DEPDIR)/usage.Po at am__quote@
+
+.c.o:
+ at am__fastdepCC_TRUE@	if $(COMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ $<; \
+ at am__fastdepCC_TRUE@	then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Po"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi
+ at AMDEP_TRUE@@am__fastdepCC_FALSE@	source='$<' object='$@' libtool=no @AMDEPBACKSLASH@
+ at AMDEP_TRUE@@am__fastdepCC_FALSE@	DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@
+ at am__fastdepCC_FALSE@	$(COMPILE) -c $<
+
+.c.obj:
+ at am__fastdepCC_TRUE@	if $(COMPILE) -MT $@ -MD -MP -MF "$(DEPDIR)/$*.Tpo" -c -o $@ `$(CYGPATH_W) '$<'`; \
+ at am__fastdepCC_TRUE@	then mv -f "$(DEPDIR)/$*.Tpo" "$(DEPDIR)/$*.Po"; else rm -f "$(DEPDIR)/$*.Tpo"; exit 1; fi
+ at AMDEP_TRUE@@am__fastdepCC_FALSE@	source='$<' object='$@' libtool=no @AMDEPBACKSLASH@
+ at AMDEP_TRUE@@am__fastdepCC_FALSE@	DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@
+ at am__fastdepCC_FALSE@	$(COMPILE) -c `$(CYGPATH_W) '$<'`
+uninstall-info-am:
+
+ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES)
+	list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '    { files[$$0] = 1; } \
+	       END { for (i in files) print i; }'`; \
+	mkid -fID $$unique
+tags: TAGS
+
+TAGS:  $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \
+		$(TAGS_FILES) $(LISP)
+	tags=; \
+	here=`pwd`; \
+	list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '    { files[$$0] = 1; } \
+	       END { for (i in files) print i; }'`; \
+	if test -z "$(ETAGS_ARGS)$$tags$$unique"; then :; else \
+	  test -n "$$unique" || unique=$$empty_fix; \
+	  $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \
+	    $$tags $$unique; \
+	fi
+ctags: CTAGS
+CTAGS:  $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \
+		$(TAGS_FILES) $(LISP)
+	tags=; \
+	here=`pwd`; \
+	list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \
+	unique=`for i in $$list; do \
+	    if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \
+	  done | \
+	  $(AWK) '    { files[$$0] = 1; } \
+	       END { for (i in files) print i; }'`; \
+	test -z "$(CTAGS_ARGS)$$tags$$unique" \
+	  || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \
+	     $$tags $$unique
+
+GTAGS:
+	here=`$(am__cd) $(top_builddir) && pwd` \
+	  && cd $(top_srcdir) \
+	  && gtags -i $(GTAGS_ARGS) $$here
+
+distclean-tags:
+	-rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags
+
+distdir: $(DISTFILES)
+	@srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \
+	list='$(DISTFILES)'; for file in $$list; do \
+	  case $$file in \
+	    $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \
+	    $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \
+	  esac; \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \
+	  if test "$$dir" != "$$file" && test "$$dir" != "."; then \
+	    dir="/$$dir"; \
+	    $(mkdir_p) "$(distdir)$$dir"; \
+	  else \
+	    dir=''; \
+	  fi; \
+	  if test -d $$d/$$file; then \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \
+	    fi; \
+	    cp -pR $$d/$$file $(distdir)$$dir || exit 1; \
+	  else \
+	    test -f $(distdir)/$$file \
+	    || cp -p $$d/$$file $(distdir)/$$file \
+	    || exit 1; \
+	  fi; \
+	done
+check-am: all-am
+check: check-am
+all-am: Makefile $(PROGRAMS) $(HEADERS) config.h
+installdirs:
+	for dir in "$(DESTDIR)$(bindir)"; do \
+	  test -z "$$dir" || $(mkdir_p) "$$dir"; \
+	done
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-binPROGRAMS clean-generic mostlyclean-am
+
+distclean: distclean-am
+	-rm -rf ./$(DEPDIR)
+	-rm -f Makefile
+distclean-am: clean-am distclean-compile distclean-generic \
+	distclean-hdr distclean-tags
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+info: info-am
+
+info-am:
+
+install-data-am:
+
+install-exec-am: install-binPROGRAMS
+
+install-info: install-info-am
+
+install-man:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+	-rm -rf ./$(DEPDIR)
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-compile mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-binPROGRAMS uninstall-info-am
+
+.PHONY: CTAGS GTAGS all all-am check check-am clean clean-binPROGRAMS \
+	clean-generic ctags distclean distclean-compile \
+	distclean-generic distclean-hdr distclean-tags distdir dvi \
+	dvi-am html html-am info info-am install install-am \
+	install-binPROGRAMS install-data install-data-am install-exec \
+	install-exec-am install-info install-info-am install-man \
+	install-strip installcheck installcheck-am installdirs \
+	maintainer-clean maintainer-clean-generic mostlyclean \
+	mostlyclean-compile mostlyclean-generic pdf pdf-am ps ps-am \
+	tags uninstall uninstall-am uninstall-binPROGRAMS \
+	uninstall-info-am
+
+
+parano:
+	$(LINT) $(LINTFLAGS) $(LINTDEFS) $(toppred_SOURCES)
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:
diff --git a/src/charge.c b/src/charge.c
new file mode 100644
index 0000000..1f12c9f
--- /dev/null
+++ b/src/charge.c
@@ -0,0 +1,296 @@
+/* -----------------------------------------------------------------
+ file      : /home/schuerer/toppred_com/src/top_loop.c
+
+ author    : Schuerer
+ description :
+
+
+-------------------------------------------------------------------- */
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+#include <ctype.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#endif
+
+#ifdef HAVE_UNISTD_H
+#include <unistd.h>
+#endif
+
+#ifdef HAVE_LIBM
+#include <math.h>
+#endif
+
+#include "charge.h"
+#include "error.h"
+
+
+#define MAXSIZE 5
+
+/* internal function prototypes */
+static int is_aa(int c);
+
+/* calc the Arg+Lys content of a loop
+
+   to calculate over :
+      _____           _____
+   ...     |\       /|      ...
+      _____|_\     /_|_____
+           |<------->|                 */
+int countkr (char *seq, int soff, int eoff) {
+
+  int c = 0;
+  int i;
+
+  if (soff == -1) return 0; /* undefined sequence element */
+
+  if (soff < 0)
+    error_fatal (seq, "start position smaller than zero");
+  if (eoff > strlen (seq))
+    error_fatal (seq, "end position greater than sequence lenght");
+
+  /* if (eoff - soff > 70) return 0; peut etre un niveau plus haut */
+
+  for(i=soff; i<eoff; i++)
+    if (seq[i] == 'K' || seq[i] == 'R') c++;
+
+  return c;
+}
+
+/* calc the number of negative aa (Asp+Glu)
+   in a subsequence (soff, eoff) of seq
+
+   to calculate over :
+      _____           _____
+   ...     |\       /|      ...
+      _____|_\     /_|_____
+           |<------->|                 */
+int countneg (char *seq, int soff, int eoff) {
+
+  int c = 0;
+  int i;
+
+  if (soff == -1) return 0; /* undefined sequence element */
+
+  if (soff < 0)
+    error_fatal (seq, "start position smaller than zero");
+  if (eoff > strlen (seq)){
+       error_fatal (seq, "end position greater than sequence lenght");
+  }
+  for(i=soff; i<eoff; i++)
+    if (seq[i] == 'D' || seq[i] == 'E') c++;
+
+  return c;
+}
+
+/* charge of N-terminus =
+   1 if Met start is cleaved after translation
+   0 other one */
+int ncharge (char *seq, int kingdom) {
+
+  if (kingdom == EUKARYOTE) return 1;
+  if (strlen(seq) > 2 && strchr("KRLFI", seq[1]) == NULL) return 1;
+  return 0;
+}
+
+/* calc the difference between the cyt ext compositions
+   a value of smaller than zero indicates a cytoplasmatic location
+   should only be used for loops longer than 50 aa
+   FEBS Lett. 303:141-46 (1992)
+
+   to calculate over :
+      _____           _____
+   ...     |\       /|      ...
+      _____|_\     /_|_____
+              |<->|                 */
+double distance (char *seq, int soff, int eoff, scale_t *scale) {
+
+  double *cyt = scale->cyt;
+  double *ext = scale->ext;
+  double *sd  = scale->sd;
+
+  int i;
+  int naa[26];
+  double freq, sumcyt, sumext, temp;
+
+  if (soff == eoff) return 0.0;
+
+  for (i=0; i<26; i++) naa[i] = 0;
+  for (i=soff; i<eoff; i++) naa[seq[i] - 'A']++;
+
+  sumext = sumcyt = 0.0;
+  for (i=0; i<26; i++) {
+    if (is_aa (i + 'A')) {
+      freq = naa[i] * 100.0 / (eoff - soff);
+      temp = (cyt[i] - freq) / sd[i];
+      sumcyt += temp * temp;
+      temp = (ext[i] - freq) / sd[i];
+      sumext += temp * temp;
+    }
+  }
+
+  return sqrt(sumcyt) - sqrt(sumext);
+}
+
+
+/* calc the net charge difference of the N-terminal segment including 15 aa
+   up- and 15 aa downward
+   Hartmann et al., PNAS
+
+   to calculate over :
+                      __________
+                    /|    S0    |\
+          | 15 aa |/_|__________|_\| 15 aa |
+          |<-------->|          |<-------->|    */
+int nterminus (char *seq, int soff, int eoff, int delta) {
+
+  int start, end, charge;
+  int i, len;
+
+  charge = 0;
+  /* calc charge avant the segment */
+  start = soff - 15;
+  start = (start < 0) ? 0 : start;
+  end = soff + delta;
+
+  for (i=start; i<end; i++)
+    if (strchr("KR", seq[i]) != NULL) charge++;
+    else if (strchr("DE", seq[i]) != NULL) charge--;
+
+  /* calc charge after the segment */
+  start = eoff - 1 - delta;
+  end = eoff - 1 + 15;
+  len = strlen(seq);
+  end = (end > len) ? len : end;
+
+  for (i=start; i<end; i++)
+    if (strchr("KR", seq[i]) != NULL) charge--;
+    else if (strchr("DE", seq[i]) != NULL) charge++;
+
+  return charge;
+}
+
+static int is_aa(int aa) {
+
+    char c;
+    c = (char)aa;
+
+    if ((c >= 'A') && (c <= 'Z'))
+      if (strchr("BJOUXZ", c) == NULL)
+        return TRUE;
+
+    return FALSE;
+
+}
+
+/* retreive cyt-ext scale datas from file */
+int read_cytext_datas (char *file, scale_t *scales) {
+
+  double *cyt = scales->cyt;
+  double *ext = scales->ext;
+  double *sd = scales->sd;
+
+  int i;
+  char *BUFF, *p, *q, *val;
+  int aa;
+
+  FILE *IN;
+
+  /* we initialise the storage to 0 */
+  for(i = 0; i < 26; i++) {
+    cyt[i] = ext[i] = sd[i] = 0;
+  }
+
+  if ((IN = fopen(file, "r")) == NULL)
+    error_fatal(file, NULL);
+
+  if((BUFF = (char *)malloc(BUFFLEN)) == NULL)
+    error_fatal("memory", NULL);
+
+  if((val = (char *)malloc(sizeof(char) *  (MAXSIZE + 1))) == NULL)
+    error_fatal("memory", NULL);
+
+  while (fgets(BUFF, BUFFLEN, IN) != NULL) {
+
+    /* we skip the comment lines */
+    if (*BUFF == '\0')
+      continue;
+
+    if (*BUFF == '#')
+      continue;
+
+    p = BUFF;
+
+    /* get aa definition */
+    aa = (int)*p;
+    if (!is_aa(aa)){
+      error_warn(file, "Unknown aminoacid.");
+      continue;
+    }
+
+    p++;
+
+    while (*p != '\0'  && isalpha((int)*p)) p++;
+    while (*p != '\0' && isspace((int)*p)) p++;
+
+    if(*p == '\0')
+      error_fatal(file, "Incorrect format.");
+
+
+    /* get cyt value */
+    q = val;
+    *q = '\0';
+    while (*p != '\0' && !isspace((int)*p)) {
+      *q++ = *p++; }
+    *q = '\0';
+     cyt[aa - 'A'] = atof(val);
+
+     while (*p != '\0' && isspace((int)*p)) p++;
+     /* get ext value */
+     q = val;
+     *q = '\0';
+     while (*p != '\0' && !isspace((int)*p)) {
+       *q++ = *p++; }
+     *q = '\0';
+     ext[aa - 'A'] = atof(val);
+
+     while (*p != '\0' && isspace((int)*p)) p++;
+     /* get ext value */
+     q = val;
+     *q = '\0';
+     while (*p != '\0' && !isspace((int)*p)) {
+       *q++ = *p++; }
+     *q = '\0';
+     sd[aa - 'A'] = atof(val);
+
+  }
+
+  if(fclose(IN) == EOF)
+    error_fatal(file, NULL);
+
+  free(BUFF);
+  free(val);
+
+  /* print_Hphobes_datas(hphobes_datas); */
+
+  return 0;
+}
+
+/* determine the N-terminus orientation */
+char *orientation(double val) {
+  if (val > 0.0) return "N-in";
+  else if (val < 0.0) return "N-out";
+  else return "undecided";
+}
+
+/* determine the N-terminus orientation */
+char *new_orientation(double val) {
+  if (val > 0.0) return "N-in";
+  else if (val < 0.0) return "N-out";
+  else return "?";
+}
diff --git a/src/charge.h b/src/charge.h
new file mode 100644
index 0000000..f0a0850
--- /dev/null
+++ b/src/charge.h
@@ -0,0 +1,41 @@
+/*   File:                /home/edeveaud/Work/toppred/src/charge.h
+ *   Author:              Katja Schuerer
+ */
+
+
+#ifndef __CHARGE_H_
+#define __CHARGE_H_
+
+
+#include "params.h"
+
+#define EUKARYOTE 1
+#define PROKARYOTE 2
+
+/* retreive cyt-ext scale datas from file */
+int read_cytext_datas (char *file, scale_t *scales);
+
+/* calc the Arg+Lys content over a subsequence from soff to eoff */
+int countkr (char *seq, int soff, int eoff);
+
+/* calc the Asp+Glu content over a subsequence from soff to eoff */
+int countneg (char *seq, int soff, int eoff);
+
+/* calc the charge of the N-terminus, depend on cleavage of Met start */
+int ncharge (char *seq, int kingdom);
+
+/* calc the difference of cyt-ext values of a subsequence */
+double distance (char *seq, int soff, int eoff, scale_t *scale);
+
+/* calc the charge difference over adjacent loops of the first segment
+   including 15 aa at each side */
+int nterminus (char *seq, int soff, int eoff, int delta);
+
+/* determine the N-terminus orientation */
+char *orientation(double val);
+
+/* determine the N-terminus orientation
+   if undecided return "?" */
+char *new_orientation(double val);
+
+#endif /* __CHARGE_H_ */
diff --git a/src/config.h.in b/src/config.h.in
new file mode 100644
index 0000000..407d599
--- /dev/null
+++ b/src/config.h.in
@@ -0,0 +1,96 @@
+/* src/config.h.in.  Generated from configure.in by autoheader.  */
+
+/* Define to 1 if you have the <errno.h> header file. */
+#undef HAVE_ERRNO_H
+
+/* is gnuplot present */
+#undef HAVE_GNUPLOT
+
+/* Define to 1 if you have the <inttypes.h> header file. */
+#undef HAVE_INTTYPES_H
+
+/* is libgd present */
+#undef HAVE_LIBGD
+
+/* Define to 1 if you have the `m' library (-lm). */
+#undef HAVE_LIBM
+
+/* Define to 1 if you have the <memory.h> header file. */
+#undef HAVE_MEMORY_H
+
+/* Define to 1 if you have the `pow' function. */
+#undef HAVE_POW
+
+/* Define to 1 if you have the `sqrt' function. */
+#undef HAVE_SQRT
+
+/* Define to 1 if `stat' has the bug that it succeeds when given the
+   zero-length file name argument. */
+#undef HAVE_STAT_EMPTY_STRING_BUG
+
+/* Define to 1 if you have the <stdint.h> header file. */
+#undef HAVE_STDINT_H
+
+/* Define to 1 if you have the <stdlib.h> header file. */
+#undef HAVE_STDLIB_H
+
+/* Define to 1 if you have the `strchr' function. */
+#undef HAVE_STRCHR
+
+/* Define to 1 if you have the `strerror' function. */
+#undef HAVE_STRERROR
+
+/* Define to 1 if you have the <strings.h> header file. */
+#undef HAVE_STRINGS_H
+
+/* Define to 1 if you have the <string.h> header file. */
+#undef HAVE_STRING_H
+
+/* Define to 1 if you have the `strrchr' function. */
+#undef HAVE_STRRCHR
+
+/* Define to 1 if you have the <sys/stat.h> header file. */
+#undef HAVE_SYS_STAT_H
+
+/* Define to 1 if you have the <sys/types.h> header file. */
+#undef HAVE_SYS_TYPES_H
+
+/* Define to 1 if you have the <unistd.h> header file. */
+#undef HAVE_UNISTD_H
+
+/* Define to 1 if `lstat' dereferences a symlink specified with a trailing
+   slash. */
+#undef LSTAT_FOLLOWS_SLASHED_SYMLINK
+
+/* Name of package */
+#undef PACKAGE
+
+/* Define to the address where bug reports for this package should be sent. */
+#undef PACKAGE_BUGREPORT
+
+/* Define to the full name of this package. */
+#undef PACKAGE_NAME
+
+/* Define to the full name and version of this package. */
+#undef PACKAGE_STRING
+
+/* Define to the one symbol short name of this package. */
+#undef PACKAGE_TARNAME
+
+/* Define to the version of this package. */
+#undef PACKAGE_VERSION
+
+/* Define to 1 if you have the ANSI C header files. */
+#undef STDC_HEADERS
+
+/* Define to 1 if your <sys/time.h> declares `struct tm'. */
+#undef TM_IN_SYS_TIME
+
+/* Version number of package */
+#undef VERSION
+
+/* Define to empty if `const' does not conform to ANSI C. */
+#undef const
+
+/* Define to `unsigned' if <sys/types.h> does not define. */
+#undef size_t
diff --git a/src/error.c b/src/error.c
new file mode 100644
index 0000000..e62ecc3
--- /dev/null
+++ b/src/error.c
@@ -0,0 +1,44 @@
+/* error.c - Error functions */
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#endif
+
+#include <errno.h>
+
+#include "error.h"
+
+#ifndef HAVE_STRERROR
+char *strerror(int errnum) {
+  extern char *sys_errlist[];
+  extern int sys_nerr;
+
+  if (errnum > 0 && errnum < sys_nerr) {
+    return sys_errlist[errnum]; }
+
+  return (char *)"Unknown error type"; }
+#endif /* HAVE_STRERROR */
+
+
+/* Abort on fatal error */
+void error_fatal(const char *str, const char *err) {
+
+  if (err == NULL) { err = strerror(errno); }
+  (void)fprintf(stderr, "Fatal: %s: %s\n", str, err);
+
+  exit(EXIT_FAILURE); }
+
+/* Warn for non fatal error */
+void error_warn(const char *str, const char *err) {
+
+  if (err == NULL) { err = strerror(errno); }
+  (void)fprintf(stderr, "Warning: %s: %s\n", str, err);
+
+  return; }
diff --git a/src/error.h b/src/error.h
new file mode 100644
index 0000000..54ca298
--- /dev/null
+++ b/src/error.h
@@ -0,0 +1,10 @@
+/* error.h - Error functions */
+
+#ifndef __ERROR_H_
+#define __ERROR_H_
+
+/* Functions prototypes */
+void error_fatal(const char *str, const char *err);
+void error_warn(const char *str, const char *err);
+
+#endif /* __ERROR_H_ */
diff --git a/src/graph.c b/src/graph.c
new file mode 100644
index 0000000..c9bde2d
--- /dev/null
+++ b/src/graph.c
@@ -0,0 +1,439 @@
+/*   File:                /home/edeveaud/Work/toppred/src/graph.c
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#endif
+
+#include <graph.h>
+#include <gd.h>
+#include <gdfontl.h>
+#include <gdfontg.h>
+
+
+#include "error.h"
+#include "topology.h"
+
+
+static int TM_COLOR;
+static int TM_BORDER;
+static int MBR_COLOR;
+static int PUT_COLOR;
+static int MBR_BORDER;
+static int FONT_COLOR;
+static int LOOP_COLOR;
+
+static float COEFF;
+
+static FILE *file_maker(char *title, char *dir, int num) ;
+
+static gdImagePtr init_img(char *title, int num) ;
+
+static int *loop_tweaker (elprint_t *element, int n) ;
+
+static void draw_segment(gdImagePtr img, int pos, int n, int kind) ;
+
+static void draw_loop(gdImagePtr img, int x1,int x2, int length, int real,
+		      int kr, int kind, int first_last) ;
+
+static void print_legend(gdImagePtr img,char *legend) ;
+
+void topo_graph_print (topoprint_t *topo, int n, param_t *params, seq_t *seq) {
+
+  char *seq_name;
+  int  i,j;
+  int *loop_length;
+  int ll, real, kr, loc,first_last;
+  int num;
+  int  x1, x2;
+  char *legend, *p;
+  char *legend_text = "Segments included:";
+  char *dir_name;
+  FILE *pngout;
+  gdImagePtr img;
+  elprint_t *element;
+
+  /* could we draw */
+  if((n-1)/2 >MAX_SEGMENTS){
+    error_warn("graphic_topo", "too many segments to be represented, skipped");
+    return;
+  }
+
+  /* tweaking the values to avoid drawing overlaping segments */
+  element = topo->elps;
+  if ((loop_length = loop_tweaker(element, n)) == NULL) {
+    error_warn("graphic_topo", "could not display topologies");
+    return;
+  }
+
+  /* generating image holder file */
+  dir_name = params->out_dir;
+  seq_name=seq->id;
+  num =   topo->nr;
+  pngout = file_maker(seq_name, dir_name, num);
+
+  /* allocate image */
+  img = init_img(seq_name, num);
+
+  /* there is at least n/2 -1 segment included
+   * each one is at max 2 char long + 1 for space
+   * thus generous legend size is  */
+  i = strlen(legend_text) + n*3;
+  if((legend = (char *)malloc(sizeof(char) * (i+1))) == NULL){
+    error_fatal("memory", NULL);
+  }
+  p =legend;
+  (void)sprintf(p, "%s", legend_text);
+  p+=strlen(legend_text);
+
+
+  /* draw topologie segments and loops  */
+  if ( topo->kr <= 0) loc = CYT;
+  else loc = EXT;
+
+  x1 = x2 = 0;
+  j = 0;
+  for (i=0; i<n; i++) {
+    if (i%2) {
+      draw_segment(img, x2, element[i].tm.nr, (int)element[i].tm.prob);
+      (void)sprintf(p, "%3d", element[i].tm.nr);
+      p+=3;
+    }
+    else {
+      x2 = x1 + loop_length[j];
+      ll = element[i].lo.len;
+      real = loop_length[j];
+      kr = element[i].lo.kr;
+      if (i == 0) first_last = FIRST;
+      else if (i == n-1) first_last = LAST;
+      else first_last = INNER;
+      draw_loop(img, x1, x2, ll, real, kr, loc,first_last ) ;
+      x1 = x2;
+      loc *= -1;
+      j++;
+    }
+  }
+
+  print_legend(img, legend);
+
+  /* dropping image to file */
+  gdImagePng(img, pngout);
+  gdImageDestroy(img);
+  
+  if(fclose(pngout) == EOF) {
+    error_fatal("closing file", NULL);
+  }
+
+  /* memory cleaning */
+  free(legend);
+  free(loop_length);
+
+  return;
+}
+
+
+static void print_legend(gdImagePtr img,char *legend) {
+  gdFontPtr font;
+  font = gdFontGiant;
+  gdImageString(img, font, 10, 50, (unsigned char *)legend, FONT_COLOR);
+
+  return;
+}
+
+static void draw_loop(gdImagePtr img, int x1, int x2, int length, int real, int kr, int loc, int first_last) {
+
+  /* loop position */
+  int xc , yc;
+  int l, start, stop;
+  /* legend related */
+  gdFontPtr font;
+  char *legend1, *legend2;
+  int xf1, xf2, yf1, yf2;
+
+  font = gdFontLarge;
+
+  /* positioning the loop params */
+  l = (int)(COEFF * real);
+  yc = Y_CENTER - ((SEG_H /2) * loc);
+  if (first_last == INNER) {
+    xc = (int)(((x1 + x2)/2.0) * COEFF) + MARGIN;
+    start = 180 - ((1 - loc) * 90);
+    stop  = start + 180;
+  }
+  else if (first_last == FIRST) {
+    xc = MARGIN;
+    start = 270 - ((1 - loc) * 135);
+    stop  = start + 90;
+    l *= 2;
+    gdImageChar(img, font, xc , yc, 'N', FONT_COLOR) ;
+  }
+  else { /* first_last == LAST */
+    xc = (int)(((x1 + x2)/2.0) * COEFF) + l/2 + MARGIN;
+    start = 180 - ((1 - loc) * 45);
+    stop  = start + 90;
+    l *= 2;
+    gdImageChar(img, font, xc , yc, 'C', FONT_COLOR) ;
+  }
+
+  /* draw the loop */
+  gdImageArc(img, xc, yc, l,LOOP_H, start, stop, LOOP_COLOR);
+
+
+  /* now deal with the loop legend */
+  if((legend1 = (char *)malloc(10)) == NULL){ error_fatal("memory", NULL); }
+  if((legend2 = (char *)malloc(10)) == NULL){ error_fatal("memory", NULL); }
+
+  (void)sprintf(legend1, "Ll = %d", length);
+  (void)sprintf(legend2, "KR = %d", kr);
+
+  /* legend position */
+  if (first_last == INNER) {
+    xf1 = xc - strlen(legend1)*font->w/2;
+    xf2 = xc - strlen(legend2)*font->w/2;
+  }
+  else if (first_last == FIRST) {
+    xf1 = xc ;
+    xf2 = xc ;
+  }
+  else {
+    xf1 = xc - strlen(legend1)*font->w;
+    xf2 = xc - strlen(legend2)*font->w;
+  }
+  yf1 = Y_CENTER - (loc * (LOOP_H + SEG_H - font->h/2));
+  yf2 = yf1 + 2*font->h/2;
+
+  /* plot the loop legend */
+  gdImageString(img, font, xf1, yf1, (unsigned char *)legend1, FONT_COLOR);
+  gdImageString(img, font, xf2, yf2, (unsigned char *)legend2, FONT_COLOR);
+
+  free(legend1);
+  free(legend2);
+
+  return;
+}
+
+/* segment representation routine */
+static void draw_segment(gdImagePtr img, int pos, int n, int kind) {
+
+  /* segment position */
+  int x;
+  int x1, x2, y1, y2;
+  int w, l;
+  int color;
+
+  /* legend related */
+  int xf, yf;
+  int num_l, num_h;
+  char *tag;
+  gdFontPtr font;
+  font = gdFontLarge;
+
+  x = (int)(pos * COEFF) + MARGIN;
+
+  /* segment coordinate */
+  x1 = x - (SEG_L/2);
+  x2 = x + (SEG_L/2);
+  y1 = Y_CENTER - (int)((SEG_H - SEG_L) / 2);
+  y2 = Y_CENTER + (int)((SEG_H - SEG_L) / 2);
+  w = l = SEG_L + 2;
+
+  /* segment color attribution */
+  if (kind == 1){ color = PUT_COLOR; }
+  else { color = TM_COLOR; }
+
+  /* draw the segment border and fill it*/
+  gdImageLine(img, x1, y1, x1, y2, TM_BORDER);
+  gdImageLine(img, x2, y1, x2, y2, TM_BORDER);
+  gdImageArc(img, x, y1, w, l, 180, 0, TM_BORDER);
+  gdImageArc(img, x, y2, w, l, 0, 180, TM_BORDER);
+  gdImageFillToBorder(img, x, Y_CENTER,  TM_BORDER, color);
+
+  /* tag segment with is number */
+  if((tag = (char *)malloc(3*sizeof(char))) == NULL) {
+    error_fatal("memory", NULL);
+  }
+  (void)sprintf(tag, "%d", n);
+
+  num_l=(strlen(tag) * font->w) /2 ;
+  num_h = font->h / 2;
+  xf = x - num_l;
+  yf = Y_CENTER - num_h;
+
+  gdImageString(img, font, xf, yf, (unsigned char *)tag, FONT_COLOR);
+  free(tag);
+}
+
+/* tweaking the loop length values in order to avoid some overlaping segments
+ * drawing
+ * segment are drawn with a fixed width, we must check that the loop
+ * representation is long enough to avoid some segment collision.
+ * eg: shorter loop lenght are forced to be represented at least with
+ * a lenght compatible with segment width
+ * see below
+ *          _                    ____
+ *         | |                  |    |
+ *        _____                ___   ___
+ *       / / \ \              /   \ /   \
+ *      | |   | |            |     |     |
+ *      | |   | |            |     |     |
+ *       \_\_/_/              \___/ \___/
+ *
+ * loop length < SEG_L   loop_lenght forced to SEG_L
+ */
+
+static int *loop_tweaker (elprint_t *element, int n){
+
+  int check , cont, graph_len;
+  int i, j, ll;
+  int *loop_length;
+  i = n - ((n-1)/2);
+  if ((loop_length = malloc(i * sizeof(int))) == NULL) {
+    error_fatal("memory", NULL);
+  }
+  for (i=0, j=0; i<n; i+=2, j++  ) {
+    loop_length[j] = element[i].lo.len;
+  }
+
+
+  check = 10;
+  j = n - ((n-1)/2);
+  while (check > 0) {
+    cont = 1;
+    check--;
+    graph_len = 0;
+
+    for (i = 0; i< j; i++) { graph_len += loop_length[i]; }
+    if ( graph_len == 0) graph_len = 1;
+    COEFF = (float)(800 - 40)/ graph_len;
+    for (i = 0; i<j; i++) {
+      ll = loop_length[i]*COEFF;
+      if (ll < 20) {
+	cont = 0;
+	loop_length[i] = (int)(20/COEFF)+1;
+      }
+    }
+    if (cont == 1) {break;}
+  }
+
+  if (check <= 0) {
+    free (loop_length);
+    return NULL;
+  }
+
+  return loop_length;
+}
+
+/* prepare the png file wich will host the image */
+static FILE *file_maker(char *title, char *dir, int num) {
+
+  char *file_name, *p;
+  int path_len;
+  FILE *pngout;
+
+  /* preparing filename  and allocating the result file ptr*/
+  path_len =sizeof(char) * (strlen(dir) + 1 + strlen(title) + 6 + 5 + 2 + 1 );
+  if((file_name=(char *)malloc(path_len)) == NULL){
+    error_fatal("memory", NULL);
+  }
+  p = file_name;
+  (void)sprintf(p, "%s/%s-%d.png",dir, title, num);
+
+  if ((pngout = fopen(file_name, "wb")) == NULL) {
+    error_fatal("topos", NULL);
+  }
+
+  free(file_name);
+  return pngout;
+}
+
+
+/* allocate the image holder, and plot the legends and common drawing */
+static gdImagePtr init_img(char *title, int num) {
+  int y1, y2;
+  int xf, yf, text_l, text_h;
+
+  char  *cyto, *extra;
+  char *struct_num;
+  char *certain, *put;
+  char *loop, *kr;
+
+  gdImagePtr img;
+  gdFontPtr font, sfont;
+
+  img = gdImageCreate(IMAGE_LENGTH, IMAGE_HEIGTH);
+  font =  gdFontGiant;
+  sfont = gdFontLarge;
+
+
+  /* colors are given in RGB see /usr/lib/X11/rgb.txt */
+  TM_COLOR = gdImageColorAllocate(img, 255, 255, 255);            /* white  */
+  TM_BORDER = FONT_COLOR = gdImageColorAllocate(img, 0, 0, 0);    /* black  */
+  MBR_COLOR = gdImageColorAllocate(img, 219, 219, 219);           /* grey86 */
+  MBR_BORDER = LOOP_COLOR = gdImageColorAllocate(img, 3, 3, 3);   /* grey1  */
+  PUT_COLOR = gdImageColorAllocate(img, 161, 161, 161);           /* grey63 */
+
+  y1 = Y_CENTER - (int)(SEG_H / 4);
+  y2 = Y_CENTER + (int)(SEG_H / 4);
+
+  /* plot the membrane */
+  gdImageFilledRectangle(img, 0, y1, IMAGE_LENGTH , y2, MBR_COLOR);
+  gdImageLine(img, 0, y1, IMAGE_LENGTH, y1, MBR_BORDER);
+  gdImageLine(img, 0, y2, IMAGE_LENGTH, y2, MBR_BORDER);
+
+  /* title and legend */
+
+  /* localisation legend */
+  cyto = "CYTOPLASM";
+  extra = "EXTRACELLULAR";
+  text_h = font->h / 2;
+
+  /* cytoplasm legend */
+  text_l = (strlen(cyto) * font->w) /2 ;
+  xf = X_CENTER - text_l;
+  yf = (int)(IMAGE_HEIGTH * 2.0/9.0) - text_h;
+  gdImageString(img, font, xf, yf, (unsigned char *)cyto, FONT_COLOR);
+
+  /* extracellular legend */
+  text_l = (strlen(extra) * font->w) /2 ;
+  xf = X_CENTER - text_l;
+  yf = (int)(IMAGE_HEIGTH * 8.0/9.0) - text_h;
+  gdImageString(img, font, xf, yf, (unsigned char *)extra, FONT_COLOR);
+
+  /* title generation */
+  gdImageString(img, font, 10, 10, (unsigned char *)title, FONT_COLOR);
+  if((struct_num = (char *)malloc(14+3)) == NULL){
+    error_fatal("memory", NULL);
+  }
+  (void)sprintf(struct_num, "Structure no. %d", num);
+
+  gdImageString(img, font, 10, 30, (unsigned char *)struct_num, FONT_COLOR);
+  free(struct_num);
+
+  /* color meaning legend */
+  gdImageRectangle(img, 600, 30, 620, 50, TM_BORDER);
+  gdImageFilledRectangle(img, 600, 60, 620, 80, PUT_COLOR);
+  gdImageRectangle(img, 600, 60, 620, 80, TM_BORDER);
+
+  certain = "Segment Certain";
+  put = "Segment Putative";
+  gdImageString(img, sfont, 630, 32, (unsigned char *)put, FONT_COLOR);
+  gdImageString(img, sfont, 630, 62, (unsigned char *)certain, FONT_COLOR);
+
+  /* cellular localisation legend */
+  loop = "Ll: Loop length";
+  kr   = "KR: Number of Lys and Arg";
+  gdImageString(img, font, 10, 350, (unsigned char *)loop, FONT_COLOR);
+  gdImageString(img, font, 10, 370, (unsigned char *)kr, FONT_COLOR);
+
+  /* positionnning the Margin */
+  return img;
+
+}
diff --git a/src/graph.h b/src/graph.h
new file mode 100644
index 0000000..a218d61
--- /dev/null
+++ b/src/graph.h
@@ -0,0 +1,33 @@
+/*   File:                /home/edeveaud/Work/toppred/src/top-graph.h
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifndef __GRAPH_H__
+#define __GRAPH_H__
+
+
+#include "topoprint.h"
+
+				
+#define IMAGE_LENGTH 800           /* image size is fixed */
+#define IMAGE_HEIGTH 400
+#define Y_CENTER IMAGE_HEIGTH/2
+#define X_CENTER IMAGE_LENGTH/2
+#define SEG_L 20                     /* segment representation is fixed */
+#define SEG_H 60
+#define LOOP_H 40
+#define MARGIN 20
+#define MAX_SEGMENTS 37		/* maximum segments we can represent */
+
+#define CYT -1
+#define MBR 0
+#define EXT +1
+
+#define FIRST -1
+#define LAST   1
+#define INNER 0
+
+void topo_graph_print (topoprint_t *topo,  int n, param_t *params, seq_t *seq);
+
+#endif /* __GRAPH_H__ */
diff --git a/src/loop.c b/src/loop.c
new file mode 100644
index 0000000..bd10525
--- /dev/null
+++ b/src/loop.c
@@ -0,0 +1,300 @@
+/*   File:                /home/edeveaud/Work/toppred/src/loop.c
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#endif
+
+#ifdef HAVE_UNISTD_H
+#include <unistd.h>
+#endif
+
+#include "loop.h"
+#include "error.h"
+
+
+
+/* eliminate segments overlapping */
+static int purge_segments(segment_t **seg, param_t params, int nbr);
+
+/* sort segments by Hvalues, used by purge_segments*/
+static  int seg_H_sort(const void *p1, const void *p2);
+/* sort segments by positions, used by purge_segments*/
+static int seg_pos_sort(const void *p1, const void *p2);
+
+/* sort segments regardin their Hydrophobicity  */
+static int seg_H_sort(const void *p1, const void *p2) {
+  const segment_t *seg1, *seg2 ;
+
+  seg1 = (const segment_t *)p1;
+  seg2 = (const segment_t *)p2;
+
+  if(seg1->max > seg2->max)
+    return -1 ;
+
+  if(seg1->max < seg2->max)
+    return 1;
+
+  return 0 ;
+}
+
+
+/* get segments from the hydrophobicity profile
+ * extract all maximum whose value is greater than the putative cut-of value
+ * on the curve, and check for their compliance to the
+ * parameters, ie eliminate overlaping segments
+ * allocte the correspondig structure, and returns the number of "correct"
+ * segments found
+ */
+int get_segments(double *Hplot, segment_t **res,int nb, param_t params)  {
+
+  int n;
+  int i, n_tot;
+  size_t len;
+  double p_cut;
+  double prev, curr, next;
+
+  segment_t curr_seg;
+  segment_t *pos, *p;
+
+  p_cut = params.p_cut;
+  len = sizeof(segment_t);
+  prev = curr = next = 0.0;
+  pos = p = NULL;
+
+  if ((pos = (segment_t *)malloc(MAXSEGMENT*len)) == NULL)
+    error_fatal("Memory", NULL);
+
+  n_tot = MAXSEGMENT;
+
+  p = pos;
+  i = 0;
+  n = 0;
+  while(i < nb ) {
+    /* take segment at beginning of the sequence */
+    if (i == 0) prev = params.p_cut - 1.0;
+    else prev = Hplot[i-1];
+    curr = Hplot[i];
+    /* take segment at end of the sequence */
+    if (i == nb-1) next = curr - 1.0;
+    else next = Hplot[i+1];
+    /* <= and >= allow to get segments in position 0 */
+    /* and to get segments at the begining of a "plateau" */
+    if((curr > p_cut) && ((prev <= curr) && (curr >= next))) {
+      curr_seg.max = curr;
+      curr_seg.pos = i;
+      curr_seg.keep = 1;
+      /* resize the segment holder if needed */
+      if (n >= n_tot) {
+        n_tot =  n_tot + MAXSEGMENT;
+        if ((pos=(segment_t *)realloc(pos, n_tot*len)) == NULL)
+          error_fatal("Memory", "Reallocating segment holder");
+        p = pos + n;
+      }
+      *p=curr_seg;
+      n++;
+      p++;
+    } /* end if max */
+    i++;
+  } /* end while */
+
+  if (n != 0) {
+    qsort(pos, (size_t)n, len, seg_H_sort) ;
+    n = purge_segments(&pos, params, n);
+
+    /* allocating the real segment holder */
+    if ((pos = (segment_t *)realloc(pos, n*len)) == NULL)
+      error_fatal("Memory", "resizing results");
+  }
+
+  *res = pos;
+  return n;
+}
+
+
+/* clean all the "incorretc" segments,
+ * overlaping ones,
+ * contiguous ones */
+static int purge_segments(segment_t **seg, param_t params, int nbr) {
+
+  int i, j;
+  int n, len;
+  int pos1, pos2;
+  int tmspacer;
+  segment_t *p, *q;
+
+  n = 0;
+  tmspacer = params.tmspacer;
+
+  /* don't allow transmembrane segments to be contiguous*/
+  len = (2* params.q) + params.n + tmspacer;
+  i = j = 0;
+  p = q = * seg;
+  for (i = 0; i <nbr; i++) {
+    pos1 = p->pos;
+    q = *seg;
+    for (j=0; j< nbr; j++) {
+      pos2 = q->pos;
+
+      if(p->keep == FALSE){
+	q++;
+	continue;
+      }
+
+      if((pos2 < pos1) && (pos1 - len < pos2)){
+	q->keep = FALSE;
+	q++;
+	continue;
+      }
+
+      if((pos2 > pos1) && (pos1 + len > pos2)) {
+	q->keep = FALSE;
+	q++;
+	continue;
+      }
+      q++;
+    }/*end for j */
+
+    p++;
+  }/*end for i */
+
+  p = *seg;
+  n = 0;
+  for(i = 0; i < nbr; i++, n++, p++){
+    if(p->keep == 0){
+      p->pos = 9999999;
+      n--;
+    }
+  }
+  q = *seg;
+  qsort(q, (size_t)nbr, sizeof(segment_t), seg_pos_sort) ;
+
+  return n;
+}
+
+
+static int seg_pos_sort(const void *p1, const void *p2) {
+  const segment_t *seg1, *seg2;
+
+  seg1 = (const segment_t *)p1;
+  seg2 = (const segment_t *)p2;
+
+  if(seg1->pos > seg2->pos)
+    return 1 ;
+
+  if(seg1->pos < seg2->pos)
+    return -1;
+
+  return 0 ;
+
+}
+
+/* allocate seg_t and loop_t structures from the segment_t structure
+ * and returns the number of loops */
+int calc_loop(seq_t *sequence, segment_t **segment, loop_t **loopKS,
+	       seg_t **segKS, param_t params, int nbr)
+{
+  loop_t *l_res, *l;
+  seg_t  *s_res, *s;
+  segment_t *seg;
+
+  int i, n, q_win;
+  int start, stop, x, y;
+  int state;
+  int win_len;
+  int seq_len;
+  char *seq;
+
+  start = stop = 0;
+
+  win_len = (2*params.q) + params.n;  /* full window length  */
+  q_win = params.q;		      /* flanking region length  */
+
+  seq = sequence->seq;
+  seq_len = sequence->size;
+  seg = *segment;
+  state = -1;
+
+  n = nbr+1;
+
+  if ((l_res = (loop_t *)malloc(n*sizeof(loop_t))) == NULL){
+    error_fatal("memory", "allocating loops");
+  }
+  if ((s_res = (seg_t *)malloc(nbr*sizeof(seg_t))) == NULL) {
+    error_fatal("memory", "allocating segments");
+  }
+  l = l_res;
+  s = s_res;
+
+  if(seg[0].pos == 0) { /* sequence starts with a segment */
+    l[0].start = -1;
+    l++;
+    state = 1;
+  }
+
+  for(i = 0; i < nbr; i++, seg++) {
+
+    /* we are in a loop */
+    if(state == -1){
+      x = start = stop;
+      y = stop = seg->pos;
+
+      l->start = start;
+      l->stop  = stop;
+      if ((start - q_win) >= 0){
+	x = start - q_win;
+      }
+      if ((stop + q_win) <= seq_len) {
+	y = stop + q_win;
+      }
+      l->delta = countkr(seq, x, y);
+      state *= -1;
+      l++;
+    }
+    /* we are now in a menbrane segment */
+    if(state == 1);{
+      start = stop;
+      stop = start + win_len;
+      s->start = start;
+      s->stop = stop;
+      s->H = seg->max;
+      if (seg->max >= params.c_cut) {
+	s->kind = CERTAIN; /* 1 */
+	s->probTM = 1.0;
+      }
+      else {
+	s->kind = PUTATIVE; /* 0 */
+	s->probTM = (seg->max - params.p_cut) / (params.c_cut - params.p_cut);
+      }
+      x = start + q_win;
+      y =  stop - q_win;
+      s->delta = countkr(seq, x, y);
+      s++;
+      state *= -1;
+    }
+  }
+
+  /* dealing with the last segment if it exists */
+  if (stop < seq_len ) {
+    start = stop;
+    stop = sequence->size;
+    l->start = start;
+    l->stop = stop;
+    l->delta = countkr(seq, start - q_win, stop);
+  }
+  else { /* sequence ends with a segment */
+    l->start = -1;
+  }
+
+  *segKS = s_res;
+  *loopKS = l_res;
+
+  return n++;
+}
diff --git a/src/loop.h b/src/loop.h
new file mode 100644
index 0000000..280eb05
--- /dev/null
+++ b/src/loop.h
@@ -0,0 +1,55 @@
+/*   File:                /home/edeveaud/Work/toppred/src/loop.h
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifndef __LOOP_H_
+#define __LOOP_H_
+
+
+
+#include "params.h"
+#include "charge.h"
+#include "seq-reader.h"
+
+
+
+typedef struct segment_S {
+  double max;
+  int pos;
+  int stop;
+  int keep;
+}segment_t;
+
+
+typedef struct  seg_S {
+  int start;
+  int stop;
+  int kind;
+  int delta;
+  double H;
+  double probTM;
+}  seg_t;
+
+
+typedef struct loop_S {
+  int start;
+  int stop;
+  int delta;
+} loop_t;
+
+#define MAXSEGMENT 20
+#define TMSPACER 2
+#define PUTATIVE 0
+#define CERTAIN 1
+#define LOOP -1
+
+#define MAXSIZE 5
+
+/* retrieve the position of ech peak on the curve, with is associated
+   H value  */
+int get_segments(double *Hplot, segment_t **res,int nb, param_t params);
+
+int calc_loop(seq_t *sequence, segment_t **segment, loop_t **loop,
+	       seg_t **seg, param_t params, int nbr);
+#endif /* __LOOP_H_ */
diff --git a/src/main.c b/src/main.c
new file mode 100644
index 0000000..7bfe872
--- /dev/null
+++ b/src/main.c
@@ -0,0 +1,556 @@
+/*   File:                /home/edeveaud/Work/toppred/src/main.c
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#endif
+
+#ifdef HAVE_UNISTD_H
+#include <unistd.h>
+#endif
+
+#include <libgen.h>
+#include <math.h>
+
+#include <sys/stat.h>
+#include <sys/types.h>
+
+#ifdef HAVE_LIBGD
+#include "graph.h"
+#endif
+
+/* #include "params.h" */
+#include "main.h"
+#include "error.h"
+#include "usage.h"
+#include "seq-reader.h"
+#include "profile.h"
+#include "loop.h"
+#include "topology.h"
+#include "topoprint.h"
+#include "output.h"
+#include "mloutput.h"
+
+static char *prog;
+
+static void process_seq(FILE *IN, param_t params);
+
+int main(int argc, char **argv) {
+
+  /* variables and initialisation */
+  param_t params;
+  int i, uplot;
+  char  *out_file, *p;
+  FILE *IN;
+  char *data_dir;
+  char *buf;
+  size_t len;
+
+  /* default values */
+  out_file = NULL;
+  params.web = 0;
+  params.n = 11;
+  params.q = 5;
+  params.p_cut = 0.6; /* 0.5; */
+  params.c_cut = 1.0;
+  params.n_topos = 16;
+  params.seg_len = 60; /* 70; */
+  params.OUT = stdout;
+  params.gplot = TRUE;
+  params.hydro_file = TRUE;
+  params.plot_format = "x11";
+  params.plot_pause = "";
+  params.output = NEW;
+  params.topo_format = "png";
+  params.tmspacer = 2;
+  params.kingdom = PROKARYOTE;
+  uplot = FALSE;
+
+  /* check to see if a TOPPREDDATA environment variable is available */
+  /* yes overwritte the DATADIR default, and use it*/
+  if ((data_dir = getenv("TOPPREDDATA")) == NULL){
+    data_dir = DATADIR;
+  }
+
+  params.data_file = "GES-scale";
+  params.ce_file = "CYTEXT-scale";
+
+  /* get progname */
+  prog = argv[0];
+  if((p = strrchr(prog, '/')) != NULL)
+    prog = ++p;
+
+
+  /* check syntax option on command line */
+  i = 0;
+  while((i = getopt(argc, argv, "c:d:eg:hH:n:N:o:O:p:q:s:t:vy")) != -1) {
+    switch(i) {
+
+    case 'c':
+      params.c_cut = atof(optarg);
+      break;
+
+    case 'd':
+      params.tmspacer = atoi(optarg);
+      break;
+
+    case 'e':
+      params.kingdom = EUKARYOTE;
+      break;
+
+    case 'g':
+#ifdef HAVE_GNUPLOT
+      params.gplot = TRUE;
+      params.plot_format = optarg;
+      uplot = TRUE;
+#else
+      if (strcmp(optarg, "none") != 0) {
+	(void)fprintf(stderr, "Missing gnuplot support: -g option unavailable");
+	return EXIT_FAILURE;
+      }
+      params.gplot = FALSE;
+      params.plot_format = "none";
+#endif /* HAVE_GNUPLOT */
+      break;
+
+    case 'h':
+      usage(prog);
+      return EXIT_SUCCESS;
+
+    case 'H':
+      params.data_file = optarg;
+      break;
+
+    case 'n':
+      params.n = atoi(optarg);
+      break;
+
+    case 'N':
+      params.n_topos = atoi(optarg);
+      break;
+
+    case 'o':
+      out_file = optarg;
+      break;
+
+    case 'O':
+      params.output = check_output_format(prog, optarg);
+      break;
+
+    case 'p':
+      params.p_cut = atof(optarg);
+      break;
+
+    case 'q':
+      params.q = atoi(optarg);
+      break;
+
+    case 's':
+      params.seg_len = atoi(optarg);
+      break;
+
+    case 't':
+#ifdef HAVE_LIBGD
+      params.topo_format = optarg;
+#else
+      if (strcmp(optarg, "none") != 0) {
+	(void)fprintf(stderr, "Missing libgd support: -t option unavailable");
+	return EXIT_FAILURE;
+      }
+      params.topo_format = "none";
+#endif
+      break;
+
+    case 'v':
+      (void)fprintf(stdout, "%s (%s %s)\n", prog, PACKAGE, VERSION);
+      return EXIT_SUCCESS;
+
+    case 'y':
+      params.hydro_file = FALSE;
+      break;
+
+    default :
+      usage(prog);
+      return EXIT_FAILURE;
+    }
+  }
+
+  /* change default values for different output formats */
+  if (params.output == HTML && !uplot) {
+    params.plot_format = PNG;
+  }
+
+  /* checking validity of arguments */
+  if (params.n < 0)
+    error_fatal(prog, "n should be a positive number.");
+  if (params.q < 0)
+    error_fatal(prog, "q should be a positive number.");
+  if(params.n + params.q == 0)
+    error_fatal(prog, "Humm, n or q can be null, but not simultaneously.");
+  if(params.c_cut < params.p_cut)
+    error_fatal(prog, "certain cutoff should be greater than putative cutoff.");
+  if(params.seg_len <= 0)
+    error_fatal(prog, "critical segment length s should be a positive integer.");
+  if(params.tmspacer <=0)
+    error_fatal(prog, "critical tm distance should be a positive integer.");
+  if(params.n_topos <= 0)
+    error_fatal(prog, "N should be a positive number.");
+
+  /* output file */
+  if(out_file != NULL && (params.OUT = fopen(out_file, "w")) == NULL)
+    error_fatal(out_file, NULL);
+
+  /* get the directory holder for files*/
+  params.out_dir = strdup(dirname(out_file));
+
+  /* check the plot format */
+  check_plot_format(prog, &params);
+
+  /* check the topo format */
+  check_topo_format(prog, &params);
+
+  /* check if there's some files to deal with */
+  if (optind >= argc) {
+    usage(prog);
+    return EXIT_FAILURE;
+  }
+
+  /* load the hphobes values once */
+  len = strlen(data_dir) + 1 + strlen(params.data_file) + 1;
+  if ((buf = (char *)malloc(len)) == NULL)
+    error_fatal("memory", NULL);
+  (void)snprintf(buf, len, "%s/%s", data_dir, params.data_file);
+  read_Hphobes_datas(buf, params.Hdatas);
+  free(buf);
+
+  /* load cyt-ext values from cefile */
+  len = strlen(data_dir) + 1 + strlen(params.ce_file) + 1;
+  if ((buf = (char *)malloc(len)) == NULL)
+    error_fatal("memory", NULL);
+  (void)snprintf(buf, len, "%s/%s", data_dir, params.ce_file);
+  (void) read_cytext_datas (buf, &(params.scales));
+  free(buf);
+
+  /* print parameter values */
+
+  switch (params.output) {
+  case HTML:
+    break;
+  case OLD:
+    old_print_firstparameters(&params);
+    break;
+  default: /* NEW */
+    new_print_parameters(&params);
+  }
+
+  IN = stdin;
+  /* process all the input files */
+  for (i = optind; i <argc; i++) {
+    if (*argv[i] != '-' && (IN = fopen(argv[i], "r")) == NULL)
+      error_fatal(argv[i], NULL);
+
+    if (params.output == OLD) {
+      (void) fprintf (params.OUT, "Using sequence file: %s\n\n", argv[i]);
+    }
+
+    process_seq(IN, params);
+
+    if(fclose(IN) !=0)
+      error_fatal(argv[i], NULL);
+
+  }
+
+  if(out_file != NULL && (fclose(params.OUT) == EOF)){
+    error_fatal(out_file, NULL); }
+
+  free(params.out_dir);
+
+  return 0;
+}
+
+
+static void process_seq(FILE *IN, param_t params) {
+
+  int i, s;
+  int nb_plot;
+  int ntopos, maxtopos;
+  size_t len;
+  double *Hprofile;
+  seq_t seq;
+  segment_t *segments;
+  loop_t *KSloop;
+  seg_t *KSseg;
+  elem_t KSelem;
+  topo_t *KStopo;
+  int nel2prn;
+  topoprint_t topo2prn;
+  FILE *OUT;
+  int skip;
+  char *alphabet;
+  char *err_msg;
+
+  OUT = params.OUT;
+  Hprofile = NULL;
+  segments = NULL;
+
+
+  alphabet = alphabet_maker(DEFAULT_ALPHABET);
+  while(read_seq(IN, &seq, alphabet) !=0) {
+
+/**** verify sequence ****/
+    skip = 0;
+
+    if(seq.size > MAXSEQLEN) {
+      err_msg = "sequence too long -- skipped";
+      skip = 1;
+    }
+    if(seq.size < ((2 * params.q) + params.n)) {
+      err_msg = "sequence too short -- skipped";
+      skip = 1;
+    }
+    if(seq.size == 0) {
+      err_msg = "empty sequence -- skipped";
+      skip = 1;
+    }
+
+    if(skip) {
+      error_warn(seq.id, err_msg);
+      free_seq(&seq);
+      continue;
+    }
+
+/**** print sequence ****/
+    switch (params.output) {
+    case HTML:
+      OUT = params.OUT = init_html (seq.id, params.out_dir);
+      html_header (OUT, seq.id);
+      html_parameters (OUT, &params);
+      /* sequence is printed below the plot */
+      break;
+    case OLD:
+    default:
+      (void) fprintf(OUT, "\nSequence : %s  (%d res)\n", seq.id, seq.size);
+      print_sequence(OUT, seq.seq);
+      (void) fprintf(OUT, "\n");
+    }
+
+    if (params.output == OLD) { old_print_secondparameters(&params); }
+
+/**** generation profile ****/
+
+    /* allocate memory of the hydrophobic profile */
+    nb_plot = seq.size - ((2 * params.q) + params.n) + 1;
+    len = nb_plot * sizeof(double);
+    if ((Hprofile = (double *)malloc(len)) == NULL) {
+      error_fatal("memory", NULL);
+    }
+
+    /* calc Hval for all window positions */
+    calc_profile(&seq, params, Hprofile);
+
+    /*****  find transmembran segments  *****/
+    s = get_segments(Hprofile, &segments, nb_plot , params);
+
+/*****  produce profile plot with transmembran segment indication  *****/
+
+    /* we produce the hydrophobic profile datas */
+    if (params.hydro_file == TRUE)
+      plot_values(Hprofile, &seq, params);
+
+    switch (params.output) {
+    case HTML:
+      html_plot(OUT, seq.id, &params);
+      html_sequence (OUT, &seq);
+      break;
+    /* case OLD: */
+    /* default: */ /* NEW */
+    }
+
+#ifdef HAVE_GNUPLOT
+    if(!params.plot_outfile && strlen(params.plot_pause) != 0) {
+      (void)fprintf(stdout, "hit return to continue\n");
+    }
+    /* produce de gnuplot image */
+    if(params.gplot){
+      gplot(Hprofile, &segments, &seq, s, params);
+    }
+#endif
+
+/**** transform segments structure to segment-loop structure   ****/
+
+    if (s != 0) {
+      (void)calc_loop(&seq, &segments, &KSloop,  &KSseg, params, s);
+    }
+
+    /* as profile and segments-storage struct is no longer needed purge it */
+    free(Hprofile);
+    free(segments);
+
+/**** print transmembran segment summary ****/
+
+    switch (params.output) {
+    case OLD:
+      break;
+    case HTML:
+      (void)fprintf (OUT, "<H4><CENTER>Transmembran segments</CENTER></H4>\n");
+      start_phrase();
+    default:
+      (void) fprintf(OUT, "Found: %d segments\n\n", s);
+      if (params.output == HTML) { end_phrase(); start_phrase(); }
+      if (s) { print_tmsummary(OUT, s, KSseg); }
+    }
+
+    if (params.output == HTML) { end_phrase(); }
+
+/**** construct topologies ****/
+
+    if (s != 0) {
+
+      KSelem.nsegs = s;
+      KSelem.nputatives = 0;
+      for (i=0; i< s; i++)
+	if(KSseg[i].kind == 0) KSelem.nputatives++;
+      KSelem.segs = KSseg;
+      KSelem.loops = KSloop;
+
+      if (KSelem.nputatives > MAXPUTATIVES_CALC) {
+	error_warn(seq.id,
+		   "too many putative segments to calculate best topologies");
+      }
+      else {
+
+	maxtopos = ntopos = (int) pow(2.0, (double) KSelem.nputatives);
+
+/**** print topology summary ****/
+
+	if (params.output == HTML) {
+	  (void) fprintf (OUT, "<H4><CENTER>Topologies</CENTER></H4>\n");
+	  start_phrase();
+	}
+
+
+	(void)fprintf(OUT, "\nTotal of %d structures are to be tested\n\n",
+		      maxtopos);
+	if (params.output == OLD) {
+	  (void) fprintf (OUT, "\n");
+	  old_print_tmsummary(OUT, s, KSseg, seq.seq);
+	}
+
+	if (params.output == HTML) { end_phrase(); start_phrase(); }
+
+	if (ntopos > params.n_topos) {
+	  error_warn(seq.id, "more topologies than printed");
+	  ntopos = params.n_topos;
+	}
+
+/**** calculate topologies and stock the ntopos best ones ****/
+
+	if ((KStopo = (topo_t *) malloc (ntopos*sizeof(topo_t))) == NULL)
+	  error_fatal("memory", NULL);
+
+	ntopos = tp_calc(KStopo, &KSelem, &seq, &params);
+	/* sort topologies by highest Arg+Lys bias */
+	qsort((void *)KStopo, (size_t)ntopos, sizeof(topo_t), tp_compare);
+
+/**** print the best topologies ****/
+
+	/* allocate memory for max number of structure elements to print */
+	nel2prn =  2*KSelem.nsegs + 1;
+	if ((topo2prn.elps = (elprint_t *) malloc (nel2prn*sizeof(elprint_t))) == NULL)
+	  error_fatal("memory", NULL);
+	topo2prn.image = NULL;
+
+	for (i=0; i<ntopos; i++) {
+	  /* construct all topology information */
+	  topo2prn.nr = i+1;
+	  topo2prn.putatives = KStopo[i].putatives;
+	  topo2prn.kr = KStopo[i].kr;
+	  nel2prn = tp_decode (&topo2prn, &KSelem, &seq, &params);
+
+/**** print topology image ****/
+#ifdef HAVE_LIBGD
+	  if(strcmp(params.topo_format, "none") != 0) {
+	    int image_len = strlen(seq.id) + strlen(params.topo_format) + 6 + 3;
+	    if ((topo2prn.image = (char *) realloc (topo2prn.image, image_len*sizeof(char))) == NULL)
+	      error_fatal("memory", NULL);
+	    (void)sprintf(topo2prn.image, "%s-%d.%s",
+			  seq.id, topo2prn.nr, params.topo_format);
+
+	    /* graphic print go here */
+	    (void)topo_graph_print(&topo2prn, nel2prn, &params, &seq);
+	  }
+#endif
+
+/**** printing nongraphic output ****/
+
+	  switch (params.output) {
+	  case HTML:
+	    html_topology (&topo2prn, nel2prn, &params);
+	    break;
+	  case OLD:
+	    (void)fprintf(OUT, "\n-----------------------------------------------------------------------\n");
+	    tp_toppred_fprintf (&topo2prn, nel2prn, &params);
+	    break;
+	  default: /* NEW */
+	    tp_new_print (&topo2prn, nel2prn, &params);
+	  }
+
+	} /* end for */
+
+/**** nettoyage ****/
+
+	/* free element structure for printing */
+	if (topo2prn.image != NULL) {
+	  free(topo2prn.image);
+	}
+	free(topo2prn.elps);
+	free(KStopo);
+
+      } /* end else of if (KSelem.nputatives > MAXPUTATIVES_CALC) */
+
+      /* free KS structs even if no topologie calculated */
+      free(KSloop);
+      free(KSseg);
+
+    } /* end if (s != 0) */
+
+    /* freeing the seq-storage struct */
+    free_seq(&seq);
+
+    /* print sequence end informations and close html output file */
+
+    switch(params.output) {
+    case OLD:
+      (void)fprintf(OUT, "\n-----------------------------------------------------------------------\n");
+      break;
+    case HTML:
+      (void)fprintf(OUT, "\n");
+      (void)fprintf(OUT, "</BODY>\n");
+      (void)fprintf(OUT, "</HTML>\n");
+      break;
+      /* default : */
+    }
+
+    if (params.output == HTML) {
+      if (fclose(params.OUT) == EOF) {
+	error_fatal(prog, NULL);
+      }
+      OUT=stdout;
+    }
+
+  }/* end while j=read_seq */
+
+  free(alphabet);
+
+  return;
+}
+
+
diff --git a/src/main.h b/src/main.h
new file mode 100644
index 0000000..4f88fe7
--- /dev/null
+++ b/src/main.h
@@ -0,0 +1,26 @@
+/*   File:                /home/edeveaud/Work/toppred/src/main.h
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifndef __MAIN_H_
+#define __MAIN_H_
+
+
+
+
+#define MAXSEQLEN 30000
+
+
+#ifndef DATADIR
+#define DATADIR "/usr/local/share/"PACKAGE
+#endif
+
+
+#endif /* __MAIN_H_ */
+
+
+
+
+
+
diff --git a/src/mloutput.c b/src/mloutput.c
new file mode 100644
index 0000000..96f1b7a
--- /dev/null
+++ b/src/mloutput.c
@@ -0,0 +1,161 @@
+/* -----------------------------------------------------------------
+ file      : /home/schuerer/toppred/src/mloutput.c
+
+ author    : Schuerer
+ description :
+
+
+-------------------------------------------------------------------- */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include "error.h"
+#include "config.h"
+#include "usage.h"
+
+#include "output.h"
+#include "mloutput.h"
+
+/* internal macros */
+
+/* internal prototypes */
+
+FILE *init_html(char *name, char *dir) {
+  char *filename;
+  FILE *OUT;
+  int len;
+
+  len = strlen(dir) + 1 + strlen(name) + 5;
+
+  if ((filename = malloc((size_t)len+1)) == NULL) {
+    error_fatal("html output file", NULL); }
+
+  (void)sprintf(filename, "%s/%s.html", dir, name);
+
+  if ((OUT = fopen(filename, "w")) == NULL) {
+    error_fatal(filename, NULL); }
+
+  free(filename);
+
+  return OUT; }
+
+
+void html_header (FILE *OUT, char *name) {
+
+  (void)fprintf(OUT, "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\"\n");
+  (void)fprintf(OUT, " \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n");
+  (void)fprintf(OUT, "<HTML>\n");
+
+  (void)fprintf(OUT, "<HEAD>\n");
+  (void)fprintf(OUT, "<META http-equiv=\"Content-Type\" content=\"text/html;");
+  (void)fprintf(OUT, " charset=iso-8859-1\">\n");
+  (void)fprintf(OUT, "<TITLE>Toppred prediction %s</TITLE>\n", name);
+  (void)fprintf(OUT, "</HEAD>\n");
+
+  (void)fprintf(OUT, "<BODY>\n");
+  (void)fprintf(OUT, "<H1><CENTER>Toppred prediction %s</CENTER></H1>\n", name);
+  (void)fprintf(OUT, "<PRE>\n");
+
+  return; }
+
+
+void html_parameters (FILE *OUT, param_t *p) {
+
+  (void) fprintf (OUT, "<H4><CENTER>Algorithm specific parameters</CENTER></H4>\n\n");
+  (void) fprintf (OUT, "<PRE>\n");
+  new_print_parameters (p);
+  (void) fprintf (OUT, "</PRE>\n");
+
+}
+
+void html_sequence (FILE *OUT, seq_t *seq) {
+
+  (void)fprintf(OUT, "<H4><CENTER>Sequence</CENTER></H4>\n");
+  start_phrase();
+  (void) fprintf(OUT, "Sequence : %s  (%d res)\n", seq->id, seq->size);
+  print_sequence(OUT, seq->seq);
+  end_phrase();
+
+}
+
+void html_plot (FILE *OUT, char *seqname, param_t *p) {
+
+  (void)fprintf(OUT, "<H4><CENTER>Hydrophobicity plot</CENTER></H4>\n");
+  (void)fprintf(OUT, "<P><CENTER>\n");
+#ifdef HAVE_GNUPLOT
+  if (p->gplot && p->plot_outfile && !strcmp(p->plot_outfile, PNG)) {
+    (void)fprintf(OUT, "<IMG SRC=\"./%s.png\">\n", seqname);
+  }
+#endif
+  (void)fprintf(OUT, "<PRE>\n");
+  (void)fprintf(OUT, "<P>\n");
+  (void)fprintf(OUT, "<A HREF=\"./%s.hydro\">view hydrophobic values</A>\n",
+		seqname);
+  (void)fprintf(OUT, "</P>\n");
+  (void)fprintf(OUT, "</CENTER></P>\n");
+
+}
+
+void html_topology (topoprint_t *topo, int nel, param_t *para) {
+
+  FILE *OUT = para->OUT;
+  int clen = para->seg_len;
+  elprint_t *el = topo->elps;
+  int i;
+
+  /* header */
+  (void) fprintf (OUT, "%8s %6s %6s %6s %4s %4s %8s %8s %8s %8s\n",
+		  "HEADER  ", "START", "STOP", "LEN",
+		  "PROB", "HP",
+		  "DARGLYS", "DCYTEXT",  "DNCHARGE", "DNNEGPOS");
+
+
+  /* topo summary */
+  (void) fprintf (OUT, "%8s ", "TOPOLOGY");
+#ifdef  HAVE_LIBGD
+  if (!strcmp(para->topo_format, PNG)) {
+    (void) fprintf (OUT, "<A HREF=\"./%s\">%3d</A>", topo->image, topo->nr);
+  }
+  else {
+    (void) fprintf (OUT, "%3d", topo->nr);
+  }
+#else
+  (void) fprintf (OUT, "%3d", topo->nr);
+#endif
+
+  (void) fprintf (OUT, "                  %3.2f       %6.2f   %6.2f  %8.2f %8.2f\n",
+		  topo->prob, (double) topo->kr,
+		  topo->cytext, (double) topo->nterm, topo->negpos);
+
+  (void) fprintf (OUT, "%8s                                %7s  %7s  %8s\n",
+		  "TOPOLOGY",
+  		  new_orientation((double) (topo->kr+topo->ncharge)),
+  		  new_orientation(topo->cytext * (-1.0)),
+		  new_orientation((double) topo->nterm));
+
+  /* topo elements */
+  for (i=0; i<nel; i++) {
+      if (i%2) { /* tmsegment (index impair) */
+	(void) fprintf(OUT, "%8s %6d %6d %6d %4.2f %4.2f\n",
+		       el[i].tm.type, el[i].tm.start+1, el[i].tm.stop,
+		       el[i].tm.len, el[i].tm.prob, el[i].tm.H);
+      }
+      else { /* loop (index pair) */
+	if (el[i].lo.len > clen) { /* cytext value is significant */
+	  (void) fprintf(OUT, "%8s %6d %6d %6d           (%6.2f)  %6.2f\n",
+			 el[i].lo.type, el[i].lo.start+1, el[i].lo.stop,
+			 el[i].lo.len, (double) el[i].lo.kr, el[i].lo.cytext);
+	}
+	else if (el[i].lo.len != 0) { /* kr value is significant */
+	  (void) fprintf(OUT, "%8s %6d %6d %6d            %6.2f  (%6.2f)\n",
+			 el[i].lo.type, el[i].lo.start+1, el[i].lo.stop,
+			 el[i].lo.len, (double) el[i].lo.kr, el[i].lo.cytext);
+	}
+      }
+  }
+
+  (void) fprintf(OUT, "\n");
+
+  return;
+}
diff --git a/src/mloutput.h b/src/mloutput.h
new file mode 100644
index 0000000..76e1185
--- /dev/null
+++ b/src/mloutput.h
@@ -0,0 +1,26 @@
+/*   File:                /home/schuerer/toppred/src/mloutput.h
+ *   Author:              Schuerer
+ */
+
+#ifndef __MLOUTPUT_H_
+#define __MLOUTPUT_H_
+
+#include <stdlib.h>
+#include "loop.h"
+#include "params.h"
+#include "topoprint.h"
+#include "seq-reader.h"
+
+/* html output functions */
+#define start_phrase() (void) fprintf(OUT, "<PRE><P>\n")
+#define end_phrase()   (void) fprintf(OUT, "</P></PRE>\n")
+
+FILE *init_html(char *name, char *dir);
+void html_header (FILE *OUT, char *name);
+void html_parameters (FILE *OUT, param_t *p);
+
+void html_sequence (FILE *OUT, seq_t *seq);
+void html_plot (FILE *OUT, char *seqname, param_t *p);
+void html_topology (topoprint_t *topo, int nel, param_t *para);
+
+#endif /* _MLOUTPUT_H_ */
diff --git a/src/output.c b/src/output.c
new file mode 100644
index 0000000..63e1d21
--- /dev/null
+++ b/src/output.c
@@ -0,0 +1,132 @@
+/* -----------------------------------------------------------------
+ file      : /home/schuerer/toppred/src/baseprint.c
+
+ author    : Schuerer
+ description :
+
+
+-------------------------------------------------------------------- */
+
+#include <stdio.h>
+#include <string.h>
+#include "output.h"
+
+#include "error.h"
+
+/* internal macros */
+
+/* internal prototypes */
+
+void print_sequence (FILE *OUT, char *seq) {
+
+  int k;
+  char *sq;
+
+  sq = seq;
+  k = 1;
+  while(*sq){
+    (void)fputc(*sq, OUT);
+    sq++;
+    k++;
+    if(k>60) {
+      (void)fputc('\n', OUT);
+      k=1;
+    }
+  }
+  (void) fputc('\n', OUT);
+}
+
+void print_tmsummary (FILE *OUT, int nseg, seg_t *KSseg) {
+
+  char *type;
+  int i;
+
+  (void)fprintf(OUT, "Candidate membrane-spanning segments:\n\n");
+  (void)fprintf(OUT, " Helix Begin - End   Score Certainity\n");
+  for(i=0; i< nseg; i++) {
+    type = NULL;
+    (void)fprintf(OUT, "%6d %5i - %-5i %-6.3f",
+                  i+1, KSseg[i].start+1, KSseg[i].stop, KSseg[i].H);
+    if(KSseg[i].kind == 0) type = "Putative";
+    if(KSseg[i].kind == 1) type = "Certain";
+    (void)fprintf(OUT, "%s\n", type);
+  }
+}
+
+void new_print_parameters (param_t *p) {
+
+  FILE *OUT = p->OUT;
+  char *scale;
+  char *cytext;
+
+  scale = p->data_file;
+  cytext = p->ce_file;
+
+  (void) fprintf (OUT, "Algorithm specific parameters: \n\n");
+
+  (void) fprintf (OUT, "Full window size : %d\n", 2*p->q+p->n);
+  (void) fprintf (OUT, "Core window size : %d\n", p->n);
+  (void) fprintf (OUT, "Wedge window size: %d\n", p->q);
+  (void) fprintf (OUT, "Using hydrophobicity file: %s\n\n", scale);
+
+  (void) fprintf (OUT, "Cutoff for certain transmembrane segments: %.2f\n",
+		  p->c_cut);
+  (void) fprintf (OUT, "Cutoff for putative transmembrane segments: %.2f\n",
+		  p->p_cut);
+  (void) fprintf (OUT, "Critical distance between 2 transmembrane segments: %d\n\n",
+		  p->tmspacer);
+
+  (void) fprintf (OUT, "Critical loop length:  %d\n\n", p->seg_len);
+  (void) fprintf (OUT, "Kingdom: %s\n\n",
+		  (p->kingdom == PROKARYOTE) ? "procaryote" : "eucaryote");
+  (void) fprintf (OUT, "Using cyt/ext file: %s\n\n", cytext);
+  /*  (void) fprintf (OUT, "\nCharge-pair energy: 0\n");  mettre en variable */
+
+}
+
+void old_print_firstparameters (param_t *p) {
+
+  FILE *OUT = p->OUT;
+  char *scale, *cytext;
+
+  (void) fprintf (OUT, "\n");
+
+  cytext = p->ce_file;
+  scale = p->data_file;
+  (void) fprintf (OUT, "Using hydrophobicity file: %s\n", scale);
+  (void) fprintf (OUT, "Using cyt/ext file: %s\n", cytext);
+}
+
+void old_print_tmsummary (FILE *OUT, int nseg, seg_t *KSseg, char *seq) {
+
+  char *type;
+  int i;
+
+  (void)fprintf(OUT, "Candidate membrane-spanning segments:\n\n");
+  (void)fprintf(OUT, " Helix Begin   End   Score Certainity\n");
+  for(i=0; i< nseg; i++) {
+    type = NULL;
+    (void)fprintf(OUT, "%6d %5i   %-5i %-6.3f",
+                  i+1, KSseg[i].start+1, KSseg[i].stop, KSseg[i].H);
+    if(KSseg[i].kind == 0) type = "Putative";
+    if(KSseg[i].kind == 1) type = "Certain";
+    (void)fprintf(OUT, "%s\n", type);
+  }
+}
+
+void old_print_secondparameters (param_t *p) {
+
+  FILE *OUT = p->OUT;
+
+  (void) fprintf (OUT, "\n(p)rokaryotic or (e)ukaryotic: %c\n\n",
+		  (p->kingdom == PROKARYOTE) ? 'p' : 'e');
+
+  (void) fprintf (OUT, "\nCharge-pair energy: 0\n\n"); /* mettre en variable */
+  (void) fprintf (OUT, "Length of full window (odd number!): %d\n\n", 2*p->q+p->n);
+  (void) fprintf (OUT, "Length of core window (odd number!): %d\n\n", p->n);
+  (void) fprintf (OUT, "Number of residues to add to each end of helix: 1\n\n");
+  (void) fprintf (OUT, "Critical length: %d\n\n", p->seg_len);
+  (void) fprintf (OUT, "Upper cutoff for candidates: %.2f\n\n", p->c_cut);
+  (void) fprintf (OUT, "Lower cutoff for candidates: %.2f", p->p_cut);
+
+}
diff --git a/src/output.h b/src/output.h
new file mode 100644
index 0000000..8fc5378
--- /dev/null
+++ b/src/output.h
@@ -0,0 +1,19 @@
+/*   File:                /home/schuerer/toppred/src/output.h
+ *   Author:              Schuerer
+ */
+
+#ifndef __OUTPUT_H_
+#define __OUTPUT_H_
+
+#include <stdlib.h>
+#include "loop.h"
+
+void new_print_parameters (param_t *p);
+void old_print_firstparameters (param_t *p);
+void old_print_secondparameters (param_t *p);
+
+void print_sequence (FILE *OUT, char *seq);
+void print_tmsummary (FILE *OUT, int nseg, seg_t *KSseg);
+void old_print_tmsummary (FILE *OUT, int nseg, seg_t *KSseg,char *seq);
+
+#endif /* __OUTPUT_H_ */
diff --git a/src/params.h b/src/params.h
new file mode 100644
index 0000000..36880ab
--- /dev/null
+++ b/src/params.h
@@ -0,0 +1,49 @@
+/*   File:                /home/edeveaud/Work/toppred/src/params.h
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifndef __PARAMS_H_
+#define __PARAMS_H_
+
+typedef struct scale_S {
+
+  double cyt[26];
+  double ext[26];
+  double sd[26];
+
+} scale_t;
+
+typedef struct param_S {
+  double Hdatas[26];
+  double c_cut;	/* certain cut-off */
+  double p_cut;	/* putative cut-off */
+  int n;		/* core window */
+  int q;		/* wedge window */
+  int seg_len;	/* segment lentgh */
+  int kingdom;       /* kingdom of species to which the sequence belongs */
+  int n_topos;	/* numbers of topologies to calculate/print */
+  int gplot;		/* to produce the ps Hphobe profile file or not */
+  int hydro_file;	/* to produce the hydro file or not */
+  char *out_dir;	/* where to store results files */
+  FILE *OUT;		/* where to display the results */
+  scale_t scales;       /* cyt-ext-sd scale file */
+
+  char *plot_pause;
+  char *topo_format;/* wich format to produce for the topo images */
+  char *data_file;	/* hydrophobicity scale */
+  char *ce_file;     /* cyt-ext-sd scale file */
+  char *plot_format;	/* wich format to produce */
+  char *plot_outfile;	/* prefix for the plot file */
+
+  int output;        /* output format */
+  int tmspacer;	/* critical tm distance */
+  int web;		/* for web output format */
+} param_t;
+
+#define BUFFLEN 100
+#define TRUE 1
+#define FALSE 0
+
+
+#endif
diff --git a/src/profile.c b/src/profile.c
new file mode 100644
index 0000000..9d82b32
--- /dev/null
+++ b/src/profile.c
@@ -0,0 +1,368 @@
+/*   File:                /home/edeveaud/Work/toppred/src/profile.c
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+*/
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#include <time.h>
+#endif
+
+#ifdef HAVE_UNISTD_H
+#include <unistd.h>
+#endif
+
+#include <ctype.h>
+
+#include "profile.h"
+#include "error.h"
+#include "output.h"
+
+/* as sequence verification was performed before. Thus I don't care
+   about checking, it is assumed all char (aa) submited will be
+   correct and is comprise between correc t bounds. */
+#define aa2H(c,d) (d)[(c)-'A']
+
+/* check aa syntax from sequence  based on IUPAC alphabet */
+static int is_aa(int aa);
+
+
+/* retreive Hphobes datas from file */
+void read_Hphobes_datas (char *file, double *hphobes_datas)
+{
+
+  int i, indx;
+  char *BUFF, *p, *q, *val;
+  int aa;
+  double Hval;
+
+  FILE *IN;
+
+  /* we initialise the storage to 0 */
+  for(i = 0; i < 26; i++)
+    hphobes_datas[i] = 0;
+
+  if ((IN = fopen(file, "r")) == NULL)
+    error_fatal(file, NULL);
+
+  if((BUFF = (char *)malloc(sizeof(char)*BUFFLEN)) == NULL)
+    error_fatal("memory", NULL);
+
+  if((val = (char *)malloc(sizeof(char)*(MAXSIZE + 1))) == NULL)
+    error_fatal("memory", NULL);
+
+  while (fgets(BUFF, BUFFLEN, IN) != NULL) {
+
+    /* we skip the comment lines */
+    if (*BUFF == '\0')
+      continue;
+
+    if (*BUFF == '#')
+      continue;
+
+    indx = -1;
+    p = BUFF;
+
+    /* get aa definition */
+    aa = (int)*p;
+    if (!is_aa(aa)){
+      error_warn(file, "Unknown aminoacid.");
+      continue;
+    }
+
+    p++;
+
+    while (*p != '\0'  && isalpha((int)*p)) p++;
+    while (*p != '\0' && isspace((int)*p)) p++;
+
+    if(*p == '\0')
+      error_fatal(file, "Incorrect format.");
+
+    /* get hydrophobic value */
+    q = val;
+    *q = '\0';
+    while (*p != '\0' && !isspace((int)*p)) {
+      *q++ = *p++; }
+    *q = '\0';
+
+    /*store the datas */
+    Hval = atof(val);
+    indx = (aa -'A');
+    hphobes_datas[indx] = Hval;
+  }
+
+  if(fclose(IN) == EOF){
+    error_fatal(file, NULL);
+  }
+
+  free(BUFF);
+  free(val);
+
+  return ;
+}
+
+
+
+
+/* retrieve the hydropbobic calcul for each positions */
+/* ___________________________________________________________________________
+ *
+ *  based on  G. von Heijne J. Mol. Biol. 1992 225,487-494
+ *
+ *       -->  l=2q+1  <--
+ *          +--------+
+ *     +----|        |----+
+ *     +----+--------+----+
+ *  -->       l=2n+1       <--
+ *
+ * for each given window position on sequence, i,
+ * the hydrophobicity value of the window is calculated this way
+ * heach hi for a given aa on the window is multiplied by Wi
+ *  Wi = | 1/S              1<= i <= (n - q + 1)
+ *       | (n - q + 1)/S    (n - q + 1) < i < (n + q + 1)
+ *       | (2n + 2 - i)/S   (n + q + 1) <= i <= (2n + 1)
+ *        with S = (1 + n)^2 - q^2
+ * ___________________________________________________________________________
+ *
+ * rewritten in order to use n as length of the center window and q
+ * as length of the wedge window
+ *
+ *  ie
+ *       -->  l=n     <--
+ *          +--------+
+ *     +----|        |----+
+ *     +----+--------+----+
+ *  --> l=q  <--  --> l=q  <--
+ *
+ *  -->       l=2q+n       <--
+ *
+ * thus ponderation calculus become
+ *
+ * Wi = | 1/S                 1<= i <= q
+ *      | (q + 1)/S           (q + 1) < i < (q + n)
+ *      | (2q + n + 1 - i)/S  (q + n +1) <= i <= (q + 2n)
+ *       with S = (q + 1)* (n + q)
+ */
+
+void calc_profile(seq_t *seq_holder, param_t params, double *profile) {
+
+  char *seq, *p;
+  int i, j, n, q;
+  int R1, R2;
+  int L, size;
+  double S;
+  double Hval;
+  double *Hdatas;
+  double d, wi;
+
+  n = params.n;			/* 11  */
+  q = params.q;			/*  5  */
+  Hdatas = params.Hdatas;
+
+  L = (2*q)+n;
+  size = seq_holder->size - L ;
+  seq = seq_holder->seq;
+  p = seq;
+
+  S = (double) ((q+1)*(n+q));
+
+  R1 = q;
+  R2 = n + q + 1;
+  for(i = 0; i<= size; i++ ) { /* loop on sequence */
+    Hval = 0.0;
+    d = 0.0;
+    p = seq+i;
+
+    for(j = 1; j<= R1; j++) { /*loop on window 1*/
+      wi = ((double) j) / S;
+      d = aa2H(p[j-1], Hdatas) * wi;
+      Hval = Hval + d;
+    }
+
+    wi = ((double) (q + 1)) / S;
+    for(j=R1+1 ; j < R2; j++){ /*loop on window 2*/
+      d = aa2H(p[j-1], Hdatas) * wi;
+      Hval = Hval + d;
+    }
+
+
+    for(j = R2; j<= L; j++) { /*loop on window 3*/
+      wi = ((double) (2 * q + n + 1 - j)) /  S;
+      d = aa2H(p[j-1], Hdatas) * wi;
+      Hval = Hval + d;
+    }
+    profile[i] = Hval;
+  }
+}
+
+
+
+/* print hydrophobic values, in a useable manner */
+void plot_values(double *plot, seq_t *seq, param_t params) {
+
+  char *id, *filename, *dir;
+  FILE *OUT;
+  time_t timer;
+  int size;
+  char  *scale;
+  int core_win, full_win;
+  int len;
+  int i;
+
+  id = seq->id;
+  size = seq->size;
+  dir = params.out_dir;
+  scale = params.data_file;
+
+  core_win = params.n;
+  full_win = core_win + (2 * params.q);
+
+  /* setting the creation time */
+  if (time(&timer) == (time_t) -1) error_warn("time", NULL);
+
+  /* creating the output file-name and associated FILE */
+  len =  strlen(dir) + 1 + strlen(id) + 6 + 1;
+  if ((filename = (char *)malloc((size_t)len)) == NULL){
+     error_fatal("memory", NULL);
+   }
+   (void)sprintf(filename, "%s/%s.hydro",dir, id);
+   if((OUT=fopen(filename, "w")) == NULL){
+     error_fatal(filename, NULL);
+   }
+
+   /* generating header */
+   (void)fprintf(OUT, "# sequence:\t%s (%d res.)\n", id, size);
+   (void)fprintf(OUT, "# hydrophobicity values generated: %s", ctime(&timer));
+   (void)fprintf(OUT, "# core window: %d\n", core_win);
+   (void)fprintf(OUT, "# full window: %d\n", full_win);
+   (void)fprintf(OUT, "# using values from file: %s\n", scale);
+   (void)fprintf(OUT, "# Position Hydrophobicity\n");
+
+   for(i = 0 ; i <= size -  full_win; i++) {
+     (void)fprintf(OUT, "%d\t%6.2f\n", i+1, plot[i]);
+   }
+   if(fclose(OUT) == EOF){
+     error_fatal(filename, NULL);
+   }
+
+   free(filename);
+}
+
+
+/* return TRUE if c is one of the 20 amino acid known on IUPAC */
+int is_aa(int aa) {
+    char c;
+    c = (char)aa;
+
+    if ((c >= 'A') && (c <= 'Z'))
+      if (strchr("BJOUXZ", c) == NULL)
+	return TRUE;
+
+    return FALSE;
+}
+
+
+#ifdef HAVE_GNUPLOT
+void gplot (double *plot, segment_t **segments,  seq_t *seq, int nbr,
+	     param_t params) {
+
+  char *id, *plot_format, *plot_outfile, *dir;
+  int size, x_max;
+  FILE  *OUT;
+  double p_cut, c_cut;
+  double y_max, y_min, val;
+  double *p;
+  segment_t *seg;
+  char tempfilename[]=TEMPFILENAME;
+
+  char *gnuplot_command;
+  int j, i, win_len;
+  dir = params.out_dir;
+
+  p_cut = params.p_cut;
+  c_cut = params.c_cut;
+
+  id = seq->id;
+  size = seq->size;
+
+  i = nbr;
+  /* win_len = params.n + (2 * params.q) + 1; */
+  win_len = params.n + (2 * params.q);
+  seg = *segments;
+
+  /* generate tempory file name */
+  if((j = mkstemp(tempfilename)) == -1){
+    error_fatal("generating temporary file", NULL);
+  }
+
+  if ((OUT = fdopen(j, "w")) == NULL) {
+    error_fatal("writing temporary file", NULL);
+  }
+
+  plot_format = params.plot_format;
+  plot_outfile = params.plot_outfile;
+
+  /* getting axis range */
+  y_min = y_max = val = 0;
+  x_max = size - win_len + 1;
+  p = plot;
+  for(i = 0; i < size - win_len - 1; i++, p++) {
+    val = *p;
+    if (y_max < val) y_max = val;
+    if (y_min > val) y_min = val;
+  }
+  y_min = y_min - 0.25;
+  y_max = y_max + 0.5;
+
+  /* writting gnuplot file definition */
+  (void)fprintf(OUT, "set title '%s'\n", id);
+  (void)fprintf(OUT, "set time\n");
+  (void)fprintf(OUT, "set xlabel 'start position of window in sequence'\n");
+  (void)fprintf(OUT, "set ylabel 'hydrophobicity value'\n");
+  (void)fprintf(OUT, "set key right bottom\n");
+  (void)fprintf(OUT, "%s\n", plot_format);
+  if(plot_outfile){
+    (void)fprintf(OUT, "set output \"%s/%s.%s\"\n",dir, id, plot_outfile);
+  }
+  /* setting plot axis */
+  (void)fprintf(OUT, "set xrange [%d:%d]\n", 0, x_max);
+  (void)fprintf(OUT, "set yrange [%.1f:%.1f]\n", y_min, y_max);
+  (void)fprintf(OUT, "set y2range [%.1f:%.1f]\n", y_min - y_max, 0.2);
+
+  /* tagging the tm segments */
+  for(i = 0; i < nbr; i++, seg++) {
+    int x;
+    x = seg->pos;
+    (void)fprintf(OUT, "set arrow from second %d,0 to second %d,-0.2 nohead lw 2\n", x, x);
+  }
+
+  (void)fprintf(OUT, "plot %f title 'Upper cutoff', %f title 'Lower cutoff', '%s/%s.hydro' title 'hydrophobicity' with lines\n", c_cut, p_cut, dir, id);
+  (void)fprintf(OUT, "%s\n", params.plot_pause);
+
+  if(fclose(OUT) == EOF) {
+    error_fatal("gpl file 3", NULL);
+  }
+
+  /* gnuplot command */
+  if((gnuplot_command = (char*)malloc(sizeof(char) *(TEMPFILENAMELEN + 8 +1))) == NULL)
+    error_fatal ("memory", NULL);
+  (void)sprintf(gnuplot_command, "gnuplot %s", tempfilename);
+
+  if(system(gnuplot_command) == -1){
+  	error_fatal("plotting" , NULL);
+  }
+
+    free(gnuplot_command);
+
+    if (unlink(tempfilename) == -1) {
+      error_fatal("gpl file", "deleting");
+    }
+
+}
+#endif /* HAVE_GNUPLOT */
diff --git a/src/profile.h b/src/profile.h
new file mode 100644
index 0000000..5552ba7
--- /dev/null
+++ b/src/profile.h
@@ -0,0 +1,38 @@
+/*   File:                /home/edeveaud/Work/toppred/src/profile.h
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifndef __PROFILE_H_
+#define __PROFILE_H_
+
+#include "params.h"
+#include "seq-reader.h"
+#include "loop.h"
+
+
+
+/* WARNING if changing TEMPFILENAME value, adjust TEMPFILENAMELEN */
+#define TEMPFILENAME "/tmp/top-XXXXXX"
+#define TEMPFILENAMELEN 15
+
+
+
+/* retreive Hphobes datas from file */
+void read_Hphobes_datas (char *file, double *hphobes_datas);
+
+
+/* print hydrophobic values, in a useable manner */
+void plot_values(double *plot, seq_t *seq, param_t params);
+
+/* retrieve the hydropbobic calcul for each positions */
+void calc_profile(seq_t *seq, param_t params, double *res);
+void calc_profile_bug(seq_t *seq_holder, param_t params, double *profile);
+
+#ifdef HAVE_GNUPLOT
+/* display or produce the hydrophobic profile using gnuplot */
+void gplot (double *plot, segment_t **segments, seq_t *seq, int i,
+	    param_t params);
+#endif /* HAVE_GNUPLOT */
+
+#endif
diff --git a/src/seq-reader.c b/src/seq-reader.c
new file mode 100644
index 0000000..8a1fe28
--- /dev/null
+++ b/src/seq-reader.c
@@ -0,0 +1,245 @@
+/*   File:                /home/edeveaud/Work/dnatool/src/readseq.c
+ *   Author:              Eric Deveaud <edeveaud at pasteur.fr>
+ */
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#endif
+
+#include <ctype.h>
+
+#include "seq-reader.h"
+#include "error.h"
+
+
+
+static void process_header(seq_t *seq, char *header) ;
+static int clean_buff(char **buffer, char *alphabet) ;
+
+
+int read_seq (FILE *IN, seq_t *seq_holder, char *alphabet) {
+
+  char *BUFF, *stock, *p, *q;
+  int i, state, l;
+  size_t buffsize, bufflen, seq_len;
+
+  /* check if there is something to read */
+  if ((i = fgetc(IN)) == EOF && feof(IN) != 0) {
+    return NO_SEQ; }
+
+  ungetc(i, IN);
+
+  state = SEQ_NONE;
+  seq_len = bufflen = 0;
+  buffsize = BUFFSIZE;
+  seq_holder->seq = NULL;
+
+  if ((BUFF = (char *) malloc(sizeof(char) * buffsize+1 )) == NULL)
+    error_fatal ("memory1" , NULL);
+  if ((stock = (char *) malloc(sizeof(char) * buffsize+1 )) == NULL)
+    error_fatal ("memory2" , NULL);
+
+  *stock = '\0';
+  q = stock;
+
+  while ((i = fgetc(IN)) != EOF) {
+    /* skip empty lines */
+    if (isspace(i)) {continue;}
+    
+    if ( ungetc(i, IN) == EOF ) error_fatal ("ungetc", NULL);
+
+    /* end entry or start entry */
+    if ( i == '>' ) {
+      if (state == SEQ_NONE )  state = HEADER;
+      if (state == SEQ) break ;
+    }
+
+    if (fgets(BUFF, BUFFSIZE + 1, IN) == NULL)  break;
+
+    /* header processing */
+    if ( state == HEADER ) {
+
+      /* memcopy with '/0' inclusion */
+      memcpy(q, BUFF, BUFFSIZE+1);
+      /* is header line completly read */
+      if (strrchr(BUFF, '\n') == NULL) {
+	if((stock = realloc(stock, buffsize + BUFFSIZE + 1)) == NULL)
+	  error_fatal("realloc", NULL);
+	q = stock + buffsize ;
+	buffsize += BUFFSIZE ;
+	continue;
+      }
+      process_header(seq_holder, stock);
+      state = SEQ;
+      buffsize = BUFFSIZE;
+      p = stock;
+      *p ='\0';
+      continue;
+    }
+
+    if ( state == SEQ || state == DUMP ){
+      /* we clean the buffer before any further use */
+      if ((l = clean_buff(&BUFF,  alphabet)) == -1)
+	error_fatal(seq_holder->id, "sequence contain spurious characters");
+    }
+
+    if (state == SEQ ) {
+      bufflen = l;
+      /* is stock buffer long enough */
+      if ( seq_len + bufflen >= buffsize ) {
+	buffsize += BUFFSIZE;
+	if ((stock = realloc(stock, sizeof(char) * buffsize+1)) == NULL)
+	  error_fatal("Memory3", "Reallocating seq");
+      }
+      q = stock + seq_len;
+      strncpy (q, BUFF, bufflen);
+      seq_len += bufflen;
+    }
+
+    if ( state == SEQ_NONE ) {
+      error_fatal("Sequence", "is NOT fasta formated");
+    }
+  }
+
+
+  free(BUFF);
+  if ( state == SEQ ) {
+    *(stock+seq_len) = '\0';
+    seq_holder->seq = stock;
+  }
+  seq_holder->size = seq_len;
+
+  return state;
+
+}
+
+char *alphabet_maker (char *alphabet) {
+
+  char  *res, *p;
+  int j;
+
+  if ((res = calloc(255, sizeof(char))) == NULL) {
+    error_fatal("memory", NULL);
+  }
+
+  p = alphabet;
+  while(*p) {
+    j = (int)*p;
+    if ( islower(j) ){
+      res[j] = toupper((int)*p);
+      res[j-32] = toupper((int)*p);
+    }
+    else{
+      res[j] = *p;
+      res[j+32] = *p;
+    }
+    p++;
+  }
+
+  return res;
+}
+
+
+static void process_header(seq_t *seq, char *header) {
+  char *id, *comm, *p, *q;
+  int i, n, l;
+
+  n = 0;
+  p = header;
+
+  /* skip > */
+  p++;
+
+  while(*p && isascii((int)*p) && !isspace((int)*p)) {
+    p++; n++;
+  }
+
+  /* check if sequence is named or not */
+  if (n == 1 && strchr( ".,;", (int)header[1])) n = 0;
+  l = ( n == 0) ? 9 : n;
+
+  if((id = malloc(sizeof(char)*(l+1))) == NULL){
+    error_fatal("memory", NULL);
+  }
+  p = header;
+  p++;
+  
+  /* check if sequence is named or not */
+  if ( n == 0 ){
+    error_warn("anonymous sequence",
+	       "name will be forced to \"anonymous\"");
+    snprintf(id,10, "anonymous");
+  }
+  else {
+    q = id;
+    for (i=0; i<n; i++) {
+      /* replace all non alnum character by '_' */
+      if (isalnum((int)*p))  *q++ = *p++;
+      else { *q++ = '_'; p++; }
+    }
+    *q = '\0';
+  }
+
+
+  /* skip spaces */
+  while(*p && (isspace((int)*p))) { p++; n++; }
+
+  /* get comment */
+
+  if((comm = malloc(sizeof(char) * (strlen(header) - n))) == NULL){
+    error_fatal("memory", "COMLEN");
+  }
+  q = comm;
+  while(*p && *p != '\n') { *q++ = *p++; }
+  *q = '\0';
+
+  seq->id = id;
+  seq->comment = comm;
+}
+
+
+
+static signed int clean_buff(char **buffer, char *alphabet) {
+  char *p, *c;
+  int bufflen;
+
+  p = *buffer;
+  c = *buffer;
+  bufflen = 0;
+  while (*p && *p != '\n') {
+    if (isspace ((int)*p)) { p++; continue; }
+    if( alphabet[(int)*p] != '\0') {
+      *c++ = alphabet[(int)*p];
+      p++;
+      bufflen++;
+    }
+    else {
+      if (isalpha((int)*p) || *p == '*') {
+	char err_aa[2];
+	err_aa[0] = *p;
+	err_aa[1] = '\0';
+	error_warn(err_aa, "not a valid aa, skipped");
+	p++;
+      }
+      else {
+	return -1;
+      }
+    }
+  }
+  *c = '\0';
+
+  return bufflen;
+}
+
+void free_seq(seq_t *seq) {
+  free(seq->id);
+  free(seq->comment);
+  if ( seq->seq != NULL ) free(seq->seq);
+}
diff --git a/src/seq-reader.h b/src/seq-reader.h
new file mode 100644
index 0000000..164b148
--- /dev/null
+++ b/src/seq-reader.h
@@ -0,0 +1,45 @@
+/*   File:                /home/edeveaud/Work/dnatool/src/readseq.h
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifndef __SEQ_READER_H_
+#define __SEQ_READER_H_
+
+/* sequence size switch between memory and file processing */
+#define MAX_MEM_SIZE 1000000
+
+/* default allowed characters in sequence */
+#define DEFAULT_ALPHABET "ARNDCQEGHILKMFPSTWYV"
+
+#define BUFFSIZE 100
+#define SEQ_NONE -1
+#define HEADER 0
+#define SEQ 1
+#define DUMP 2
+
+#define NO_SEQ 0
+#define SEQ_OK 1
+#define SEQ_OVERMEM 2
+
+
+
+typedef struct seq_S {
+  char *id;
+  char *comment;
+  char *seq;
+  size_t size;
+} seq_t;
+
+
+
+/* retreive sequence in fasta format from file descriptor */
+int read_seq(FILE *IN, seq_t  *seq_holder, char *alphabet) ;
+
+/* generate alphabet table used to check the sequences */
+char *alphabet_maker (char *alphabet) ;
+
+/* free the sequence holder */
+void free_seq(seq_t *seq) ;
+
+#endif /* __SEQ_READER_ */
diff --git a/src/topology.c b/src/topology.c
new file mode 100644
index 0000000..79205b2
--- /dev/null
+++ b/src/topology.c
@@ -0,0 +1,181 @@
+/* -----------------------------------------------------------------
+ file      : /home/schuerer/toppred_com/src/top_topology.c
+ author    : Schuerer
+ description :
+
+
+-------------------------------------------------------------------- */
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#endif
+
+#ifdef HAVE_LIBM
+#include <math.h>
+#endif
+
+#include "error.h"
+
+#include "topology.h"
+
+#include "charge.h"
+
+
+/* calculation of the total kr bias or each possible topology
+   stockage of the para->tmax best topologies */
+int tp_calc (topo_t *topos, elem_t *elems, seq_t *seq_h, param_t *para) {
+
+  int tmax = para->n_topos;
+  int cllen = para->seg_len;
+
+  int nsegments = elems->nsegs;
+  seg_t *segments = elems->segs;
+  loop_t *loops = elems->loops;
+  int ntopos = (int) pow(2.0, (double) elems->nputatives);
+
+  int i, k, n, saved;
+  int kr, kr_l, start_l, side, first_tm;
+  double probtm;
+  int putatives, integrate, kingdom;
+  char * seq;
+
+  seq = seq_h->seq;
+
+  kingdom = para->kingdom;
+
+  saved = 0; k = 0;
+  for (n=0; n < ntopos; n++) {
+    putatives = n; side = 1;
+    /* init kr with 1 if N-terminal met is cleaved elsewhere 0 */
+    kr = 0;
+    kr_l = 0; start_l = 0;
+    probtm = 1.0;
+    first_tm = 1;
+    for (i=0; i < nsegments; i++) {
+
+      /* segmentment integrated ? */
+      if (segments[i].kind == PUTATIVE) {
+	integrate = putatives % 2;
+	putatives /= 2;
+      }
+      else integrate = 1;
+
+      /* calculation of global transmembrane probability */
+      if (integrate) probtm *= segments[i].probTM;
+
+      /* calculation of total kr bias */
+      if (loops[i].start != -1) kr_l += loops[i].delta;
+      if(integrate) {
+	if (loops[i].start != -1 && loops[i].stop - start_l <= cllen) {
+	  kr += kr_l * side;
+	  if (first_tm) kr += ncharge(seq, kingdom);
+	}
+
+	side *= (-1);
+	kr_l = 0;
+	start_l = segments[i].stop;
+	first_tm = 0;
+      }
+      else kr_l += segments[i].delta;
+
+    } /* end for to calculate total kr bias */
+    if (loops[nsegments].start == -1 &&
+	segments[nsegments-1].stop - start_l <= cllen )
+      kr += kr_l * side;
+    else if (loops[nsegments].stop - start_l <= cllen)
+      kr += (kr_l + loops[nsegments].delta) * side;
+
+    /* if there is at least one segment save the topology */
+    if (!first_tm) {
+      /* find topology with minimum kr bias to replace */
+      if (saved >= tmax) {
+	k = 0;
+	for (i=1; i<tmax; i++)
+	  if (abs(topos[i].kr) < abs(topos[k].kr)) k = i;
+      }
+      else { k = saved; saved++;}
+      /* init topology object */
+      topos[k].putatives = n;
+      topos[k].kr    = kr;
+      topos[k].prob  = probtm;
+    }
+  }
+
+  return saved;
+}
+
+/* sort topologies in increasing order */
+int tp_compare (const void *first, const void *second) {
+  const topo_t *topof = (const topo_t *) first;
+  const topo_t *topos = (const topo_t *) second;
+
+  int res = abs(topos->kr) - abs(topof->kr);
+
+  if (res) { return (abs(topos->kr) - abs(topof->kr)); }
+  if (topof->prob > topos->prob) return -1;
+  return 1;
+}
+
+
+/* extract loops and segments as 2 distinct structures */
+/*
+void KS_wrap (KSsegment_t *segs, KSloop_t *loops,
+ 	      boucle_t *boucle, int n) {
+   int i, s, l;
+   boucle_t *p;
+
+   KSseg_t seg;
+   KSloop_t loop;
+
+   i = s = l = 0;
+   seg = NULL;
+   loop = NULL;
+
+   P = boucle;
+    getting the sizes for both struct to create
+   for(i = 0; i< n; i++) {
+     if(p[i].kind == PUTATIVE || p[i].kind == CERTAIN) {
+       s++;
+     }
+     else {
+       l++;
+     }
+   }
+
+    allocate both structures
+   if ((seg = (KSseg_t)malloc(sizeof(KSseg_t) *s)) == NULL) {
+     error_fatal("memory", NULL);
+   }
+   if ((loop = (KSloop_t)malloc(sizeof(KSloop_t) *s)) == NULL) {
+     error_fatal("memory", NULL);
+   }
+   s = l = 0;
+   for(i = 0; i < n; i++) {
+     if(p[i].kind == LOOP) {
+       loop[l].start = p[i].start;
+       loop[l].stop = p[i].stop;
+       loop[l].charge = p[i].delta;
+       l++;
+     }  end if LOOP
+
+     else {  it's a segment...
+       seg[s].start = p[i].start;
+       seg[s].stop = p[i].stop;
+       seg[s].kind = p[i].kind;
+       seg[s].hpval = p[i].H;
+       seg[s].charge = p[i].delta;
+     }
+
+   }  end for
+
+   segs = seg;
+   loops =loop;
+
+}
+*/
diff --git a/src/topology.h b/src/topology.h
new file mode 100644
index 0000000..860147b
--- /dev/null
+++ b/src/topology.h
@@ -0,0 +1,41 @@
+/*   File:                /home/edeveaud/Work/toppred/src/topology.h
+ *   Author:              Katja Schuerer
+ */
+
+#ifndef __TOP_TOPOLOGY_
+#define __TOP_TOPOLOGY_
+
+
+#include "params.h"
+#include "loop.h"
+
+
+typedef struct topo {
+  int putatives; /* je sais pas  */
+  int kr; /* total Arg + Lys bias */
+  double prob; /* global transmembrane probability */
+  int cytext; /* total cyt - ext difference */
+} topo_t;
+
+typedef struct elem {
+  int nputatives; /* number of putative segments */
+  int nsegs;      /* number of all segements */
+
+  seg_t *segs; /* segment structures */
+  loop_t *loops;  /* loop structures */
+} elem_t;
+
+#define CYTOPLASMIC 1
+#define PERIPLASMIC -1
+#define INDETERMINED 0
+#define MAXPUTATIVES_CALC 10
+
+int tp_calc (topo_t *topos, elem_t *elems, seq_t *seq, param_t *para);
+int tp_compare (const void *first, const void *second);
+
+#endif
+
+
+
+
+
diff --git a/src/topoprint.c b/src/topoprint.c
new file mode 100644
index 0000000..7d2677a
--- /dev/null
+++ b/src/topoprint.c
@@ -0,0 +1,296 @@
+/* -----------------------------------------------------------------
+ file      : /home/schuerer/toppred/src/topoprint.c
+
+ author    : Schuerer
+ description :
+
+
+-------------------------------------------------------------------- */
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#include <stdio.h>
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#endif
+
+#include "topoprint.h"
+#include "loop.h"
+
+
+/* init topology_t object with topo_t informations */
+
+/* transforme topologie as topo_t object to topology_t with
+   informations of all elements  */
+int tp_decode (topoprint_t *topo, elem_t *elems, seq_t *sq, param_t *para)
+{
+  int putatives = topo->putatives;
+  seg_t *segments = elems->segs;
+  int nsegments = elems->nsegs;
+
+  scale_t *scales = &(para->scales);
+  int clen = para->seg_len;
+
+  char *seq = sq->seq;
+  size_t len;
+
+  int krstart, krstop;
+  double pos , neg;
+  int type_loop, triangle, last_stop, first;
+  int integrate, k, i, nel, side, kingdom;
+
+  elprint_t *el = topo->elps;
+  loprint_t *lo;
+  tmprint_t *tm;
+
+  len = strlen(seq);
+
+  triangle = para->q;
+  type_loop = (topo->kr > 0) ? 1 : (topo->kr < 0) ? -1 : 0;
+  last_stop = 0;
+  k=0;
+  kingdom = para->kingdom;
+  for(i=0; i<nsegments; i++) {
+
+    /* segment integrated ? */
+    integrate = 1;
+    if (segments[i].kind == PUTATIVE)
+      { integrate = putatives % 2 ; putatives /= 2; }
+
+    /* */
+    if (integrate)
+      {
+	/* loop */
+	lo = &(el[k].lo);
+	lo->type = (type_loop == 1) ? "CYT_LOOP" : (type_loop == -1) ? "EXT_LOOP" : "LOOP";
+	lo->start = last_stop;
+	lo->stop = segments[i].start;
+	krstart = (lo->start - triangle < 0) ? 0 :  lo->start - triangle;
+	krstop =  (lo->stop + triangle > len) ? len : lo->stop + triangle;
+	lo->len = lo->stop - lo->start;
+	if (lo->len != 0) {
+	  lo->kr = countkr (seq, krstart, krstop);
+	  lo->cytext = distance (seq, lo->start, lo->stop, scales);
+	}
+	else { lo->kr =0; lo->cytext = 0.0; }
+
+	/* segment */
+	k++;
+	tm = &(el[k].tm);
+	tm->type = "TRANSMEM";
+	tm->nr = i+1;
+	tm->start = segments[i].start;
+	tm->stop = segments[i].stop;
+	tm->len = tm->stop - tm->start;
+	tm->prob = segments[i].probTM;
+	/* tm->type_seg = (segments[i].kind == CERTAIN) ? "certain" : "putative"; */
+	tm->H = segments[i].H;
+
+	/* init next loop and segment */
+	k++;
+	type_loop *= -1;
+	last_stop = tm->stop;
+      } /* end if */
+  } /* end for */
+
+  /* last loop */
+  lo = &(el[k].lo);
+  lo->type = (type_loop == 1) ? "CYT_LOOP" : (type_loop == -1) ? "EXT_LOOP" : "LOOP";
+  lo->start = last_stop;
+  lo->stop = len;
+  krstart = (lo->start - triangle < 0) ? 0 :  lo->start - triangle;
+  krstop =  (lo->stop + triangle > len) ? len : lo->stop + triangle;
+  lo->len = lo->stop - lo->start;
+  if (lo->len != 0) {
+    lo->kr = countkr (seq, krstart, krstop);
+    lo->cytext = distance (seq, lo->start, lo->stop, scales);
+  }
+  else { lo->kr =0; lo->cytext = 0.0; }
+
+  /* topology summary */
+  nel = k+1; side = 1;
+  topo->prob = 1.0;
+  topo->cytext = 0.0;
+  for (i=0; i<nel; i++) {
+    if (i%2) {/* tm segment (index impair) */
+      topo->prob = (el[i].tm.prob < topo->prob) ? el[i].tm.prob : topo->prob;
+      side *= -1;
+    }
+    else { /* loop (index pair) */
+      if (el[i].lo.len > clen) topo->cytext += el[i].lo.cytext * (double) side;
+    }
+  }
+
+  first = el[1].tm.nr - 1;
+  topo->nterm = nterminus(seq, segments[first].start, segments[first].stop, para->q);
+
+  topo->ncharge = (el[0].lo.start != -1 && el[0].lo.len <= clen) ?
+    ncharge(seq, kingdom) : 0;
+  topo->pos = pos = el[0].lo.kr;
+  topo->neg = neg = countneg(seq, el[0].lo.start, el[0].lo.stop);
+  if (neg+pos == 0) topo->negpos = 0.0;
+  else topo->negpos = ((double) (neg - pos))/((double) (neg+pos));
+
+  return nel;
+}
+
+
+void tp_new_print (topoprint_t *topo, int nel, param_t *para) {
+
+  FILE *OUT = para->OUT;
+  int clen = para->seg_len;
+  elprint_t *el = topo->elps;
+  int i;
+
+  /* header */
+  (void) fprintf (OUT, "%8s %6s %6s %6s %4s %4s %8s %8s %8s %8s\n",
+		  "HEADER  ", "START", "STOP", "LEN",
+		  "PROB", "HP",
+		  "DARGLYS", "DCYTEXT",  "DNCHARGE", "DNNEGPOS");
+
+
+  /* topo summary */
+  if (para->web == 1)
+    {
+    (void) fprintf (OUT, "%8s <A HREF=\"./%s-%d.png\">%3d</A>                  %3.2f       %6.2f   %6.2f  %8.2f %8.2f\n",
+		  "TOPOLOGY", topo->image, topo->nr, topo->nr, topo->prob,
+		    (double) topo->kr,
+		    topo->cytext, (double) topo->nterm, topo->negpos);
+  }
+  else {
+    (void) fprintf (OUT, "%8s %3d                  %3.2f       %6.2f   %6.2f  %8.2f %8.2f\n",
+		  "TOPOLOGY", topo->nr, topo->prob,
+		  (double) topo->kr,
+		  topo->cytext, (double) topo->nterm, topo->negpos);
+  }
+  (void) fprintf (OUT, "%8s                                %7s  %7s  %8s\n",
+		  "TOPOLOGY",
+  		  new_orientation((double) (topo->kr+topo->ncharge)),
+  		  new_orientation(topo->cytext * (-1.0)),
+		  new_orientation((double) topo->nterm));
+
+  /* topo elements */
+  for (i=0; i<nel; i++) {
+      if (i%2) { /* tmsegment (index impair) */
+	(void) fprintf(OUT, "%8s %6d %6d %6d %4.2f %4.2f\n",
+		       el[i].tm.type, el[i].tm.start+1, el[i].tm.stop,
+		       el[i].tm.len, el[i].tm.prob, el[i].tm.H);
+      }
+      else { /* loop (index pair) */
+	if (el[i].lo.len > clen) { /* cytext value is significant */
+	  (void) fprintf(OUT, "%8s %6d %6d %6d           (%6.2f)  %6.2f\n",
+			 el[i].lo.type, el[i].lo.start+1, el[i].lo.stop,
+			 el[i].lo.len, (double) el[i].lo.kr, el[i].lo.cytext);
+	}
+	else if (el[i].lo.len != 0) { /* kr value is significant */
+	  (void) fprintf(OUT, "%8s %6d %6d %6d            %6.2f  (%6.2f)\n",
+			 el[i].lo.type, el[i].lo.start+1, el[i].lo.stop,
+			 el[i].lo.len, (double) el[i].lo.kr, el[i].lo.cytext);
+	}
+      }
+  }
+
+  /* end topology */
+  (void) fprintf(OUT, "//\n");
+
+  return;
+}
+
+
+void tp_toppred_fprintf (topoprint_t *topo, int nel, param_t *para) {
+
+  FILE *OUT = para->OUT;
+  int clen = para->seg_len;
+  elprint_t *el = topo->elps;
+  int i;
+
+  (void) fprintf(OUT, "Structure %d\n\n", topo->nr);
+
+  /* element information of the structure */
+  (void) fprintf(OUT, "Transmembrane segments included in this structure:\n");
+
+  /* number of included segments */
+  (void) fprintf(OUT, "     Segment  ");
+  for (i=0; i<nel; i++) {
+    if (i%2) { /* tmsegment (index impair) */
+      (void) fprintf(OUT, "%6d", el[i].tm.nr);
+    }
+  }
+  (void) fprintf(OUT, "\n");
+
+  /* loop length */
+  (void) fprintf(OUT, " Loop length");
+  for(i=0; i<nel; i++) {
+     if (!(i%2)) { /* loop (index pair) */
+       (void) fprintf(OUT, "%6d", el[i].lo.len);
+     }
+  }
+  (void) fprintf(OUT, "\n");
+
+  /* k+r profile */
+  (void) fprintf(OUT, " K+R profile");
+
+  for(i=0; i<nel; i++) {
+    if ((i%4) == 0) { /* loop (index pair) */
+      if (el[i].lo.len <= clen) { (void) fprintf(OUT, "%6.2f", (!i) ?  (double) (el[i].lo.kr+topo->ncharge) : (double) el[i].lo.kr); }
+      else { (void) fprintf(OUT, "%6s", "+"); }
+    }
+    if ((i%4) == 2) { (void) fprintf(OUT, "      "); }
+  }
+  (void) fprintf(OUT, "\n");
+
+  (void) fprintf(OUT, "            ");
+  for(i=0; i<nel; i++) {
+    if ((i%4) == 0) { (void) fprintf(OUT, "      "); }
+    else if ((i%4) == 2) {
+      if (el[i].lo.len <= clen) { (void) fprintf(OUT, "%6.2f", (double) el[i].lo.kr); }
+      else { (void) fprintf(OUT, "%6s", "+"); }
+    }
+  }
+  (void) fprintf(OUT, "\n");
+
+  /* cyt-ext profile */
+  (void) fprintf(OUT, "CYT-EXT prof");
+
+  for(i=0; i<nel; i++) {
+    if ((i%4) == 0) { /* loop (index pair) */
+      if (el[i].lo.len > clen) { (void) fprintf(OUT, "%6.2f", el[i].lo.cytext); }
+      else { (void) fprintf(OUT, "%6s", "-"); }
+    }
+    if ((i%4) == 2) { (void) fprintf(OUT, "      "); }
+  }
+  (void) fprintf(OUT, "\n");
+
+  (void) fprintf(OUT, "            ");
+  for(i=0; i<nel; i++) {
+    if ((i%4) == 0) { (void) fprintf(OUT, "      "); }
+    else if ((i%4) == 2) {
+      if (el[i].lo.len > clen) { (void) fprintf(OUT, "%6.2f", el[i].lo.cytext); }
+      else { (void) fprintf(OUT, "%6s", "-"); }
+    }
+  }
+  (void) fprintf(OUT, "\n");
+
+  (void) fprintf(OUT, "For CYT-EXT profile neg. values indicate cytoplasmic preference.\n\n");
+
+  /* topology summary */
+
+  (void) fprintf(OUT, "\nK+R difference: %.2f\n", (double) (topo->kr));
+  (void) fprintf(OUT, "Tm probability: %.2f\n", topo->prob);
+  (void) fprintf(OUT, "-> Orientation: %s\n", orientation((double) (topo->kr)));
+  (void) fprintf(OUT, "\nCharge-difference over N-terminal Tm (+-15 residues): %.2f\n", (double) topo->nterm);
+  (void) fprintf (OUT, "%20s: %.4f\n", "(NEG-POS)/(NEG+POS)", topo->negpos);
+
+  (void) fprintf (OUT, "%20s: %.4f\n", "NEG", (double) topo->neg);
+  (void) fprintf (OUT, "%20s: %.4f\n", "POS", (double) topo->pos);
+
+  (void) fprintf(OUT, "-> Orientation: %s\n", orientation((double)topo->nterm));
+  (void) fprintf(OUT, "\nCYT-EXT difference: %6.2f\n", topo->cytext);
+  (void) fprintf(OUT, "-> Orientation: %s\n", orientation(topo->cytext * (-1.0)));
+
+  return;
+}
diff --git a/src/topoprint.h b/src/topoprint.h
new file mode 100644
index 0000000..c79b484
--- /dev/null
+++ b/src/topoprint.h
@@ -0,0 +1,68 @@
+/*   File:                /home/edeveaud/Work/toppred/src/topoprint.h
+ *   Author:              Katja Schuerer
+ */
+
+#ifndef __TOP_TOPOPRINT_
+#define __TOP_TOPOPRINT_
+
+#include "params.h"
+
+#include "topology.h"
+
+/* types for full length topology  printing */
+
+typedef struct tmprint
+{
+  int nr;
+  int start;
+  int stop;
+  int len;
+  double prob;
+  double H;
+  char *type;
+} tmprint_t;
+
+typedef struct loprint
+{
+  int start;
+  int stop;
+  int len;
+  int kr;
+  double cytext;
+  char *type;
+} loprint_t;
+
+typedef union elprint
+{
+  loprint_t lo;
+  tmprint_t tm;
+} elprint_t;
+
+typedef struct topoprint
+{
+  double prob;
+  double cytext;
+  int pos;
+  int neg;
+  double negpos;
+  int nr;
+  int putatives;
+  int kr;
+  int nterm;
+  elprint_t *elps;
+  char *image;
+  int ncharge;
+} topoprint_t;
+
+/* transforme topologie as topo_t object to topology_t with
+   informatigons of all elements  */
+int tp_decode (topoprint_t *topo, elem_t *elems, seq_t *sq, param_t *para);
+
+void tp_toppred_fprintf (topoprint_t *topo, int nel, param_t *para);
+
+/* print topology information in new output format */
+void tp_new_print (topoprint_t *topo, int nel, param_t *para);
+
+#endif
+
+
diff --git a/src/usage.c b/src/usage.c
new file mode 100644
index 0000000..b2acb9f
--- /dev/null
+++ b/src/usage.c
@@ -0,0 +1,116 @@
+/*   File:                /home/edeveaud/Work/toppred/src/usage.c
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifdef HAVE_CONFIG_H
+#include <config.h>
+#endif
+
+#ifdef STDC_HEADERS
+#include <stdlib.h>
+#include <string.h>
+#endif
+
+#include <stdio.h>
+
+#include "usage.h"
+#include "error.h"
+
+
+void usage(char *prog) {
+  FILE *PERR = stderr;
+  (void)fprintf(PERR, "usage: %s [options] <file>\n", prog);
+
+  (void)fprintf(PERR, "  -c <val>    ... Use <val> as certain cut-off.\n");
+
+  (void)fprintf(PERR, "  -d <val>    ... Use <val> as critical distance between 2 transmembrane\n");
+  (void)fprintf(PERR, "                  segments.\n");
+
+  (void)fprintf(PERR, "  -e          ... For use with Eucaryotes.\n");
+
+#ifdef HAVE_GNUPLOT
+  (void)fprintf(PERR, "  -g <format> ... Display or produce Hydropphobic profile, in the specified\n");
+  (void)fprintf(PERR, "                  <format> (ps, png, ppm, x11 and none).\n");
+#endif /* HAVE_GNUPLOT */
+
+  (void)fprintf(PERR, "  -h          ... Print this message and exit.\n");
+
+  (void)fprintf(PERR, "  -H <file>   ... Use Hydrophobycitie values from <file>.\n");
+
+  (void)fprintf(PERR, "  -n <val>    ... Use <val> as core window length.\n");
+
+  (void)fprintf(PERR, "  -o <file>   ... Place the output into <file>.\n");
+
+  (void)fprintf(PERR, "  -O <format> ... Print output in the specified\n");
+  (void)fprintf(PERR, "                  <format> (old, new (default), html).\n");
+  (void)fprintf(PERR, "  -p <val>    ... Use <val> as putative cut-off.\n");
+
+  (void)fprintf(PERR, "  -q <val>    ... Use <val> as wedge window length.\n");
+
+  (void)fprintf(PERR, "  -s <val>    ... Use <val> as critical loop length.\n");
+
+#ifdef HAVE_LIBGD
+  (void)fprintf(PERR, "  -t <format> ... Produce images of the topologies in the specified\n");
+  (void)fprintf(PERR, "                  <format> (png and none).\n");
+#endif
+
+  (void)fprintf(PERR, "  -v          ... Print version number and exit.\n");
+}
+
+int check_output_format(char *prog, char *format) {
+
+  if (strcmp (format, "html") == 0) { return HTML; }
+  if (strcmp (format, "old") == 0) { return OLD; }
+  if (strcmp (format, "new") == 0) { return NEW; }
+
+  error_fatal(prog, "supported format are currently new, old and html");
+
+  return 1;
+}
+
+
+void check_plot_format(char *prog, param_t *params) {
+  char *format;
+  format = params->plot_format;
+
+  if(strcmp (format, PS) == 0) {
+    params->plot_format = "set term postscript color solid\n";
+    params->plot_outfile = "ps";
+    return;
+  }
+  else if (strcmp (format, PNG) == 0) {
+    params->plot_format= "set term png medium";
+    params->plot_outfile = "png";
+    return;
+  }
+  else if(strcmp (format, NONE) == 0) {
+    params->gplot = FALSE;
+    params->plot_format = NULL;
+    return;
+  }
+  else 	if(strcmp (format, X11) == 0) {
+    params->plot_format = "" ;
+    params->plot_outfile = NULL;
+    params->plot_pause = "pause -1";
+    return;
+  }
+  else if(strcmp (format, PPM) == 0) {
+    params->plot_format = "set term pbm medium color";
+    params->plot_outfile = "ppm";
+    return;
+  }
+  else{error_fatal(prog,
+		   "supported format are currently ps, png, ppm, x11 and none");
+  }
+}
+
+void check_topo_format(char *prog, param_t *params) {
+  char *format;
+  format = params->topo_format;
+
+  if((strcmp (format, PNG) != 0) && (strcmp (format, NONE) !=0 ))  {
+    error_fatal(prog,
+		"supported format are currently png and none");
+  }
+}
diff --git a/src/usage.h b/src/usage.h
new file mode 100644
index 0000000..dea9d99
--- /dev/null
+++ b/src/usage.h
@@ -0,0 +1,30 @@
+/*   File:                /home/edeveaud/Work/toppred/src/usage.h
+ *   Author:              Eric Deveaud edeveaud at pasteur.fr
+ */
+
+
+#ifndef __USAGE_H_
+#define __USAGE_H_
+
+#include "params.h"
+
+#define PS "ps"
+#define PNG "png"
+#define PPM "ppm"
+#define NONE "none"
+#define X11 "x11"
+
+/* output format */
+#define NEW 1
+#define OLD 2
+#define HTML 3
+
+/* usage display */
+void usage(char *prog);
+
+/* check plot format */
+int check_output_format(char *prog, char *format);
+void check_plot_format(char *prog, param_t *params);
+void check_topo_format(char *prog, param_t *params);
+
+#endif
diff --git a/test/Makefile.am b/test/Makefile.am
new file mode 100644
index 0000000..74b1576
--- /dev/null
+++ b/test/Makefile.am
@@ -0,0 +1,26 @@
+TESTS = toppred.test hydro.test \
+        detect_segments.test seqlen.test construct_topos.test \
+	naming.test math.test
+#	float.test naming.test
+
+SEQS = seq-test \
+       first_seg.fasta last_seg.fasta no_seg.fasta \
+       min_seqlen.fasta \
+       too_many_put.fasta more_calc.fasta only_put.fasta \
+       seq_anonymous.fasta seq_zero_div.fasta
+#       seq_float.fasta seq_float2.fasta seq_float3.fasta
+
+
+OUT =  first_seg.out last_seg.out no_seg.out \
+       min_seqlen.out \
+       too_many_put.out more_calc.out only_put.out
+
+ERR =  first_seg.err last_seg.err no_seg.err \
+       min_seqlen.err seq_anonymous.err \
+       too_many_put.err more_calc.err only_put.err \
+       no_error.err
+       
+
+EXTRA_DIST = $(TESTS) $(SEQS) $(OUT) $(ERR)
+
+CLEANFILES = *.hydro *_tmp.out *_tmp.err *.png
diff --git a/test/Makefile.in b/test/Makefile.in
new file mode 100644
index 0000000..46a44f6
--- /dev/null
+++ b/test/Makefile.in
@@ -0,0 +1,385 @@
+# Makefile.in generated by automake 1.9.2 from Makefile.am.
+# @configure_input@
+
+# Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002,
+# 2003, 2004  Free Software Foundation, Inc.
+# This Makefile.in is free software; the Free Software Foundation
+# gives unlimited permission to copy and/or distribute it,
+# with or without modifications, as long as this notice is preserved.
+
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY, to the extent permitted by law; without
+# even the implied warranty of MERCHANTABILITY or FITNESS FOR A
+# PARTICULAR PURPOSE.
+
+ at SET_MAKE@
+srcdir = @srcdir@
+top_srcdir = @top_srcdir@
+VPATH = @srcdir@
+pkgdatadir = $(datadir)/@PACKAGE@
+pkglibdir = $(libdir)/@PACKAGE@
+pkgincludedir = $(includedir)/@PACKAGE@
+top_builddir = ..
+am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd
+INSTALL = @INSTALL@
+install_sh_DATA = $(install_sh) -c -m 644
+install_sh_PROGRAM = $(install_sh) -c
+install_sh_SCRIPT = $(install_sh) -c
+INSTALL_HEADER = $(INSTALL_DATA)
+transform = $(program_transform_name)
+NORMAL_INSTALL = :
+PRE_INSTALL = :
+POST_INSTALL = :
+NORMAL_UNINSTALL = :
+PRE_UNINSTALL = :
+POST_UNINSTALL = :
+build_triplet = @build@
+host_triplet = @host@
+subdir = test
+DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in
+ACLOCAL_M4 = $(top_srcdir)/aclocal.m4
+am__aclocal_m4_deps = $(top_srcdir)/m4/aclibgd.m4 \
+	$(top_srcdir)/configure.in
+am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \
+	$(ACLOCAL_M4)
+mkinstalldirs = $(SHELL) $(top_srcdir)/mkinstalldirs
+CONFIG_HEADER = $(top_builddir)/src/config.h
+CONFIG_CLEAN_FILES =
+SOURCES =
+DIST_SOURCES =
+DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST)
+ACLOCAL = @ACLOCAL@
+AMDEP_FALSE = @AMDEP_FALSE@
+AMDEP_TRUE = @AMDEP_TRUE@
+AMTAR = @AMTAR@
+AUTOCONF = @AUTOCONF@
+AUTOHEADER = @AUTOHEADER@
+AUTOMAKE = @AUTOMAKE@
+AWK = @AWK@
+CC = @CC@
+CCDEPMODE = @CCDEPMODE@
+CFLAGS = @CFLAGS@
+CPP = @CPP@
+CPPFLAGS = @CPPFLAGS@
+CYGPATH_W = @CYGPATH_W@
+DEFS = @DEFS@
+DEPDIR = @DEPDIR@
+ECHO_C = @ECHO_C@
+ECHO_N = @ECHO_N@
+ECHO_T = @ECHO_T@
+EGREP = @EGREP@
+EXEEXT = @EXEEXT@
+GNUPLOT = @GNUPLOT@
+INSTALL_DATA = @INSTALL_DATA@
+INSTALL_PROGRAM = @INSTALL_PROGRAM@
+INSTALL_SCRIPT = @INSTALL_SCRIPT@
+INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@
+LDFLAGS = @LDFLAGS@
+LIBOBJS = @LIBOBJS@
+LIBS = @LIBS@
+LTLIBOBJS = @LTLIBOBJS@
+MAKEINFO = @MAKEINFO@
+OBJEXT = @OBJEXT@
+OS_CPPFLAGS = @OS_CPPFLAGS@
+PACKAGE = @PACKAGE@
+PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@
+PACKAGE_NAME = @PACKAGE_NAME@
+PACKAGE_STRING = @PACKAGE_STRING@
+PACKAGE_TARNAME = @PACKAGE_TARNAME@
+PACKAGE_VERSION = @PACKAGE_VERSION@
+PATH_SEPARATOR = @PATH_SEPARATOR@
+POD2MAN = @POD2MAN@
+SET_MAKE = @SET_MAKE@
+SHELL = @SHELL@
+STRIP = @STRIP@
+USE_GD_LIB_SRC_FALSE = @USE_GD_LIB_SRC_FALSE@
+USE_GD_LIB_SRC_TRUE = @USE_GD_LIB_SRC_TRUE@
+VERSION = @VERSION@
+ac_ct_CC = @ac_ct_CC@
+ac_ct_STRIP = @ac_ct_STRIP@
+am__fastdepCC_FALSE = @am__fastdepCC_FALSE@
+am__fastdepCC_TRUE = @am__fastdepCC_TRUE@
+am__include = @am__include@
+am__leading_dot = @am__leading_dot@
+am__quote = @am__quote@
+am__tar = @am__tar@
+am__untar = @am__untar@
+bindir = @bindir@
+build = @build@
+build_alias = @build_alias@
+build_cpu = @build_cpu@
+build_os = @build_os@
+build_vendor = @build_vendor@
+datadir = @datadir@
+exec_prefix = @exec_prefix@
+host = @host@
+host_alias = @host_alias@
+host_cpu = @host_cpu@
+host_os = @host_os@
+host_vendor = @host_vendor@
+includedir = @includedir@
+infodir = @infodir@
+install_sh = @install_sh@
+libdir = @libdir@
+libexecdir = @libexecdir@
+localstatedir = @localstatedir@
+mandir = @mandir@
+mkdir_p = @mkdir_p@
+oldincludedir = @oldincludedir@
+prefix = @prefix@
+program_transform_name = @program_transform_name@
+sbindir = @sbindir@
+sharedstatedir = @sharedstatedir@
+sysconfdir = @sysconfdir@
+target_alias = @target_alias@
+TESTS = toppred.test hydro.test \
+        detect_segments.test seqlen.test construct_topos.test \
+	naming.test math.test
+
+#	float.test naming.test
+SEQS = seq-test \
+       first_seg.fasta last_seg.fasta no_seg.fasta \
+       min_seqlen.fasta \
+       too_many_put.fasta more_calc.fasta only_put.fasta \
+       seq_anonymous.fasta seq_zero_div.fasta
+
+#       seq_float.fasta seq_float2.fasta seq_float3.fasta
+OUT = first_seg.out last_seg.out no_seg.out \
+       min_seqlen.out \
+       too_many_put.out more_calc.out only_put.out
+
+ERR = first_seg.err last_seg.err no_seg.err \
+       min_seqlen.err seq_anonymous.err \
+       too_many_put.err more_calc.err only_put.err \
+       no_error.err
+
+EXTRA_DIST = $(TESTS) $(SEQS) $(OUT) $(ERR)
+CLEANFILES = *.hydro *_tmp.out *_tmp.err *.png
+all: all-am
+
+.SUFFIXES:
+$(srcdir)/Makefile.in:  $(srcdir)/Makefile.am  $(am__configure_deps)
+	@for dep in $?; do \
+	  case '$(am__configure_deps)' in \
+	    *$$dep*) \
+	      cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh \
+		&& exit 0; \
+	      exit 1;; \
+	  esac; \
+	done; \
+	echo ' cd $(top_srcdir) && $(AUTOMAKE) --gnu  test/Makefile'; \
+	cd $(top_srcdir) && \
+	  $(AUTOMAKE) --gnu  test/Makefile
+.PRECIOUS: Makefile
+Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status
+	@case '$?' in \
+	  *config.status*) \
+	    cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \
+	  *) \
+	    echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \
+	    cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \
+	esac;
+
+$(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+
+$(top_srcdir)/configure:  $(am__configure_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+$(ACLOCAL_M4):  $(am__aclocal_m4_deps)
+	cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh
+uninstall-info-am:
+tags: TAGS
+TAGS:
+
+ctags: CTAGS
+CTAGS:
+
+
+check-TESTS: $(TESTS)
+	@failed=0; all=0; xfail=0; xpass=0; skip=0; \
+	srcdir=$(srcdir); export srcdir; \
+	list='$(TESTS)'; \
+	if test -n "$$list"; then \
+	  for tst in $$list; do \
+	    if test -f ./$$tst; then dir=./; \
+	    elif test -f $$tst; then dir=; \
+	    else dir="$(srcdir)/"; fi; \
+	    if $(TESTS_ENVIRONMENT) $${dir}$$tst; then \
+	      all=`expr $$all + 1`; \
+	      case " $(XFAIL_TESTS) " in \
+	      *" $$tst "*) \
+		xpass=`expr $$xpass + 1`; \
+		failed=`expr $$failed + 1`; \
+		echo "XPASS: $$tst"; \
+	      ;; \
+	      *) \
+		echo "PASS: $$tst"; \
+	      ;; \
+	      esac; \
+	    elif test $$? -ne 77; then \
+	      all=`expr $$all + 1`; \
+	      case " $(XFAIL_TESTS) " in \
+	      *" $$tst "*) \
+		xfail=`expr $$xfail + 1`; \
+		echo "XFAIL: $$tst"; \
+	      ;; \
+	      *) \
+		failed=`expr $$failed + 1`; \
+		echo "FAIL: $$tst"; \
+	      ;; \
+	      esac; \
+	    else \
+	      skip=`expr $$skip + 1`; \
+	      echo "SKIP: $$tst"; \
+	    fi; \
+	  done; \
+	  if test "$$failed" -eq 0; then \
+	    if test "$$xfail" -eq 0; then \
+	      banner="All $$all tests passed"; \
+	    else \
+	      banner="All $$all tests behaved as expected ($$xfail expected failures)"; \
+	    fi; \
+	  else \
+	    if test "$$xpass" -eq 0; then \
+	      banner="$$failed of $$all tests failed"; \
+	    else \
+	      banner="$$failed of $$all tests did not behave as expected ($$xpass unexpected passes)"; \
+	    fi; \
+	  fi; \
+	  dashes="$$banner"; \
+	  skipped=""; \
+	  if test "$$skip" -ne 0; then \
+	    skipped="($$skip tests were not run)"; \
+	    test `echo "$$skipped" | wc -c` -le `echo "$$banner" | wc -c` || \
+	      dashes="$$skipped"; \
+	  fi; \
+	  report=""; \
+	  if test "$$failed" -ne 0 && test -n "$(PACKAGE_BUGREPORT)"; then \
+	    report="Please report to $(PACKAGE_BUGREPORT)"; \
+	    test `echo "$$report" | wc -c` -le `echo "$$banner" | wc -c` || \
+	      dashes="$$report"; \
+	  fi; \
+	  dashes=`echo "$$dashes" | sed s/./=/g`; \
+	  echo "$$dashes"; \
+	  echo "$$banner"; \
+	  test -z "$$skipped" || echo "$$skipped"; \
+	  test -z "$$report" || echo "$$report"; \
+	  echo "$$dashes"; \
+	  test "$$failed" -eq 0; \
+	else :; fi
+
+distdir: $(DISTFILES)
+	@srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; \
+	topsrcdirstrip=`echo "$(top_srcdir)" | sed 's|.|.|g'`; \
+	list='$(DISTFILES)'; for file in $$list; do \
+	  case $$file in \
+	    $(srcdir)/*) file=`echo "$$file" | sed "s|^$$srcdirstrip/||"`;; \
+	    $(top_srcdir)/*) file=`echo "$$file" | sed "s|^$$topsrcdirstrip/|$(top_builddir)/|"`;; \
+	  esac; \
+	  if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \
+	  dir=`echo "$$file" | sed -e 's,/[^/]*$$,,'`; \
+	  if test "$$dir" != "$$file" && test "$$dir" != "."; then \
+	    dir="/$$dir"; \
+	    $(mkdir_p) "$(distdir)$$dir"; \
+	  else \
+	    dir=''; \
+	  fi; \
+	  if test -d $$d/$$file; then \
+	    if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \
+	      cp -pR $(srcdir)/$$file $(distdir)$$dir || exit 1; \
+	    fi; \
+	    cp -pR $$d/$$file $(distdir)$$dir || exit 1; \
+	  else \
+	    test -f $(distdir)/$$file \
+	    || cp -p $$d/$$file $(distdir)/$$file \
+	    || exit 1; \
+	  fi; \
+	done
+check-am: all-am
+	$(MAKE) $(AM_MAKEFLAGS) check-TESTS
+check: check-am
+all-am: Makefile
+installdirs:
+install: install-am
+install-exec: install-exec-am
+install-data: install-data-am
+uninstall: uninstall-am
+
+install-am: all-am
+	@$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am
+
+installcheck: installcheck-am
+install-strip:
+	$(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \
+	  install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \
+	  `test -z '$(STRIP)' || \
+	    echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install
+mostlyclean-generic:
+
+clean-generic:
+	-test -z "$(CLEANFILES)" || rm -f $(CLEANFILES)
+
+distclean-generic:
+	-test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES)
+
+maintainer-clean-generic:
+	@echo "This command is intended for maintainers to use"
+	@echo "it deletes files that may require special tools to rebuild."
+clean: clean-am
+
+clean-am: clean-generic mostlyclean-am
+
+distclean: distclean-am
+	-rm -f Makefile
+distclean-am: clean-am distclean-generic
+
+dvi: dvi-am
+
+dvi-am:
+
+html: html-am
+
+info: info-am
+
+info-am:
+
+install-data-am:
+
+install-exec-am:
+
+install-info: install-info-am
+
+install-man:
+
+installcheck-am:
+
+maintainer-clean: maintainer-clean-am
+	-rm -f Makefile
+maintainer-clean-am: distclean-am maintainer-clean-generic
+
+mostlyclean: mostlyclean-am
+
+mostlyclean-am: mostlyclean-generic
+
+pdf: pdf-am
+
+pdf-am:
+
+ps: ps-am
+
+ps-am:
+
+uninstall-am: uninstall-info-am
+
+.PHONY: all all-am check check-TESTS check-am clean clean-generic \
+	distclean distclean-generic distdir dvi dvi-am html html-am \
+	info info-am install install-am install-data install-data-am \
+	install-exec install-exec-am install-info install-info-am \
+	install-man install-strip installcheck installcheck-am \
+	installdirs maintainer-clean maintainer-clean-generic \
+	mostlyclean mostlyclean-generic pdf pdf-am ps ps-am uninstall \
+	uninstall-am uninstall-info-am
+
+# Tell versions [3.59,3.63) of GNU make to not export all variables.
+# Otherwise a system limit (for SysV at least) may be exceeded.
+.NOEXPORT:
diff --git a/test/construct_topos.test b/test/construct_topos.test
new file mode 100755
index 0000000..3bd2391
--- /dev/null
+++ b/test/construct_topos.test
@@ -0,0 +1,31 @@
+#! /bin/sh
+
+### Set verbose mode
+test "x$VERBOSE" = "xx" && set -x
+
+### Set environnement
+TOPPREDDATA=$srcdir/../data; export TOPPREDDATA
+TOPPREDOPT='-g none -t none'
+
+### calculation of all topologies is impossible
+base='too_many_put'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.out $srcdir/${base}.out >/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/${base}.err >/dev/null || exit 1
+
+### more topologies than printed
+base='more_calc'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.out $srcdir/${base}.out >/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/${base}.err >/dev/null || exit 1
+
+### found only putative segments -> skip topo without segments
+base='only_put'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.out $srcdir/${base}.out >/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/${base}.err >/dev/null || exit 1
+
+exit 0
diff --git a/test/detect_segments.test b/test/detect_segments.test
new file mode 100755
index 0000000..a6ba050
--- /dev/null
+++ b/test/detect_segments.test
@@ -0,0 +1,31 @@
+#! /bin/sh
+
+### Set verbose mode
+test "x$VERBOSE" = "xx" && set -x
+
+### Set environnement
+TOPPREDDATA=$srcdir/../data; export TOPPREDDATA
+TOPPREDOPT=' -g none -t none'
+
+### detect segment at the beginning of the sequence
+base='first_seg'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.out $srcdir/${base}.out >/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/${base}.err >/dev/null || exit 1
+
+### detect segment at the end of the sequence
+base='last_seg'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.out $srcdir/${base}.out >/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/${base}.err >/dev/null || exit 1
+
+### no segment found
+base='no_seg'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.out $srcdir/${base}.out >/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/${base}.err >/dev/null || exit 1
+
+exit 0
diff --git a/test/first_seg.err b/test/first_seg.err
new file mode 100644
index 0000000..e69de29
diff --git a/test/first_seg.fasta b/test/first_seg.fasta
new file mode 100644
index 0000000..36ccbf4
--- /dev/null
+++ b/test/first_seg.fasta
@@ -0,0 +1,4 @@
+>first TMsegment starts at position 1
+VAKLFADAGLVCITSFISPYTRRRR
+VAKLFADAGLVCITSFISPYTRRRR
+VAKLFAIIIIIIIIIIISPYTRRRR
\ No newline at end of file
diff --git a/test/first_seg.out b/test/first_seg.out
new file mode 100644
index 0000000..7f701f6
--- /dev/null
+++ b/test/first_seg.out
@@ -0,0 +1,67 @@
+Algorithm specific parameters: 
+
+Full window size : 21
+Core window size : 11
+Wedge window size: 5
+Using hydrophobicity file: GES-scale
+
+Cutoff for certain transmembrane segments: 1.00
+Cutoff for putative transmembrane segments: 0.60
+Critical distance between 2 transmembrane segments: 2
+
+Critical loop length:  60
+
+Kingdom: procaryote
+
+Using cyt/ext file: CYTEXT-scale
+
+
+Sequence : first  (75 res)
+VAKLFADAGLVCITSFISPYTRRRRVAKLFADAGLVCITSFISPYTRRRRVAKLFAIIII
+IIIIIIISPYTRRRR
+
+Found: 3 segments
+
+Candidate membrane-spanning segments:
+
+ Helix Begin - End   Score Certainity
+     1     1 - 21    0.960 Putative
+     2    26 - 46    0.960 Putative
+     3    51 - 71    2.310 Certain
+
+Total of 4 structures are to be tested
+
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   1                  1.00         7.00     0.00      1.00    -0.69
+TOPOLOGY                                   N-in        ?      N-in
+CYT_LOOP      1     50     50             11.00  ( -0.15)
+TRANSMEM     51     71     21 1.00 2.31
+EXT_LOOP     72     75      4              4.00  ( -1.01)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   2                  0.90        -6.00     0.00     -3.00     0.00
+TOPOLOGY                                  N-out        ?     N-out
+TRANSMEM      1     21     21 0.90 0.96
+CYT_LOOP     22     50     29             10.00  ( -0.60)
+TRANSMEM     51     71     21 1.00 2.31
+EXT_LOOP     72     75      4              4.00  ( -1.01)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   3                  0.90         5.00     0.00      0.00    -0.71
+TOPOLOGY                                   N-in        ?         ?
+CYT_LOOP      1     25     25              6.00  ( -0.15)
+TRANSMEM     26     46     21 0.90 0.96
+EXT_LOOP     47     50      4              5.00  ( -1.01)
+TRANSMEM     51     71     21 1.00 2.31
+CYT_LOOP     72     75      4              4.00  ( -1.01)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   4                  0.90        -4.00     0.00     -3.00     0.00
+TOPOLOGY                                  N-out        ?     N-out
+TRANSMEM      1     21     21 0.90 0.96
+CYT_LOOP     22     25      4              5.00  ( -1.01)
+TRANSMEM     26     46     21 0.90 0.96
+EXT_LOOP     47     50      4              5.00  ( -1.01)
+TRANSMEM     51     71     21 1.00 2.31
+CYT_LOOP     72     75      4              4.00  ( -1.01)
+//
diff --git a/test/hydro.test b/test/hydro.test
new file mode 100755
index 0000000..7db8094
--- /dev/null
+++ b/test/hydro.test
@@ -0,0 +1,18 @@
+#! /bin/sh
+
+### Set verbose mode
+test "x$VERBOSE" = "xx" && set -x
+
+## Environnement
+TOPPREDDATA=$srcdir/../data; export TOPPREDDATA
+
+## Check hydrophobicity files
+hyd='GES-scale GVH-scale KD-scale'
+for h in $hyd; do
+  ../src/toppred -g none -t none -H $h -o toppred.out $srcdir/seq-test >/dev/null || exit 1
+  grep "^Using hydrophobicity file: $h" toppred.out >/dev/null || exit 1
+done
+
+rm -f toppred.out
+
+exit 0
diff --git a/test/last_seg.err b/test/last_seg.err
new file mode 100644
index 0000000..e69de29
diff --git a/test/last_seg.fasta b/test/last_seg.fasta
new file mode 100644
index 0000000..783578c
--- /dev/null
+++ b/test/last_seg.fasta
@@ -0,0 +1,2 @@
+>last TMsegment ends at end of the sequence
+RRRRRRRRRRVAKLFADAGLVCITSFISPYT
\ No newline at end of file
diff --git a/test/last_seg.out b/test/last_seg.out
new file mode 100644
index 0000000..4cb8ca3
--- /dev/null
+++ b/test/last_seg.out
@@ -0,0 +1,36 @@
+Algorithm specific parameters: 
+
+Full window size : 21
+Core window size : 11
+Wedge window size: 5
+Using hydrophobicity file: GES-scale
+
+Cutoff for certain transmembrane segments: 1.00
+Cutoff for putative transmembrane segments: 0.60
+Critical distance between 2 transmembrane segments: 2
+
+Critical loop length:  60
+
+Kingdom: procaryote
+
+Using cyt/ext file: CYTEXT-scale
+
+
+Sequence : last  (31 res)
+RRRRRRRRRRVAKLFADAGLVCITSFISPYT
+
+Found: 1 segments
+
+Candidate membrane-spanning segments:
+
+ Helix Begin - End   Score Certainity
+     1    11 - 31    0.960 Putative
+
+Total of 2 structures are to be tested
+
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   1                  0.90        11.00     0.00     11.00    -1.00
+TOPOLOGY                                   N-in        ?      N-in
+CYT_LOOP      1     10     10             11.00  ( -1.01)
+TRANSMEM     11     31     21 0.90 0.96
+//
diff --git a/test/math.test b/test/math.test
new file mode 100755
index 0000000..4600328
--- /dev/null
+++ b/test/math.test
@@ -0,0 +1,15 @@
+#! /bin/sh
+
+### Set verbose mode
+test "x$VERBOSE" = "xx" && set -x
+
+## check gnuplot availability
+(gnuplot --version) >/dev/null 2>&1 || exit 77
+
+### Set environnement
+TOPPREDDATA=$srcdir/../data; export TOPPREDDATA
+
+## Call program
+../src/toppred -g png $srcdir/seq_zero_div.fasta >/dev/null 2>&1
+
+exit 0
diff --git a/test/min_seqlen.err b/test/min_seqlen.err
new file mode 100644
index 0000000..e69de29
diff --git a/test/min_seqlen.fasta b/test/min_seqlen.fasta
new file mode 100644
index 0000000..d15bac2
--- /dev/null
+++ b/test/min_seqlen.fasta
@@ -0,0 +1,2 @@
+>window size (default) equal to sequence length
+VAKLFADAIIIIITSFISPYT
\ No newline at end of file
diff --git a/test/min_seqlen.out b/test/min_seqlen.out
new file mode 100644
index 0000000..6a47933
--- /dev/null
+++ b/test/min_seqlen.out
@@ -0,0 +1,35 @@
+Algorithm specific parameters: 
+
+Full window size : 21
+Core window size : 11
+Wedge window size: 5
+Using hydrophobicity file: GES-scale
+
+Cutoff for certain transmembrane segments: 1.00
+Cutoff for putative transmembrane segments: 0.60
+Critical distance between 2 transmembrane segments: 2
+
+Critical loop length:  60
+
+Kingdom: procaryote
+
+Using cyt/ext file: CYTEXT-scale
+
+
+Sequence : window  (21 res)
+VAKLFADAIIIIITSFISPYT
+
+Found: 1 segments
+
+Candidate membrane-spanning segments:
+
+ Helix Begin - End   Score Certainity
+     1     1 - 21    1.210 Certain
+
+Total of 1 structures are to be tested
+
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   1                  1.00         0.00     0.00      1.00     0.00
+TOPOLOGY                                   N-in        ?      N-in
+TRANSMEM      1     21     21 1.00 1.21
+//
diff --git a/test/more_calc.err b/test/more_calc.err
new file mode 100644
index 0000000..98d97a3
--- /dev/null
+++ b/test/more_calc.err
@@ -0,0 +1 @@
+Warning: more: more topologies than printed
diff --git a/test/more_calc.fasta b/test/more_calc.fasta
new file mode 100644
index 0000000..7c9bbfd
--- /dev/null
+++ b/test/more_calc.fasta
@@ -0,0 +1,8 @@
+>more topologies calculated than printed
+RRRRRRRVAKLFADAAAAAAASFISPYTRRRRRRR
+RRRRVAKLFADAGLVCITSFISPYTRRRRRR
+TTTTTTTTTRRRRRRRRRRVAKLFADSSYGLVCITSFISPYTRRRRRR
+VAKLFSDSGLVCITSFISPYTRRRRRRRV
+KKKKKKKKKRVRRRRRRRVAKLFADGLSSVCITSFISPYTRRRRRRRV
+RVRRRRRKKVAKLFADSGLVCIYTSFISPYRRRRRRRV
+RVRRRRRRREEEEEEEEEVAKLFADSPSGELVCITSFIASPYTRRRRRRRV
\ No newline at end of file
diff --git a/test/more_calc.out b/test/more_calc.out
new file mode 100644
index 0000000..ec754e3
--- /dev/null
+++ b/test/more_calc.out
@@ -0,0 +1,256 @@
+Algorithm specific parameters: 
+
+Full window size : 21
+Core window size : 11
+Wedge window size: 5
+Using hydrophobicity file: GES-scale
+
+Cutoff for certain transmembrane segments: 1.00
+Cutoff for putative transmembrane segments: 0.60
+Critical distance between 2 transmembrane segments: 2
+
+Critical loop length:  60
+
+Kingdom: procaryote
+
+Using cyt/ext file: CYTEXT-scale
+
+
+Sequence : more  (280 res)
+RRRRRRRVAKLFADAAAAAAASFISPYTRRRRRRRRRRRVAKLFADAGLVCITSFISPYT
+RRRRRRTTTTTTTTTRRRRRRRRRRVAKLFADSSYGLVCITSFISPYTRRRRRRVAKLFS
+DSGLVCITSFISPYTRRRRRRRVKKKKKKKKKRVRRRRRRRVAKLFADGLSSVCITSFIS
+PYTRRRRRRRVRVRRRRRKKVAKLFADSGLVCIYTSFISPYRRRRRRRVRVRRRRRRREE
+EEEEEEEVAKLFADSPSGELVCITSFIASPYTRRRRRRRV
+
+Found: 7 segments
+
+Candidate membrane-spanning segments:
+
+ Helix Begin - End   Score Certainity
+     1     8 - 28    0.767 Putative
+     2    40 - 60    0.960 Putative
+     3    89 - 109   0.952 Putative
+     4   115 - 135   0.835 Putative
+     5   163 - 183   0.899 Putative
+     6   201 - 221   0.774 Putative
+     7   252 - 272   0.680 Putative
+
+Total of 128 structures are to be tested
+
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   1                  0.42       -46.00     0.00     -4.00    -1.00
+TOPOLOGY                                  N-out        ?     N-out
+EXT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+CYT_LOOP     29     88     60             29.00  ( -0.95)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    114      5              7.00  ( -1.01)
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    200     17             16.00  ( -0.71)
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   2                  0.20       -46.00    -0.76     -4.00    -1.00
+TOPOLOGY                                  N-out     N-in     N-out
+EXT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+CYT_LOOP     29     88     60             29.00  ( -0.95)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    114      5              7.00  ( -1.01)
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    251     68           ( 32.00)   -0.76
+TRANSMEM    252    272     21 0.20 0.68
+CYT_LOOP    273    280      8              7.00  ( -0.73)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   3                  0.42       -44.00    -0.45     -4.00    -1.00
+TOPOLOGY                                  N-out     N-in     N-out
+EXT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+CYT_LOOP     29     88     60             29.00  ( -0.95)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    200     91           ( 48.00)   -0.45
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   4                  0.43        43.00     0.60      6.00    -0.90
+TOPOLOGY                                   N-in    N-out      N-in
+CYT_LOOP      1     39     39             20.00  ( -0.79)
+TRANSMEM     40     60     21 0.90 0.96
+EXT_LOOP     61    200    140           ( 65.00)   -0.60
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   5                  0.42        43.00     0.54     -4.00    -1.00
+TOPOLOGY                                   N-in    N-out     N-out
+CYT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+EXT_LOOP     29     39     11             12.00  ( -1.01)
+TRANSMEM     40     60     21 0.90 0.96
+CYT_LOOP     61    114     54             24.00  ( -0.83)
+TRANSMEM    115    135     21 0.59 0.84
+EXT_LOOP    136    200     65           ( 41.00)   -0.54
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   6                  0.43        42.00     0.00      6.00    -0.90
+TOPOLOGY                                   N-in        ?      N-in
+CYT_LOOP      1     39     39             20.00  ( -0.79)
+TRANSMEM     40     60     21 0.90 0.96
+EXT_LOOP     61     88     28             17.00  ( -0.99)
+TRANSMEM     89    109     21 0.88 0.95
+CYT_LOOP    110    162     53             32.00  ( -0.44)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    200     17             16.00  ( -0.71)
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   7                  0.20        42.00     0.76      6.00    -0.90
+TOPOLOGY                                   N-in    N-out      N-in
+CYT_LOOP      1     39     39             20.00  ( -0.79)
+TRANSMEM     40     60     21 0.90 0.96
+EXT_LOOP     61     88     28             17.00  ( -0.99)
+TRANSMEM     89    109     21 0.88 0.95
+CYT_LOOP    110    162     53             32.00  ( -0.44)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    251     68           ( 32.00)   -0.76
+TRANSMEM    252    272     21 0.20 0.68
+CYT_LOOP    273    280      8              7.00  ( -0.73)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   8                  0.42        40.00     0.83     -4.00    -1.00
+TOPOLOGY                                   N-in    N-out     N-out
+CYT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+EXT_LOOP     29    114     86           ( 36.00)   -0.83
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    200     17             16.00  ( -0.71)
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   9                  0.20        40.00     1.58     -4.00    -1.00
+TOPOLOGY                                   N-in    N-out     N-out
+CYT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+EXT_LOOP     29    114     86           ( 36.00)   -0.83
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    251     68           ( 32.00)   -0.76
+TRANSMEM    252    272     21 0.20 0.68
+CYT_LOOP    273    280      8              7.00  ( -0.73)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY  10                  0.43       -39.00    -0.86      4.00    -0.90
+TOPOLOGY                                  N-out     N-in      N-in
+EXT_LOOP      1     88     88           ( 37.00)   -0.86
+TRANSMEM     89    109     21 0.88 0.95
+CYT_LOOP    110    162     53             32.00  ( -0.44)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    200     17             16.00  ( -0.71)
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY  11                  0.42       -39.00    -0.66     -4.00    -1.00
+TOPOLOGY                                  N-out     N-in     N-out
+EXT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+CYT_LOOP     29     88     60             29.00  ( -0.95)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    114      5              7.00  ( -1.01)
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    280     97           ( 39.00)   -0.66
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY  12                  0.20       -39.00    -1.62      4.00    -0.90
+TOPOLOGY                                  N-out     N-in      N-in
+EXT_LOOP      1     88     88           ( 37.00)   -0.86
+TRANSMEM     89    109     21 0.88 0.95
+CYT_LOOP    110    162     53             32.00  ( -0.44)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    251     68           ( 32.00)   -0.76
+TRANSMEM    252    272     21 0.20 0.68
+CYT_LOOP    273    280      8              7.00  ( -0.73)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY  13                  0.42        38.00     0.00     -4.00    -1.00
+TOPOLOGY                                   N-in        ?     N-out
+CYT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+EXT_LOOP     29     39     11             12.00  ( -1.01)
+TRANSMEM     40     60     21 0.90 0.96
+CYT_LOOP     61     88     28             17.00  ( -0.99)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    114      5              7.00  ( -1.01)
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    200     17             16.00  ( -0.71)
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY  14                  0.20        38.00     0.76     -4.00    -1.00
+TOPOLOGY                                   N-in    N-out     N-out
+CYT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+EXT_LOOP     29     39     11             12.00  ( -1.01)
+TRANSMEM     40     60     21 0.90 0.96
+CYT_LOOP     61     88     28             17.00  ( -0.99)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    114      5              7.00  ( -1.01)
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    251     68           ( 32.00)   -0.76
+TRANSMEM    252    272     21 0.20 0.68
+CYT_LOOP    273    280      8              7.00  ( -0.73)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY  15                  0.42        36.00     0.45     -4.00    -1.00
+TOPOLOGY                                   N-in    N-out     N-out
+CYT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+EXT_LOOP     29     39     11             12.00  ( -1.01)
+TRANSMEM     40     60     21 0.90 0.96
+CYT_LOOP     61     88     28             17.00  ( -0.99)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    200     91           ( 48.00)   -0.45
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    280     59             23.00  ( -0.86)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY  16                  0.20        24.00     0.00     -4.00    -1.00
+TOPOLOGY                                   N-in        ?     N-out
+CYT_LOOP      1      7      7              8.00  ( -1.01)
+TRANSMEM      8     28     21 0.42 0.77
+EXT_LOOP     29     39     11             12.00  ( -1.01)
+TRANSMEM     40     60     21 0.90 0.96
+CYT_LOOP     61     88     28             17.00  ( -0.99)
+TRANSMEM     89    109     21 0.88 0.95
+EXT_LOOP    110    114      5              7.00  ( -1.01)
+TRANSMEM    115    135     21 0.59 0.84
+CYT_LOOP    136    162     27             25.00  ( -0.55)
+TRANSMEM    163    183     21 0.75 0.90
+EXT_LOOP    184    200     17             16.00  ( -0.71)
+TRANSMEM    201    221     21 0.43 0.77
+CYT_LOOP    222    251     30             16.00  ( -1.04)
+TRANSMEM    252    272     21 0.20 0.68
+EXT_LOOP    273    280      8              7.00  ( -0.73)
+//
diff --git a/test/naming.test b/test/naming.test
new file mode 100755
index 0000000..95336e3
--- /dev/null
+++ b/test/naming.test
@@ -0,0 +1,23 @@
+#! /bin/sh
+
+### Set verbose mode
+test "x$VERBOSE" = "xx" && set -x
+
+### Set environnement
+TOPPREDDATA=$srcdir/../data; export TOPPREDDATA
+TOPPREDOPT='-g none -t none'
+
+### is anonymous detection correct
+base='seq_anonymous'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.err $srcdir/${base}.err >/dev/null || exit 1
+
+# what with named sequence
+base='seq-test'
+../src/toppred $TOPPREDOPT $srcdir/${base} >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+grep Q60967 ${base}_tmp.out >/dev/null 2>/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/no_error.err >/dev/null || exit 1
+
+exit 0
diff --git a/test/no_error.err b/test/no_error.err
new file mode 100644
index 0000000..e69de29
diff --git a/test/no_seg.err b/test/no_seg.err
new file mode 100644
index 0000000..e69de29
diff --git a/test/no_seg.fasta b/test/no_seg.fasta
new file mode 100644
index 0000000..dad8395
--- /dev/null
+++ b/test/no_seg.fasta
@@ -0,0 +1,2 @@
+>no segment 
+RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
\ No newline at end of file
diff --git a/test/no_seg.out b/test/no_seg.out
new file mode 100644
index 0000000..da724df
--- /dev/null
+++ b/test/no_seg.out
@@ -0,0 +1,23 @@
+Algorithm specific parameters: 
+
+Full window size : 21
+Core window size : 11
+Wedge window size: 5
+Using hydrophobicity file: GES-scale
+
+Cutoff for certain transmembrane segments: 1.00
+Cutoff for putative transmembrane segments: 0.60
+Critical distance between 2 transmembrane segments: 2
+
+Critical loop length:  60
+
+Kingdom: procaryote
+
+Using cyt/ext file: CYTEXT-scale
+
+
+Sequence : no  (42 res)
+RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR
+
+Found: 0 segments
+
diff --git a/test/only_put.err b/test/only_put.err
new file mode 100644
index 0000000..e69de29
diff --git a/test/only_put.fasta b/test/only_put.fasta
new file mode 100644
index 0000000..ffadef3
--- /dev/null
+++ b/test/only_put.fasta
@@ -0,0 +1,2 @@
+>only putative segments
+RRRVAKLFADAGLVCITSFISPYTRRRRRRRRRRRRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRRR
\ No newline at end of file
diff --git a/test/only_put.out b/test/only_put.out
new file mode 100644
index 0000000..c5c2b3a
--- /dev/null
+++ b/test/only_put.out
@@ -0,0 +1,55 @@
+Algorithm specific parameters: 
+
+Full window size : 21
+Core window size : 11
+Wedge window size: 5
+Using hydrophobicity file: GES-scale
+
+Cutoff for certain transmembrane segments: 1.00
+Cutoff for putative transmembrane segments: 0.60
+Critical distance between 2 transmembrane segments: 2
+
+Critical loop length:  60
+
+Kingdom: procaryote
+
+Using cyt/ext file: CYTEXT-scale
+
+
+Sequence : only  (72 res)
+RRRVAKLFADAGLVCITSFISPYTRRRRRRRRRRRRRRRRRRVAKLFADAGLVCITSFIS
+PYTRRRRRRRRR
+
+Found: 2 segments
+
+Candidate membrane-spanning segments:
+
+ Helix Begin - End   Score Certainity
+     1     4 - 24    0.960 Putative
+     2    43 - 63    0.960 Putative
+
+Total of 4 structures are to be tested
+
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   1                  0.90       -24.00     0.00    -10.00    -1.00
+TOPOLOGY                                  N-out        ?     N-out
+EXT_LOOP      1      3      3              4.00  ( -1.01)
+TRANSMEM      4     24     21 0.90 0.96
+CYT_LOOP     25     72     48             28.00  ( -0.93)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   2                  0.90        14.00     0.00      7.00    -0.92
+TOPOLOGY                                   N-in        ?      N-in
+CYT_LOOP      1     42     42             23.00  ( -0.90)
+TRANSMEM     43     63     21 0.90 0.96
+EXT_LOOP     64     72      9              9.00  ( -1.01)
+//
+HEADER    START   STOP    LEN PROB   HP  DARGLYS  DCYTEXT DNCHARGE DNNEGPOS
+TOPOLOGY   3                  0.90        -6.00     0.00    -10.00    -1.00
+TOPOLOGY                                  N-out        ?     N-out
+EXT_LOOP      1      3      3              4.00  ( -1.01)
+TRANSMEM      4     24     21 0.90 0.96
+CYT_LOOP     25     42     18             19.00  ( -1.01)
+TRANSMEM     43     63     21 0.90 0.96
+EXT_LOOP     64     72      9              9.00  ( -1.01)
+//
diff --git a/test/seq-test b/test/seq-test
new file mode 100644
index 0000000..a938bdd
--- /dev/null
+++ b/test/seq-test
@@ -0,0 +1,12 @@
+>Q60967 PPS1_MOUSE 
+MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
+SGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
+ADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
+EIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVP
+ENKLHLAKTDAEALPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGG
+VINLSVPIVLTATHEDKERLDGCTAFALVYEGRRVAILRNPEFFEHRKEERCARQWGTTC
+KNHPYIKMVLEQGDWLIGGDLQVLDRIYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL
+RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGI
+LDPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPT
+HGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQK
+PPEGFMAPKAWTVLVEYYKSLEKA
diff --git a/test/seq_anonymous.err b/test/seq_anonymous.err
new file mode 100644
index 0000000..9cc9581
--- /dev/null
+++ b/test/seq_anonymous.err
@@ -0,0 +1 @@
+Warning: anonymous sequence: name will be forced to "anonymous"
diff --git a/test/seq_anonymous.fasta b/test/seq_anonymous.fasta
new file mode 100644
index 0000000..02c0ee4
--- /dev/null
+++ b/test/seq_anonymous.fasta
@@ -0,0 +1,3 @@
+>   unamed sequence
+MASTKRKHCALLIVVFWAIICLLVVYAAGPSTEDEDASTPALLIVVFWAIICLLVVYAAH
+STGKKRRKK
diff --git a/test/seq_zero_div.fasta b/test/seq_zero_div.fasta
new file mode 100644
index 0000000..95fc219
--- /dev/null
+++ b/test/seq_zero_div.fasta
@@ -0,0 +1,2 @@
+>, 23 aa.
+XGVSELLISTAVQGILFALLGAX
diff --git a/test/seqlen.test b/test/seqlen.test
new file mode 100755
index 0000000..f1f9b86
--- /dev/null
+++ b/test/seqlen.test
@@ -0,0 +1,17 @@
+#! /bin/sh
+
+### Set verbose mode
+test "x$VERBOSE" = "xx" && set -x
+
+### Set environnement
+TOPPREDDATA=$srcdir/../data; export TOPPREDDATA
+TOPPREDOPT='-g none -t none'
+
+### sequence length equal to window size
+base='min_seqlen'
+../src/toppred $TOPPREDOPT $srcdir/${base}.fasta >${base}_tmp.out 2>${base}_tmp.err || exit 1
+
+diff ${base}_tmp.out $srcdir/min_seqlen.out >/dev/null || exit 1
+diff ${base}_tmp.err $srcdir/min_seqlen.err >/dev/null || exit 1
+
+exit 0
diff --git a/test/too_many_put.err b/test/too_many_put.err
new file mode 100644
index 0000000..3267408
--- /dev/null
+++ b/test/too_many_put.err
@@ -0,0 +1 @@
+Warning: too: too many putative segments to calculate best topologies
diff --git a/test/too_many_put.fasta b/test/too_many_put.fasta
new file mode 100644
index 0000000..6011b9e
--- /dev/null
+++ b/test/too_many_put.fasta
@@ -0,0 +1,24 @@
+>too many putative segments to calculate all topologies
+RRRRRRRVAKLFADAAAAAAASFISPYTRRRRRRR
+RRRRRRRVAKLFADAGLVCITSFISPYTRRRRRR
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRR
+RVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVR
+VRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRR
+RRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
+RRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRV
\ No newline at end of file
diff --git a/test/too_many_put.out b/test/too_many_put.out
new file mode 100644
index 0000000..10d6926
--- /dev/null
+++ b/test/too_many_put.out
@@ -0,0 +1,63 @@
+Algorithm specific parameters: 
+
+Full window size : 21
+Core window size : 11
+Wedge window size: 5
+Using hydrophobicity file: GES-scale
+
+Cutoff for certain transmembrane segments: 1.00
+Cutoff for putative transmembrane segments: 0.60
+Critical distance between 2 transmembrane segments: 2
+
+Critical loop length:  60
+
+Kingdom: procaryote
+
+Using cyt/ext file: CYTEXT-scale
+
+
+Sequence : too  (867 res)
+RRRRRRRVAKLFADAAAAAAASFISPYTRRRRRRRRRRRRRRVAKLFADAGLVCITSFIS
+PYTRRRRRRRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKL
+FADAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRR
+RRVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGL
+VCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVR
+RRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVCITSF
+ISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRRRRRR
+VAKLFADAGLVCITSFISPYTRRRRRRRVRVRVRRRRRRRVAKLFADAGLVCITSFISPY
+TRRRRRRRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFA
+DAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRR
+VRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVC
+ITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRR
+RRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRVRRRRRRRVAKLFADAGLVCITSFIS
+PYTRRRRRRRVRVRVRRRRRRRVAKLFADAGLVCITSFISPYTRRRRRRRVRRRRRRRVA
+KLFADAGLVCITSFISPYTRRRRRRRV
+
+Found: 23 segments
+
+Candidate membrane-spanning segments:
+
+ Helix Begin - End   Score Certainity
+     1     8 - 28    0.767 Putative
+     2    43 - 63    0.960 Putative
+     3    79 - 99    0.960 Putative
+     4   117 - 137   0.960 Putative
+     5   155 - 175   0.960 Putative
+     6   193 - 213   0.960 Putative
+     7   231 - 251   0.960 Putative
+     8   269 - 289   0.960 Putative
+     9   307 - 327   0.960 Putative
+    10   345 - 365   0.960 Putative
+    11   383 - 403   0.960 Putative
+    12   421 - 441   0.960 Putative
+    13   461 - 481   0.960 Putative
+    14   497 - 517   0.960 Putative
+    15   535 - 555   0.960 Putative
+    16   573 - 593   0.960 Putative
+    17   611 - 631   0.960 Putative
+    18   649 - 669   0.960 Putative
+    19   687 - 707   0.960 Putative
+    20   725 - 745   0.960 Putative
+    21   763 - 783   0.960 Putative
+    22   803 - 823   0.960 Putative
+    23   839 - 859   0.960 Putative
diff --git a/test/toppred.test b/test/toppred.test
new file mode 100755
index 0000000..3cf8a02
--- /dev/null
+++ b/test/toppred.test
@@ -0,0 +1,15 @@
+#! /bin/sh
+
+### Set verbose mode
+test "x$VERBOSE" = "xx" && set -x
+
+## Environnement
+TOPPREDDATA=$srcdir/../data; export TOPPREDDATA
+
+## Simple sequence test
+../src/toppred -g none -t none $srcdir/seq-test >/dev/null || exit 1
+
+## Check with more than one input file
+../src/toppred -g none -t none $srcdir/seq-test $srcdir/seq-test >/dev/null || exit 1
+
+exit 0

-- 
Alioth's /usr/local/bin/git-commit-notice on /srv/git.debian.org/git/debian-med/toppred.git



More information about the debian-med-commit mailing list